Accueil

Load Time 4556 ms
Querying Time 3317 ms
Queries 3883
Memory Peak Usage 68.3 Mb
Included Files 1204 files - 13.59 Mb
PrestaShop Cache 2.32 Mb
Global vars 0.43 Mb
PrestaShop Version 8.2.1
PHP Version 8.1.32
MySQL Version 10.11.11-MariaDB-0ubuntu0.24.04.2
Memory Limit 4096M
Max Execution Time 600s
Smarty Cache enabled
Smarty Compilation auto
  Time Cumulated Time Memory Usage Memory Peak Usage
config 2.079 ms 2.079 ms 3.21 Mb 3.6 Mb
__construct 0.029 ms 2.108 ms - Mb 3.6 Mb
init 20.637 ms 22.745 ms 0.89 Mb 4.4 Mb
checkAccess 0.004 ms 22.749 ms - Mb 4.4 Mb
setMedia 15.633 ms 38.382 ms 0.61 Mb 4.7 Mb
postProcess 0.003 ms 38.385 ms - Mb 4.7 Mb
initHeader 0.001 ms 38.386 ms - Mb 4.7 Mb
initContent 3800 ms 3839 ms 41.91 Mb 46.7 Mb
initFooter 0.003 ms 3839 ms - Mb 46.7 Mb
display 717.421 ms 4556 ms 18.54 Mb 68.3 Mb
Hook Time Memory Usage
displayMainMenu 181.660 ms 5.68 Mb
displayLeftColumn 18.602 ms 0.75 Mb
displayFooter 7.939 ms 0.38 Mb
ActionFrontControllerSetMedia 7.712 ms 0.19 Mb
displayNav2 4.819 ms 0.20 Mb
Footer 2.897 ms 0.18 Mb
DisplayHeader 2.700 ms 0.09 Mb
displayNav1 2.045 ms 0.08 Mb
DisplayBeforeBodyClosingTag 1.767 ms 0.05 Mb
DisplayGDPRConsent 1.714 ms 0.08 Mb
renderWidget 1.359 ms 0.05 Mb
ProductSearchProvider 0.543 ms - Mb
DisplayLeftColumn 0.518 ms 0.02 Mb
IsJustElementor 0.373 ms 0.02 Mb
Header 0.122 ms - Mb
OverrideLayoutTemplate 0.064 ms - Mb
DisplayNavFullWidth 0.021 ms - Mb
DisplayFooterBefore 0.018 ms - Mb
displayVerticalMenu 0.015 ms - Mb
ActionDispatcher 0.013 ms - Mb
ActionProductSearchAfter 0.011 ms - Mb
DisplayFooterAfter 0.011 ms - Mb
Top 0.010 ms - Mb
DisplayAfterBodyOpeningTag 0.009 ms - Mb
ModuleRoutes 0.008 ms - Mb
25 hook(s) 234.950 ms 7.75 Mb
Module Time Memory Usage
ps_checkout 10.657 ms 0.22 Mb
iqitthemeeditor 1.171 ms 0.18 Mb
ps_emailsubscription 3.707 ms 0.25 Mb
blockreassurance 0.320 ms 0.02 Mb
nkmgls 4.232 ms 0.30 Mb
paybox 2.259 ms 0.08 Mb
ps_emailalerts 0.257 ms 0.01 Mb
ps_accounts 0.490 ms - Mb
revsliderprestashop 1.996 ms 0.05 Mb
productcomments 0.248 ms 0.01 Mb
ps_shoppingcart 0.119 ms 0.01 Mb
iqitcontactpage 3.189 ms 0.07 Mb
iqitsociallogin 0.272 ms 0.01 Mb
iqitmegamenu 182.031 ms 5.69 Mb
iqitelementor 1.064 ms 0.03 Mb
iqitfreedeliverycount 0.174 ms 0.01 Mb
sendinblue 1.001 ms 0.04 Mb
colissimo_simplicite 2.622 ms 0.09 Mb
lgcookieslaw 3.609 ms 0.19 Mb
ps_facetedsearch 1.692 ms 0.08 Mb
iqithtmlandbanners 2.390 ms 0.16 Mb
ps_languageselector 1.141 ms 0.05 Mb
ps_currencyselector 3.995 ms 0.16 Mb
iqitsearch 1.615 ms - Mb
ps_customersignin 0.089 ms 0.01 Mb
ps_categorytree 18.814 ms 0.75 Mb
iqitlinksmanager 2.356 ms 0.08 Mb
psgdpr 2.056 ms 0.18 Mb
statsdata 1.900 ms 0.05 Mb
29 module(s) 255.466 ms 8.74 Mb

Stopwatch SQL - 3883 queries

# Query Time (ms) Rows Filesort Group By Location
88
SELECT SQL_NO_CACHE p.id_product FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM hgt78_product p LEFT JOIN hgt78_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN hgt78_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN hgt78_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN hgt78_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN hgt78_category_product cp ON (p.id_product = cp.id_product) INNER JOIN hgt78_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN hgt78_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN hgt78_category_group cg ON (cg.id_category = c.id_category) WHERE ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND cp.id_category IN (44, 34) AND p.id_manufacturer='2' GROUP BY p.id_product) p INNER JOIN hgt78_category_product cp ON (p.id_product = cp.id_product) GROUP BY p.id_product ORDER BY p.position ASC, p.id_product DESC
233.942 ms 35424 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
91
SELECT SQL_NO_CACHE cp.id_category, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM hgt78_product p LEFT JOIN hgt78_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN hgt78_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN hgt78_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN hgt78_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN hgt78_category_product cp ON (p.id_product = cp.id_product) INNER JOIN hgt78_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN hgt78_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN hgt78_category_group cg ON (cg.id_category = c.id_category) WHERE ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND p.id_manufacturer='2' GROUP BY p.id_product) p INNER JOIN hgt78_category_product cp ON (p.id_product = cp.id_product) INNER JOIN hgt78_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN hgt78_category_group cg ON (cg.id_category = c.id_category) WHERE cg.id_group='1' AND c.level_depth<=2 AND c.nleft>2 AND c.nright<577 GROUP BY cp.id_category
188.035 ms 22420 /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
99
SELECT SQL_NO_CACHE COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM hgt78_product p LEFT JOIN hgt78_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN hgt78_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN hgt78_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN hgt78_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN hgt78_category_product cp ON (p.id_product = cp.id_product) INNER JOIN hgt78_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN hgt78_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN hgt78_category_group cg ON (cg.id_category = c.id_category) WHERE ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND cp.id_category IN (44, 34) AND p.id_manufacturer='2' GROUP BY p.id_product) p LEFT JOIN hgt78_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN hgt78_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN hgt78_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) WHERE ((sa.out_of_stock=1) OR (sa.quantity>0))
105.203 ms 15852 /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
100
SELECT SQL_NO_CACHE COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM hgt78_product p LEFT JOIN hgt78_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN hgt78_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN hgt78_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN hgt78_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN hgt78_category_product cp ON (p.id_product = cp.id_product) INNER JOIN hgt78_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN hgt78_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN hgt78_category_group cg ON (cg.id_category = c.id_category) WHERE ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND cp.id_category IN (44, 34) AND p.id_manufacturer='2' GROUP BY p.id_product) p LEFT JOIN hgt78_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN hgt78_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN hgt78_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) WHERE ((sa.quantity>0))
85.024 ms 15852 /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
103
SELECT SQL_NO_CACHE p.condition, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM hgt78_product p LEFT JOIN hgt78_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN hgt78_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN hgt78_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN hgt78_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN hgt78_category_product cp ON (p.id_product = cp.id_product) INNER JOIN hgt78_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN hgt78_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN hgt78_category_group cg ON (cg.id_category = c.id_category) WHERE ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND cp.id_category IN (44, 34) AND p.id_manufacturer='2' GROUP BY p.id_product) p GROUP BY p.condition
47.973 ms 1987607054700 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
102
SELECT SQL_NO_CACHE p.id_manufacturer, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM hgt78_product p LEFT JOIN hgt78_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN hgt78_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN hgt78_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN hgt78_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN hgt78_category_product cp ON (p.id_product = cp.id_product) INNER JOIN hgt78_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN hgt78_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN hgt78_category_group cg ON (cg.id_category = c.id_category) WHERE ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND cp.id_category IN (44, 34) GROUP BY p.id_product) p GROUP BY p.id_manufacturer
38.603 ms 3487388177025 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
98
SELECT SQL_NO_CACHE COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM hgt78_product p LEFT JOIN hgt78_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN hgt78_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN hgt78_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN hgt78_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN hgt78_category_product cp ON (p.id_product = cp.id_product) INNER JOIN hgt78_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN hgt78_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN hgt78_category_group cg ON (cg.id_category = c.id_category) WHERE ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND cp.id_category IN (44, 34) AND p.id_manufacturer='2' GROUP BY p.id_product) p LEFT JOIN hgt78_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN hgt78_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN hgt78_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN hgt78_stock_available sa_1 ON (p.id_product = sa_1.id_product AND IFNULL(pac.id_product_attribute, 0) = sa_1.id_product_attribute AND sa_1.id_shop = 1  AND sa_1.id_shop_group = 0 ) WHERE ((sa.quantity<=0 AND sa_1.out_of_stock IN (0, 2)))
19.705 ms 15852 /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
105
SELECT SQL_NO_CACHE psi.price_min, MIN(price_min) as min, MAX(price_max) as max FROM hgt78_product p INNER JOIN hgt78_layered_price_index psi ON (psi.id_product = p.id_product AND psi.id_shop = 1 AND psi.id_currency = 1 AND psi.id_country = 8) INNER JOIN hgt78_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN hgt78_category_product cp ON (p.id_product = cp.id_product) INNER JOIN hgt78_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN hgt78_category_group cg ON (cg.id_category = c.id_category) WHERE ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND cp.id_category IN (44, 34) AND p.id_manufacturer='2'
16.931 ms 77031 /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
104
SELECT SQL_NO_CACHE MIN(p.weight) as min, MAX(p.weight) as max FROM hgt78_product p INNER JOIN hgt78_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN hgt78_category_product cp ON (p.id_product = cp.id_product) INNER JOIN hgt78_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN hgt78_category_group cg ON (cg.id_category = c.id_category) WHERE ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND cp.id_category IN (44, 34) AND p.id_manufacturer='2'
16.719 ms 77031 /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
2
SELECT SQL_NO_CACHE c.`name`, cl.`id_lang`, IF(cl.`id_lang` IS NULL, c.`value`, cl.`value`) AS value, c.id_shop_group, c.id_shop
FROM `hgt78_configuration` c
LEFT JOIN `hgt78_configuration_lang` cl ON (c.`id_configuration` = cl.`id_configuration`)
12.905 ms 5859 /classes/Configuration.php:180
111
SELECT SQL_NO_CACHE p.*,
ps.*,
pl.*,
sa.out_of_stock,
IFNULL(sa.quantity, 0) as quantity,
(DATEDIFF(
p.`date_add`,
DATE_SUB(
'2025-05-01 00:00:00',
INTERVAL 20 DAY
)
) > 0) as new
FROM hgt78_product p
LEFT JOIN hgt78_product_lang pl
ON pl.id_product = p.id_product
AND pl.id_shop = 1
AND pl.id_lang = 1
LEFT JOIN hgt78_stock_available sa   ON sa.id_product = p.id_product
AND sa.id_product_attribute = 0
AND sa.id_shop = 1 LEFT JOIN hgt78_product_shop ps
ON ps.id_product = p.id_product
AND ps.id_shop = 1
WHERE p.id_product IN (3799,3797,3796,3795,2415,2475,2447,2502,2448,2513,2504,2514,2808,2600,2889,2601,2890,2834,2835,2918,2836,2944,2898,2899,3196,3197,2945,3198,3010,3199,3011,3200,3028,3234,3235,3242,3236,3257,3258,3497,3499,3520,3500,3788,3790,3791,3942,3943,3944,3945,3946,3947,3949,3950,3801,3951,3802,3952,3803,4297,4298,4299,4856,4947,5074,5075,5106,5113,5373,3985,5415,3986,5418,3987,5509,3988,5510,3989,3990,6053,6054,3992,6099,3993,6100,3994,6101,3995,6102,3996,6120,3997,3998,3999,3018,4000,8356,4001,8357,4002,8637,4003,9521,4004,10235,4005,10236,10932,4016,4017,4018,4019,4021,4022,4029,4030,4032,4033,4034,4035,4036,4236,4238,4239,4241,4413,4490,4491,4492,4506,4507,4508,4540,4541,4580,4582,4583,4698,4699,4700,4701,4702,4703,4704,4718,4989,5076,5077,5080,5102,5103,5104,5164,5165,5166,5167,5336,5337,5638,5639,4488,4489,3978,3979,3980,3981,3982,3983,3984,2930,4027,5084,5083,5085,5101,5328,5352,5640,5641,5642,6018,6023,6024,6025,6105,6134,6135,8429,8946,8947,8948,8969,8970,9264,9721,9723,9742,9743,9744,9745,9746,9747,9749,9751,9752,9767,9768,9769,9771,9772,9773,9774,9788,9789,9790,9791,9792,9794,9819,9820,9821,9830,9842,9843,9844,9845,9846,9847,9848,9849,9850,9851,9852,10738)
11.342 ms 234 /classes/ProductAssembler.php:95
3861
SELECT SQL_NO_CACHE c.*, cl.*
FROM `hgt78_category` c
INNER JOIN hgt78_category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1)
LEFT JOIN `hgt78_category_lang` cl ON c.`id_category` = cl.`id_category` AND cl.id_shop = 1 
LEFT JOIN `hgt78_category_group` cg ON c.`id_category` = cg.`id_category`
RIGHT JOIN `hgt78_category` c2 ON c2.`id_category` = 2 AND c.`nleft` >= c2.`nleft` AND c.`nright` <= c2.`nright`
WHERE 1 AND c.`level_depth` <= 5 AND `id_lang` = 1
AND c.`active` = 1
AND cg.`id_group` IN (1)
GROUP BY c.`id_category`
ORDER BY c.`level_depth` ASC, category_shop.`position` ASC
7.803 ms 242 Yes Yes /classes/Category.php:799
3455
SELECT SQL_NO_CACHE c.*, cl.*
FROM `hgt78_category` c
INNER JOIN hgt78_category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1)
LEFT JOIN `hgt78_category_lang` cl ON c.`id_category` = cl.`id_category` AND cl.id_shop = 1 
LEFT JOIN `hgt78_category_group` cg ON c.`id_category` = cg.`id_category`
RIGHT JOIN `hgt78_category` c2 ON c2.`id_category` = 40 AND c.`nleft` >= c2.`nleft` AND c.`nright` <= c2.`nright`
WHERE 1  AND `id_lang` = 1
AND c.`active` = 1
AND cg.`id_group` IN (1)
GROUP BY c.`id_category`
ORDER BY c.`level_depth` ASC
, category_shop.`position` ASC
5.540 ms 73 Yes Yes /classes/Category.php:799
3531
SELECT SQL_NO_CACHE c.*, cl.*
FROM `hgt78_category` c
INNER JOIN hgt78_category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1)
LEFT JOIN `hgt78_category_lang` cl ON c.`id_category` = cl.`id_category` AND cl.id_shop = 1 
LEFT JOIN `hgt78_category_group` cg ON c.`id_category` = cg.`id_category`
RIGHT JOIN `hgt78_category` c2 ON c2.`id_category` = 37 AND c.`nleft` >= c2.`nleft` AND c.`nright` <= c2.`nright`
WHERE 1  AND `id_lang` = 1
AND c.`active` = 1
AND cg.`id_group` IN (1)
GROUP BY c.`id_category`
ORDER BY c.`level_depth` ASC
, category_shop.`position` ASC
5.382 ms 148 Yes Yes /classes/Category.php:799
3467
SELECT SQL_NO_CACHE c.*, cl.*
FROM `hgt78_category` c
INNER JOIN hgt78_category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1)
LEFT JOIN `hgt78_category_lang` cl ON c.`id_category` = cl.`id_category` AND cl.id_shop = 1 
LEFT JOIN `hgt78_category_group` cg ON c.`id_category` = cg.`id_category`
RIGHT JOIN `hgt78_category` c2 ON c2.`id_category` = 38 AND c.`nleft` >= c2.`nleft` AND c.`nright` <= c2.`nright`
WHERE 1  AND `id_lang` = 1
AND c.`active` = 1
AND cg.`id_group` IN (1)
GROUP BY c.`id_category`
ORDER BY c.`level_depth` ASC
, category_shop.`position` ASC
5.163 ms 93 Yes Yes /classes/Category.php:799
1087
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 6101 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
4.691 ms 10 Yes /classes/SpecificPrice.php:576
2765
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2890) AND (b.`id_shop` = 1) LIMIT 1
4.499 ms 1 /src/Adapter/EntityMapper.php:71
2792
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3197) AND (b.`id_shop` = 1) LIMIT 1
4.251 ms 1 /src/Adapter/EntityMapper.php:71
3600
SELECT SQL_NO_CACHE c.*, cl.*
FROM `hgt78_category` c
INNER JOIN hgt78_category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1)
LEFT JOIN `hgt78_category_lang` cl ON c.`id_category` = cl.`id_category` AND cl.id_shop = 1 
LEFT JOIN `hgt78_category_group` cg ON c.`id_category` = cg.`id_category`
RIGHT JOIN `hgt78_category` c2 ON c2.`id_category` = 36 AND c.`nleft` >= c2.`nleft` AND c.`nright` <= c2.`nright`
WHERE 1  AND `id_lang` = 1
AND c.`active` = 1
AND cg.`id_group` IN (1)
GROUP BY c.`id_category`
ORDER BY c.`level_depth` ASC
, category_shop.`position` ASC
4.209 ms 73 Yes Yes /classes/Category.php:799
3519
SELECT SQL_NO_CACHE c.*, cl.*
FROM `hgt78_category` c
INNER JOIN hgt78_category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1)
LEFT JOIN `hgt78_category_lang` cl ON c.`id_category` = cl.`id_category` AND cl.id_shop = 1 
LEFT JOIN `hgt78_category_group` cg ON c.`id_category` = cg.`id_category`
RIGHT JOIN `hgt78_category` c2 ON c2.`id_category` = 44 AND c.`nleft` >= c2.`nleft` AND c.`nright` <= c2.`nright`
WHERE 1  AND `id_lang` = 1
AND c.`active` = 1
AND cg.`id_group` IN (1)
GROUP BY c.`id_category`
ORDER BY c.`level_depth` ASC
, category_shop.`position` ASC
4.200 ms 24 Yes Yes /classes/Category.php:799
126
SELECT SQL_NO_CACHE h.id_hook, h.name as h_name, title, description, h.position, hm.position as hm_position, m.id_module, m.name, m.active
FROM `hgt78_hook_module` hm
STRAIGHT_JOIN `hgt78_hook` h ON (h.id_hook = hm.id_hook AND hm.id_shop = 1)
STRAIGHT_JOIN `hgt78_module` as m ON (m.id_module = hm.id_module)
ORDER BY hm.position
3.986 ms 721 /classes/Hook.php:459
610
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3788 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
3.940 ms 10 Yes /classes/SpecificPrice.php:576
2811
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3200
ORDER BY `position`
3.832 ms 1 Yes /classes/Product.php:3545
3616
SELECT SQL_NO_CACHE c.*, cl.*
FROM `hgt78_category` c
INNER JOIN hgt78_category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1)
LEFT JOIN `hgt78_category_lang` cl ON c.`id_category` = cl.`id_category` AND cl.id_shop = 1 
LEFT JOIN `hgt78_category_group` cg ON c.`id_category` = cg.`id_category`
RIGHT JOIN `hgt78_category` c2 ON c2.`id_category` = 39 AND c.`nleft` >= c2.`nleft` AND c.`nright` <= c2.`nright`
WHERE 1  AND `id_lang` = 1
AND c.`active` = 1
AND cg.`id_group` IN (1)
GROUP BY c.`id_category`
ORDER BY c.`level_depth` ASC
, category_shop.`position` ASC
3.513 ms 73 Yes Yes /classes/Category.php:799
125
SELECT SQL_NO_CACHE `id_hook`, `name`
FROM `hgt78_hook`
UNION
SELECT `id_hook`, ha.`alias` as name
FROM `hgt78_hook_alias` ha
INNER JOIN `hgt78_hook` h ON ha.name = h.name
3.424 ms 0 /classes/Hook.php:1348
1076
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3994 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
3.251 ms 10 Yes /classes/SpecificPrice.php:576
3320
SELECT SQL_NO_CACHE h.`name` as hook, m.`id_module`, h.`id_hook`, m.`name` as module
FROM `hgt78_module` m
INNER JOIN hgt78_module_shop module_shop
ON (module_shop.id_module = m.id_module AND module_shop.id_shop = 1 AND module_shop.enable_device & 1)
INNER JOIN `hgt78_hook_module` `hm` ON hm.`id_module` = m.`id_module`
INNER JOIN `hgt78_hook` `h` ON hm.`id_hook` = h.`id_hook`
LEFT JOIN `hgt78_module_group` `mg` ON mg.`id_module` = m.`id_module`
WHERE (h.`name` != "paymentOptions") AND (hm.`id_shop` = 1) AND (mg.id_shop = 1 AND  mg.`id_group` IN (1))
GROUP BY hm.id_hook, hm.id_module
ORDER BY hm.`position`
3.028 ms 219 Yes Yes /classes/Hook.php:1289
577
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3499 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
2.905 ms 10 Yes /classes/SpecificPrice.php:576
1761
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 5077 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
2.874 ms 10 Yes /classes/SpecificPrice.php:576
3139
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4702) AND (b.`id_shop` = 1) LIMIT 1
2.832 ms 1 /src/Adapter/EntityMapper.php:71
581
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3499) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
2.805 ms 1 /classes/stock/StockAvailable.php:453
798
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4298 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
2.804 ms 10 Yes /classes/SpecificPrice.php:576
141
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3797 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
2.769 ms 10 Yes /classes/SpecificPrice.php:576
760
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3802
ORDER BY f.position ASC
2.738 ms 5 Yes /classes/Product.php:6021
90
SELECT SQL_NO_CACHE c.`id_category`, cl.`name`
FROM `hgt78_category` c
INNER JOIN hgt78_category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1)
LEFT JOIN `hgt78_category_lang` cl ON c.`id_category` = cl.`id_category` AND cl.id_shop = 1 
WHERE 1  AND `id_lang` = 1
AND c.`active` = 1
ORDER BY c.nleft, c.position
2.727 ms 295 Yes /classes/Category.php:724
1352
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4018 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
2.709 ms 10 Yes /classes/SpecificPrice.php:576
921
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3986 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
2.686 ms 10 Yes /classes/SpecificPrice.php:576
776
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3803 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
2.655 ms 10 Yes /classes/SpecificPrice.php:576
1330
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4016 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
2.627 ms 10 Yes /classes/SpecificPrice.php:576
3586
SELECT SQL_NO_CACHE c.*, cl.*
FROM `hgt78_category` c
INNER JOIN hgt78_category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1)
LEFT JOIN `hgt78_category_lang` cl ON c.`id_category` = cl.`id_category` AND cl.id_shop = 1 
LEFT JOIN `hgt78_category_group` cg ON c.`id_category` = cg.`id_category`
RIGHT JOIN `hgt78_category` c2 ON c2.`id_category` = 33 AND c.`nleft` >= c2.`nleft` AND c.`nright` <= c2.`nright`
WHERE 1  AND `id_lang` = 1
AND c.`active` = 1
AND cg.`id_group` IN (1)
GROUP BY c.`id_category`
ORDER BY c.`level_depth` ASC
, category_shop.`position` ASC
2.615 ms 7 Yes Yes /classes/Category.php:799
3693
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (5373) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
2.589 ms 1 Yes Yes /classes/Product.php:4524
860
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 5075 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 5075 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
2.587 ms 0 /classes/Cart.php:1430
3452
SELECT SQL_NO_CACHE hs.`id_tab` as id_tab, hssl.`title`, hssl.`label`, hssl.`url`,
hss.`position`,  hss.`active_label`, hss.`url_type`, hss.`id_url`, hss.`icon_type`, hss.`icon_class`, hss.`icon`, hss.`legend_icon`,
hss.`new_window`, hss.`float`, hss.`submenu_type`, hss.`submenu_content`, hss.`submenu_width`, hss.`group_access`
FROM hgt78_iqitmegamenu_tabs_shop hs
LEFT JOIN hgt78_iqitmegamenu_tabs hss ON (hs.id_tab = hss.id_tab)
LEFT JOIN hgt78_iqitmegamenu_tabs_lang hssl ON (hss.id_tab = hssl.id_tab)
WHERE id_shop = 1 AND menu_type = 1 AND active = 1
AND hssl.id_lang = 1
ORDER BY hss.position
2.580 ms 12 Yes /modules/iqitmegamenu/models/IqitMenuTab.php:178
14
SELECT SQL_NO_CACHE h.`name` as hook, m.`id_module`, h.`id_hook`, m.`name` as module
FROM `hgt78_module` m
INNER JOIN hgt78_module_shop module_shop
ON (module_shop.id_module = m.id_module AND module_shop.id_shop = 1 AND module_shop.enable_device & 1)
INNER JOIN `hgt78_hook_module` `hm` ON hm.`id_module` = m.`id_module`
INNER JOIN `hgt78_hook` `h` ON hm.`id_hook` = h.`id_hook`
LEFT JOIN `hgt78_module_group` `mg` ON mg.`id_module` = m.`id_module`
WHERE (h.`name` != "paymentOptions") AND (hm.`id_shop` = 1) AND (mg.id_shop = 1 AND  mg.`id_group` IN (1))
GROUP BY hm.id_hook, hm.id_module
ORDER BY hm.`position`
2.543 ms 219 Yes Yes /classes/Hook.php:1289
932
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 5418 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
2.537 ms 10 Yes /classes/SpecificPrice.php:576
467
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3011 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
2.498 ms 10 Yes /classes/SpecificPrice.php:576
1728
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4718 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
2.490 ms 10 Yes /classes/SpecificPrice.php:576
152
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3796 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
2.478 ms 3 Yes /classes/SpecificPrice.php:576
1095
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 78 LIMIT 1
2.467 ms 1 /classes/Product.php:5659
2819
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3235) AND (b.`id_shop` = 1) LIMIT 1
2.454 ms 1 /src/Adapter/EntityMapper.php:71
2269
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 9264 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
2.431 ms 10 Yes /classes/SpecificPrice.php:576
1242
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 8637 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
2.353 ms 10 Yes /classes/SpecificPrice.php:576
2307
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 9742 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 9742 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
2.335 ms 0 /classes/Cart.php:1430
1695
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4702 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
2.320 ms 10 Yes /classes/SpecificPrice.php:576
2795
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2945) AND (b.`id_shop` = 1) LIMIT 1
2.304 ms 1 /src/Adapter/EntityMapper.php:71
792
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4297 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4297 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
2.303 ms 0 /classes/Cart.php:1430
93
SELECT SQL_NO_CACHE pac.id_attribute, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM hgt78_product p LEFT JOIN hgt78_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN hgt78_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN hgt78_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN hgt78_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN hgt78_category_product cp ON (p.id_product = cp.id_product) INNER JOIN hgt78_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN hgt78_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN hgt78_category_group cg ON (cg.id_category = c.id_category) WHERE ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND cp.id_category IN (44, 34) AND p.id_manufacturer='2' GROUP BY p.id_product) p LEFT JOIN hgt78_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN hgt78_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) INNER JOIN hgt78_attribute a ON (a.id_attribute = pac.id_attribute) WHERE ((a.id_attribute_group=1)) GROUP BY pac.id_attribute
2.293 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
2924
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3985) AND (b.`id_shop` = 1) LIMIT 1
2.285 ms 1 /src/Adapter/EntityMapper.php:71
423
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2945 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
2.273 ms 10 Yes /classes/SpecificPrice.php:576
3489
SELECT SQL_NO_CACHE c.*, cl.*
FROM `hgt78_category` c
INNER JOIN hgt78_category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1)
LEFT JOIN `hgt78_category_lang` cl ON c.`id_category` = cl.`id_category` AND cl.id_shop = 1 
LEFT JOIN `hgt78_category_group` cg ON c.`id_category` = cg.`id_category`
RIGHT JOIN `hgt78_category` c2 ON c2.`id_category` = 41 AND c.`nleft` >= c2.`nleft` AND c.`nright` <= c2.`nright`
WHERE 1  AND `id_lang` = 1
AND c.`active` = 1
AND cg.`id_group` IN (1)
GROUP BY c.`id_category`
ORDER BY c.`level_depth` ASC
, category_shop.`position` ASC
2.263 ms 7 Yes Yes /classes/Category.php:799
2816
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3234) AND (b.`id_shop` = 1) LIMIT 1
2.261 ms 1 /src/Adapter/EntityMapper.php:71
1209
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4001 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
2.238 ms 10 Yes /classes/SpecificPrice.php:576
1253
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4003 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
2.238 ms 10 Yes /classes/SpecificPrice.php:576
96
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM hgt78_product p LEFT JOIN hgt78_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN hgt78_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN hgt78_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN hgt78_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN hgt78_category_product cp ON (p.id_product = cp.id_product) INNER JOIN hgt78_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN hgt78_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN hgt78_category_group cg ON (cg.id_category = c.id_category) WHERE ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND cp.id_category IN (44, 34) AND p.id_manufacturer='2' GROUP BY p.id_product) p INNER JOIN hgt78_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature=1)) GROUP BY fp.id_feature_value
2.233 ms 32 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
1772
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 5080 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
2.231 ms 10 Yes /classes/SpecificPrice.php:576
1081
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3994 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3994 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
2.227 ms 0 /classes/Cart.php:1430
2803
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3010
2.222 ms 1 /classes/Product.php:2902
671
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3944 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3944 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
2.219 ms 0 /classes/Cart.php:1430
97
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM hgt78_product p LEFT JOIN hgt78_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN hgt78_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN hgt78_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN hgt78_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN hgt78_category_product cp ON (p.id_product = cp.id_product) INNER JOIN hgt78_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN hgt78_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN hgt78_category_group cg ON (cg.id_category = c.id_category) WHERE ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND cp.id_category IN (44, 34) AND p.id_manufacturer='2' GROUP BY p.id_product) p INNER JOIN hgt78_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature=2)) GROUP BY fp.id_feature_value
2.215 ms 32 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
472
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3011 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3011 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
2.202 ms 0 /classes/Cart.php:1430
333
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2835 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
2.176 ms 10 Yes /classes/SpecificPrice.php:576
770
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3952 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3952 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
2.174 ms 0 /classes/Cart.php:1430
2142
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 6023 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 6023 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
2.160 ms 0 /classes/Cart.php:1430
84
SELECT SQL_NO_CACHE c.*, cl.*
FROM `hgt78_category` c
LEFT JOIN `hgt78_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 )
WHERE `name` = 'Bien-etre'
AND c.`id_category` != 2
AND c.`id_parent` = 2 LIMIT 1
2.158 ms 7 /classes/Category.php:1500
632
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3791 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
2.140 ms 10 Yes /classes/SpecificPrice.php:576
412
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3197 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
2.131 ms 10 Yes /classes/SpecificPrice.php:576
677
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3945 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
2.130 ms 10 Yes /classes/SpecificPrice.php:576
417
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3197 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3197 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
2.125 ms 0 /classes/Cart.php:1430
1032
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3992 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
2.114 ms 10 Yes /classes/SpecificPrice.php:576
401
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3196 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
2.103 ms 10 Yes /classes/SpecificPrice.php:576
1198
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 8356 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
2.095 ms 10 Yes /classes/SpecificPrice.php:576
572
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3497
ORDER BY f.position ASC
2.086 ms 5 Yes /classes/Product.php:6021
2291
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 9723 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
2.086 ms 11 Yes /classes/SpecificPrice.php:576
682
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3945 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3945 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
2.081 ms 0 /classes/Cart.php:1430
1093
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 6101
ORDER BY f.position ASC
2.079 ms 5 Yes /classes/Product.php:6021
2990
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3997) AND (b.`id_shop` = 1) LIMIT 1
2.072 ms 1 /src/Adapter/EntityMapper.php:71
1706
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4703 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
2.071 ms 10 Yes /classes/SpecificPrice.php:576
1220
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 8357 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
2.064 ms 10 Yes /classes/SpecificPrice.php:576
2577
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 9830 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
2.056 ms 11 Yes /classes/SpecificPrice.php:576
3696
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3986) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
2.043 ms 1 Yes Yes /classes/Product.php:4524
699
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3947 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
2.023 ms 10 Yes /classes/SpecificPrice.php:576
533
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3236 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
2.015 ms 10 Yes /classes/SpecificPrice.php:576
937
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 5418 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 5418 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.999 ms 0 /classes/Cart.php:1430
621
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3790 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.993 ms 10 Yes /classes/SpecificPrice.php:576
2984
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3996) AND (b.`id_shop` = 1) LIMIT 1
1.977 ms 1 /src/Adapter/EntityMapper.php:71
254
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2514 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.975 ms 10 Yes /classes/SpecificPrice.php:576
570
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3497) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
1.971 ms 1 /classes/stock/StockAvailable.php:453
3316
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 9746) AND (b.`id_shop` = 1) LIMIT 1
1.964 ms 1 /src/Adapter/EntityMapper.php:71
478
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3200 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.957 ms 10 Yes /classes/SpecificPrice.php:576
1717
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4704 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.955 ms 10 Yes /classes/SpecificPrice.php:576
615
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3788 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3788 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.934 ms 0 /classes/Cart.php:1430
781
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3803 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3803 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.931 ms 0 /classes/Cart.php:1430
1982
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3983 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.919 ms 10 Yes /classes/SpecificPrice.php:576
765
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3952 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.912 ms 10 Yes /classes/SpecificPrice.php:576
421
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2945 LIMIT 1
1.910 ms 10 /classes/SpecificPrice.php:435
787
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4297 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.904 ms 10 Yes /classes/SpecificPrice.php:576
2771
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2835) AND (b.`id_shop` = 1) LIMIT 1
1.903 ms 1 /src/Adapter/EntityMapper.php:71
861
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 5075
ORDER BY f.position ASC
1.898 ms 5 Yes /classes/Product.php:6021
1109
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 6102 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.895 ms 10 Yes /classes/SpecificPrice.php:576
3690
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (5075) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.886 ms 1 Yes Yes /classes/Product.php:4524
1131
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 6120 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.882 ms 3 Yes /classes/SpecificPrice.php:576
134
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3799 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3799 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.880 ms 0 /classes/Cart.php:1430
1335
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4016 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4016 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.873 ms 0 /classes/Cart.php:1430
186
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2475 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.861 ms 10 Yes /classes/SpecificPrice.php:576
3768
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4704) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.829 ms 1 Yes Yes /classes/Product.php:4524
3788
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3979) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.828 ms 1 Yes Yes /classes/Product.php:4524
833
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4947 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.827 ms 11 Yes /classes/SpecificPrice.php:576
3771
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (5076) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.823 ms 1 Yes Yes /classes/Product.php:4524
737
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3801 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3801 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.822 ms 0 /classes/Cart.php:1430
1739
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4989 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.821 ms 10 Yes /classes/SpecificPrice.php:576
1158
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3998 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3998 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.811 ms 0 /classes/Cart.php:1430
3720
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4000) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.804 ms 1 Yes Yes /classes/Product.php:4524
3627
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3796) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.803 ms 1 Yes Yes /classes/Product.php:4524
2335
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 9745 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.798 ms 11 Yes /classes/SpecificPrice.php:576
345
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2918 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.795 ms 10 Yes /classes/SpecificPrice.php:576
3736
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4019) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.794 ms 1 Yes Yes /classes/Product.php:4524
545
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3257)
1.792 ms 1 /classes/Product.php:3860
1114
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 6102 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 6102 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.780 ms 0 /classes/Cart.php:1430
511
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3235 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.778 ms 10 Yes /classes/SpecificPrice.php:576
1103
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3995 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3995 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.771 ms 0 /classes/Cart.php:1430
220
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2448 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.768 ms 10 Yes /classes/SpecificPrice.php:576
1750
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 5076 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.768 ms 10 Yes /classes/SpecificPrice.php:576
3184
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 5336) AND (b.`id_shop` = 1) LIMIT 1
1.760 ms 1 /src/Adapter/EntityMapper.php:71
2368
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 9749 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.757 ms 11 Yes /classes/SpecificPrice.php:576
2280
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 9721 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.751 ms 11 Yes /classes/SpecificPrice.php:576
3628
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3795) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.749 ms 1 Yes Yes /classes/Product.php:4524
3789
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3980) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.745 ms 1 Yes Yes /classes/Product.php:4524
2813
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3028) AND (b.`id_shop` = 1) LIMIT 1
1.740 ms 1 /src/Adapter/EntityMapper.php:71
544
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3257 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.739 ms 10 Yes /classes/SpecificPrice.php:576
266
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2808 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.736 ms 10 Yes /classes/SpecificPrice.php:576
3629
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2415) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.734 ms 1 Yes Yes /classes/Product.php:4524
3205
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3979) AND (b.`id_shop` = 1) LIMIT 1
1.728 ms 1 /src/Adapter/EntityMapper.php:71
3773
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (5080) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.725 ms 1 Yes Yes /classes/Product.php:4524
3734
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4017) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.718 ms 1 Yes Yes /classes/Product.php:4524
389
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2899 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.715 ms 10 Yes /classes/SpecificPrice.php:576
2340
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 9745 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 9745 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.714 ms 0 /classes/Cart.php:1430
643
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3942 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.713 ms 10 Yes /classes/SpecificPrice.php:576
2373
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 9749 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 9749 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.708 ms 0 /classes/Cart.php:1430
803
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4298 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4298 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.705 ms 0 /classes/Cart.php:1430
1700
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4702 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4702 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.705 ms 0 /classes/Cart.php:1430
3735
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4018) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.701 ms 1 Yes Yes /classes/Product.php:4524
782
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3803
ORDER BY f.position ASC
1.700 ms 5 Yes /classes/Product.php:6021
743
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3951 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.699 ms 10 Yes /classes/SpecificPrice.php:576
1684
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4701 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.697 ms 10 Yes /classes/SpecificPrice.php:576
394
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2899 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2899 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.692 ms 0 /classes/Cart.php:1430
1120
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3996 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.683 ms 10 Yes /classes/SpecificPrice.php:576
174
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2415 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.677 ms 10 Yes /classes/SpecificPrice.php:576
3103
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4506) AND (b.`id_shop` = 1) LIMIT 1
1.672 ms 1 /src/Adapter/EntityMapper.php:71
2822
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3242) AND (b.`id_shop` = 1) LIMIT 1
1.671 ms 1 /src/Adapter/EntityMapper.php:71
153
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3796)
1.670 ms 1 /classes/Product.php:3860
844
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 5074 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.667 ms 10 Yes /classes/SpecificPrice.php:576
826
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4856 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4856 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.663 ms 0 /classes/Cart.php:1430
566
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3497 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.661 ms 11 Yes /classes/SpecificPrice.php:576
522
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3242 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.658 ms 10 Yes /classes/SpecificPrice.php:576
596
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 44 LIMIT 1
1.653 ms 1 /classes/Product.php:5659
3100
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4492) AND (b.`id_shop` = 1) LIMIT 1
1.653 ms 1 /src/Adapter/EntityMapper.php:71
2955
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 6053
ORDER BY `position`
1.650 ms 1 Yes /classes/Product.php:3545
3134
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4700
ORDER BY `position`
1.650 ms 1 Yes /classes/Product.php:3545
3091
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4413) AND (b.`id_shop` = 1) LIMIT 1
1.646 ms 1 /src/Adapter/EntityMapper.php:71
2104
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 5641 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.645 ms 10 Yes /classes/SpecificPrice.php:576
288
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2889 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.644 ms 10 Yes /classes/SpecificPrice.php:576
3790
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3981) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.644 ms 1 Yes Yes /classes/Product.php:4524
163
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3795 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.643 ms 10 Yes /classes/SpecificPrice.php:576
3160
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 5080) AND (b.`id_shop` = 1) LIMIT 1
1.640 ms 1 /src/Adapter/EntityMapper.php:71
1054
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3993 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.638 ms 10 Yes /classes/SpecificPrice.php:576
866
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 5106 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.637 ms 10 Yes /classes/SpecificPrice.php:576
3181
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 5167) AND (b.`id_shop` = 1) LIMIT 1
1.631 ms 1 /src/Adapter/EntityMapper.php:71
2800
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3198
1.629 ms 1 /classes/Product.php:2902
3764
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4700) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.627 ms 1 Yes Yes /classes/Product.php:4524
2621
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 9845 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.626 ms 11 Yes /classes/SpecificPrice.php:576
1788
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 5102 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 5102 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.625 ms 0 /classes/Cart.php:1430
1794
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 5103 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.625 ms 10 Yes /classes/SpecificPrice.php:576
1689
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4701 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4701 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.624 ms 0 /classes/Cart.php:1430
3136
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4701) AND (b.`id_shop` = 1) LIMIT 1
1.622 ms 1 /src/Adapter/EntityMapper.php:71
3163
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 5102) AND (b.`id_shop` = 1) LIMIT 1
1.621 ms 1 /src/Adapter/EntityMapper.php:71
2993
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3998) AND (b.`id_shop` = 1) LIMIT 1
1.618 ms 1 /src/Adapter/EntityMapper.php:71
2753
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2808) AND (b.`id_shop` = 1) LIMIT 1
1.617 ms 1 /src/Adapter/EntityMapper.php:71
3515
SELECT SQL_NO_CACHE c.*, cl.*
FROM `hgt78_category` c
INNER JOIN hgt78_category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1)
LEFT JOIN `hgt78_category_lang` cl ON c.`id_category` = cl.`id_category` AND cl.id_shop = 1 
LEFT JOIN `hgt78_category_group` cg ON c.`id_category` = cg.`id_category`
RIGHT JOIN `hgt78_category` c2 ON c2.`id_category` = 35 AND c.`nleft` >= c2.`nleft` AND c.`nright` <= c2.`nright`
WHERE 1  AND `id_lang` = 1
AND c.`active` = 1
AND cg.`id_group` IN (1)
GROUP BY c.`id_category`
ORDER BY c.`level_depth` ASC
, category_shop.`position` ASC
1.617 ms 27 Yes Yes /classes/Category.php:799
3740
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4030) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.617 ms 1 Yes Yes /classes/Product.php:4524
1175
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3018 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.610 ms 11 Yes /classes/SpecificPrice.php:576
500
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3234 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.607 ms 10 Yes /classes/SpecificPrice.php:576
1214
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4001 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4001 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.606 ms 0 /classes/Cart.php:1430
1098
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3995 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.604 ms 10 Yes /classes/SpecificPrice.php:576
1225
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 8357 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 8357 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.604 ms 0 /classes/Cart.php:1430
3761
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4583) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.594 ms 1 Yes Yes /classes/Product.php:4524
809
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4299 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.591 ms 10 Yes /classes/SpecificPrice.php:576
3691
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (5106) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.587 ms 1 Yes Yes /classes/Product.php:4524
3632
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2502) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.586 ms 1 Yes Yes /classes/Product.php:4524
435
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3198)
1.585 ms 1 /classes/Product.php:3860
3737
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4021) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.583 ms 1 Yes Yes /classes/Product.php:4524
2810
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3200) AND (b.`id_shop` = 1) LIMIT 1
1.581 ms 1 /src/Adapter/EntityMapper.php:71
3723
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (8357) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.581 ms 1 Yes Yes /classes/Product.php:4524
710
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3949 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.579 ms 10 Yes /classes/SpecificPrice.php:576
2750
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2514) AND (b.`id_shop` = 1) LIMIT 1
1.579 ms 1 /src/Adapter/EntityMapper.php:71
3076
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4036) AND (b.`id_shop` = 1) LIMIT 1
1.577 ms 1 /src/Adapter/EntityMapper.php:71
2308
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 9742
ORDER BY f.position ASC
1.576 ms 5 Yes /classes/Product.php:6021
1319
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 10932 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.574 ms 10 Yes /classes/SpecificPrice.php:576
2143
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 6023
ORDER BY f.position ASC
1.574 ms 5 Yes /classes/Product.php:6021
427
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2945) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
1.573 ms 1 /classes/stock/StockAvailable.php:453
538
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3236 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3236 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.571 ms 0 /classes/Cart.php:1430
3361
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 9790) AND (b.`id_shop` = 1) LIMIT 1
1.570 ms 1 /src/Adapter/EntityMapper.php:71
3142
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4703) AND (b.`id_shop` = 1) LIMIT 1
1.569 ms 1 /src/Adapter/EntityMapper.php:71
3762
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4698) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.567 ms 1 Yes Yes /classes/Product.php:4524
450
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3010 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3010 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.563 ms 0 /classes/Cart.php:1430
3738
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4022) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.562 ms 1 Yes Yes /classes/Product.php:4524
3625
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3799) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.556 ms 1 Yes Yes /classes/Product.php:4524
1324
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 10932 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 10932 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.556 ms 0 /classes/Cart.php:1430
1347
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4017
ORDER BY f.position ASC
1.555 ms 5 Yes /classes/Product.php:6021
704
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3947 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3947 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.540 ms 0 /classes/Cart.php:1430
3626
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3797) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.540 ms 1 Yes Yes /classes/Product.php:4524
3791
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3982) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.539 ms 1 Yes Yes /classes/Product.php:4524
1164
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3999 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.535 ms 10 Yes /classes/SpecificPrice.php:576
827
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4856
ORDER BY f.position ASC
1.534 ms 5 Yes /classes/Product.php:6021
2726
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3795) AND (b.`id_shop` = 1) LIMIT 1
1.529 ms 1 /src/Adapter/EntityMapper.php:71
3038
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 10932) AND (b.`id_shop` = 1) LIMIT 1
1.527 ms 1 /src/Adapter/EntityMapper.php:71
1799
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 5103 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 5103 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.524 ms 0 /classes/Cart.php:1430
2999
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3018) AND (b.`id_shop` = 1) LIMIT 1
1.524 ms 1 /src/Adapter/EntityMapper.php:71
793
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4297
ORDER BY f.position ASC
1.519 ms 5 Yes /classes/Product.php:6021
2313
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 9743 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.519 ms 11 Yes /classes/SpecificPrice.php:576
3787
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3978) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.519 ms 1 Yes Yes /classes/Product.php:4524
424
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2945)
1.517 ms 1 /classes/Product.php:3860
524
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3242 AND id_shop=1 LIMIT 1
1.515 ms 1 /classes/Product.php:6876
534
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3236)
1.511 ms 1 /classes/Product.php:3860
3157
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 5077) AND (b.`id_shop` = 1) LIMIT 1
1.510 ms 1 /src/Adapter/EntityMapper.php:71
3631
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2447) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.510 ms 1 Yes Yes /classes/Product.php:4524
209
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2502 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.506 ms 10 Yes /classes/SpecificPrice.php:576
1203
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 8356 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 8356 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.506 ms 0 /classes/Cart.php:1430
3073
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4035) AND (b.`id_shop` = 1) LIMIT 1
1.505 ms 1 /src/Adapter/EntityMapper.php:71
1755
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 5076 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 5076 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.505 ms 0 /classes/Cart.php:1430
3739
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4029) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.504 ms 1 Yes Yes /classes/Product.php:4524
3319
SELECT SQL_NO_CACHE lower(name) as name
FROM `hgt78_hook` h
WHERE (h.active = 1)
1.503 ms 1185 /classes/Hook.php:1388
197
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2447 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.502 ms 10 Yes /classes/SpecificPrice.php:576
2972
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3994) AND (b.`id_shop` = 1) LIMIT 1
1.502 ms 1 /src/Adapter/EntityMapper.php:71
3094
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4490) AND (b.`id_shop` = 1) LIMIT 1
1.502 ms 1 /src/Adapter/EntityMapper.php:71
821
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4856 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.502 ms 10 Yes /classes/SpecificPrice.php:576
1783
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 5102 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.499 ms 10 Yes /classes/SpecificPrice.php:576
3145
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4704) AND (b.`id_shop` = 1) LIMIT 1
1.499 ms 1 /src/Adapter/EntityMapper.php:71
2987
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 6120) AND (b.`id_shop` = 1) LIMIT 1
1.493 ms 1 /src/Adapter/EntityMapper.php:71
338
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2835 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2835 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.492 ms 0 /classes/Cart.php:1430
554
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3258
ORDER BY `id_specific_price_priority` DESC LIMIT 1
1.492 ms 0 /classes/SpecificPrice.php:259
2759
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2889) AND (b.`id_shop` = 1) LIMIT 1
1.488 ms 1 /src/Adapter/EntityMapper.php:71
362
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2836
ORDER BY f.position ASC
1.486 ms 5 Yes /classes/Product.php:6021
3313
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 9745) AND (b.`id_shop` = 1) LIMIT 1
1.482 ms 1 /src/Adapter/EntityMapper.php:71
560
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3258 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3258 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.481 ms 0 /classes/Cart.php:1430
95
SELECT SQL_NO_CACHE pac.id_attribute, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM hgt78_product p LEFT JOIN hgt78_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN hgt78_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN hgt78_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN hgt78_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN hgt78_category_product cp ON (p.id_product = cp.id_product) INNER JOIN hgt78_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN hgt78_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN hgt78_category_group cg ON (cg.id_category = c.id_category) WHERE ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND cp.id_category IN (44, 34) AND p.id_manufacturer='2' GROUP BY p.id_product) p LEFT JOIN hgt78_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN hgt78_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) INNER JOIN hgt78_attribute a ON (a.id_attribute = pac.id_attribute) WHERE ((a.id_attribute_group=2)) GROUP BY pac.id_attribute
1.481 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
85
SELECT SQL_NO_CACHE ag.id_attribute_group, agl.public_name as attribute_group_name, is_color_group, IF(liaglv.`url_name` IS NULL OR liaglv.`url_name` = "", NULL, liaglv.`url_name`) AS url_name, IF(liaglv.`meta_title` IS NULL OR liaglv.`meta_title` = "", NULL, liaglv.`meta_title`) AS meta_title, IFNULL(liag.indexable, TRUE) AS indexable FROM `hgt78_attribute_group` ag  INNER JOIN hgt78_attribute_group_shop attribute_group_shop
ON (attribute_group_shop.id_attribute_group = ag.id_attribute_group AND attribute_group_shop.id_shop = 1) LEFT JOIN `hgt78_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1) LEFT JOIN `hgt78_layered_indexable_attribute_group` liag ON (ag.`id_attribute_group` = liag.`id_attribute_group`) LEFT JOIN `hgt78_layered_indexable_attribute_group_lang_value` AS liaglv ON (ag.`id_attribute_group` = liaglv.`id_attribute_group` AND agl.`id_lang` = 1) GROUP BY ag.id_attribute_group ORDER BY ag.`position` ASC
1.473 ms 1 Yes Yes /modules/ps_facetedsearch/src/Filters/DataAccessor.php:137
1336
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4016
ORDER BY f.position ASC
1.473 ms 5 Yes /classes/Product.php:6021
3722
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4001) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.470 ms 1 Yes Yes /classes/Product.php:4524
378
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2898 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.469 ms 10 Yes /classes/SpecificPrice.php:576
2016
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4027 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.469 ms 10 Yes /classes/SpecificPrice.php:576
3079
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4236) AND (b.`id_shop` = 1) LIMIT 1
1.468 ms 1 /src/Adapter/EntityMapper.php:71
1733
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4718 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4718 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.463 ms 0 /classes/Cart.php:1430
495
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3028
ORDER BY f.position ASC
1.462 ms 5 Yes /classes/Product.php:6021
926
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3986 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3986 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.460 ms 0 /classes/Cart.php:1430
3741
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4032) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.460 ms 1 Yes Yes /classes/Product.php:4524
255
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2514)
1.460 ms 1 /classes/Product.php:3860
1082
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3994
ORDER BY f.position ASC
1.459 ms 5 Yes /classes/Product.php:6021
1625
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4582
AND image_shop.`cover` = 1 LIMIT 1
1.459 ms 3 /classes/Product.php:3570
855
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 5075 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.455 ms 10 Yes /classes/SpecificPrice.php:576
2981
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 6102) AND (b.`id_shop` = 1) LIMIT 1
1.455 ms 1 /src/Adapter/EntityMapper.php:71
1010
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 6053 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.447 ms 10 Yes /classes/SpecificPrice.php:576
122
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3799 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.446 ms 10 Yes /classes/SpecificPrice.php:576
3137
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4701
ORDER BY `position`
1.445 ms 1 Yes /classes/Product.php:3545
483
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3200 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3200 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.444 ms 0 /classes/Cart.php:1430
1744
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4989 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4989 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.443 ms 0 /classes/Cart.php:1430
366
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2944
ORDER BY `id_specific_price_priority` DESC LIMIT 1
1.441 ms 0 /classes/SpecificPrice.php:259
3778
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (5165) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.437 ms 1 Yes Yes /classes/Product.php:4524
2582
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 9830 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 9830 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.436 ms 0 /classes/Cart.php:1430
1690
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4701
ORDER BY f.position ASC
1.434 ms 5 Yes /classes/Product.php:6021
3708
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3993) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.434 ms 1 Yes Yes /classes/Product.php:4524
3695
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (5415) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.433 ms 1 Yes Yes /classes/Product.php:4524
1070
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 6100 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 6100 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.432 ms 0 /classes/Cart.php:1430
248
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2504
ORDER BY f.position ASC
1.430 ms 5 Yes /classes/Product.php:6021
1722
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4704 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4704 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.430 ms 0 /classes/Cart.php:1430
3070
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4034) AND (b.`id_shop` = 1) LIMIT 1
1.429 ms 1 /src/Adapter/EntityMapper.php:71
3403
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 9848) AND (b.`id_shop` = 1) LIMIT 1
1.428 ms 1 /src/Adapter/EntityMapper.php:71
1756
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 5076
ORDER BY f.position ASC
1.427 ms 5 Yes /classes/Product.php:6021
1247
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 8637 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 8637 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.421 ms 0 /classes/Cart.php:1430
3702
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3989) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.421 ms 1 Yes Yes /classes/Product.php:4524
2285
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 9721 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 9721 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.420 ms 0 /classes/Cart.php:1430
1059
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3993 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3993 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.418 ms 0 /classes/Cart.php:1430
1125
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3996 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3996 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.416 ms 0 /classes/Cart.php:1430
203
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2447
ORDER BY f.position ASC
1.415 ms 5 Yes /classes/Product.php:6021
777
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3803)
1.415 ms 1 /classes/Product.php:3860
146
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3797 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3797 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.414 ms 0 /classes/Cart.php:1430
1938
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3979 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.414 ms 10 Yes /classes/SpecificPrice.php:576
1180
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3018 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3018 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.413 ms 0 /classes/Cart.php:1430
541
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 44 LIMIT 1
1.412 ms 1 /classes/Product.php:5659
559
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3258) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
1.411 ms 1 /classes/stock/StockAvailable.php:453
2762
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2601) AND (b.`id_shop` = 1) LIMIT 1
1.408 ms 1 /src/Adapter/EntityMapper.php:71
13
SELECT SQL_NO_CACHE lower(name) as name
FROM `hgt78_hook` h
WHERE (h.active = 1)
1.407 ms 1185 /classes/Hook.php:1388
3154
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 5076) AND (b.`id_shop` = 1) LIMIT 1
1.406 ms 1 /src/Adapter/EntityMapper.php:71
672
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3944
ORDER BY f.position ASC
1.404 ms 5 Yes /classes/Product.php:6021
2873
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3949) AND (b.`id_shop` = 1) LIMIT 1
1.404 ms 1 /src/Adapter/EntityMapper.php:71
3772
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (5077) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.402 ms 1 Yes Yes /classes/Product.php:4524
3634
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2513) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.402 ms 1 Yes Yes /classes/Product.php:4524
771
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3952
ORDER BY f.position ASC
1.400 ms 5 Yes /classes/Product.php:6021
1104
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3995
ORDER BY f.position ASC
1.400 ms 5 Yes /classes/Product.php:6021
1325
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 10932
ORDER BY f.position ASC
1.399 ms 5 Yes /classes/Product.php:6021
370
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2944 AND `id_group` = 1 LIMIT 1
1.398 ms 0 /classes/GroupReduction.php:156
1231
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4002 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.398 ms 10 Yes /classes/SpecificPrice.php:576
582
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3499 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3499 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.396 ms 0 /classes/Cart.php:1430
322
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2834 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.394 ms 10 Yes /classes/SpecificPrice.php:576
2087
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 5352 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 5352 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.388 ms 0 /classes/Cart.php:1430
3499
SELECT SQL_NO_CACHE c.*, cl.*
FROM `hgt78_category` c
INNER JOIN hgt78_category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1)
LEFT JOIN `hgt78_category_lang` cl ON c.`id_category` = cl.`id_category` AND cl.id_shop = 1 
LEFT JOIN `hgt78_category_group` cg ON c.`id_category` = cg.`id_category`
RIGHT JOIN `hgt78_category` c2 ON c2.`id_category` = 54 AND c.`nleft` >= c2.`nleft` AND c.`nright` <= c2.`nright`
WHERE 1  AND `id_lang` = 1
AND c.`active` = 1
AND cg.`id_group` IN (1)
GROUP BY c.`id_category`
ORDER BY c.`level_depth` ASC
, category_shop.`position` ASC
1.388 ms 10 Yes Yes /classes/Category.php:799
2616
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 9844
ORDER BY f.position ASC
1.384 ms 5 Yes /classes/Product.php:6021
393
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2899) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
1.381 ms 1 /classes/stock/StockAvailable.php:453
3082
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4238) AND (b.`id_shop` = 1) LIMIT 1
1.381 ms 1 /src/Adapter/EntityMapper.php:71
3757
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4540) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.381 ms 1 Yes Yes /classes/Product.php:4524
2942
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3988) AND (b.`id_shop` = 1) LIMIT 1
1.380 ms 1 /src/Adapter/EntityMapper.php:71
271
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2808 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2808 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.371 ms 0 /classes/Cart.php:1430
938
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 5418
ORDER BY f.position ASC
1.370 ms 5 Yes /classes/Product.php:6021
1191
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4000 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4000 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.370 ms 0 /classes/Cart.php:1430
494
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3028 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3028 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.368 ms 0 /classes/Cart.php:1430
3743
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4034) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.366 ms 1 Yes Yes /classes/Product.php:4524
934
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 5418 AND id_shop=1 LIMIT 1
1.365 ms 1 /classes/Product.php:6876
2954
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 6053) AND (b.`id_shop` = 1) LIMIT 1
1.364 ms 1 /src/Adapter/EntityMapper.php:71
202
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2447 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2447 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.362 ms 0 /classes/Cart.php:1430
3035
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 10236) AND (b.`id_shop` = 1) LIMIT 1
1.359 ms 1 /src/Adapter/EntityMapper.php:71
3085
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4239) AND (b.`id_shop` = 1) LIMIT 1
1.357 ms 1 /src/Adapter/EntityMapper.php:71
3694
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3985) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.355 ms 1 Yes Yes /classes/Product.php:4524
1186
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4000 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.352 ms 10 Yes /classes/SpecificPrice.php:576
2756
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2600) AND (b.`id_shop` = 1) LIMIT 1
1.351 ms 1 /src/Adapter/EntityMapper.php:71
3200
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4489
ORDER BY `position`
1.351 ms 1 Yes /classes/Product.php:3545
2774
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2918) AND (b.`id_shop` = 1) LIMIT 1
1.350 ms 1 /src/Adapter/EntityMapper.php:71
3766
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4702) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.347 ms 1 Yes Yes /classes/Product.php:4524
2324
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 9744 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.345 ms 11 Yes /classes/SpecificPrice.php:576
915
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 5415 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 5415 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.342 ms 0 /classes/Cart.php:1430
2991
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3997
ORDER BY `position`
1.342 ms 1 Yes /classes/Product.php:3545
593
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3520 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3520 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.341 ms 0 /classes/Cart.php:1430
3151
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4989) AND (b.`id_shop` = 1) LIMIT 1
1.340 ms 1 /src/Adapter/EntityMapper.php:71
1269
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 9521 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 9521 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.335 ms 0 /classes/Cart.php:1430
1414
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4030 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4030 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.335 ms 0 /classes/Cart.php:1430
1357
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4018 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4018 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.333 ms 0 /classes/Cart.php:1430
2192
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 6135 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.333 ms 10 Yes /classes/SpecificPrice.php:576
626
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3790 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3790 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.331 ms 0 /classes/Cart.php:1430
2766
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2890
ORDER BY `position`
1.331 ms 1 Yes /classes/Product.php:3545
1993
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3984 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.329 ms 10 Yes /classes/SpecificPrice.php:576
3782
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (5337) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.329 ms 1 Yes Yes /classes/Product.php:4524
3406
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 9849) AND (b.`id_shop` = 1) LIMIT 1
1.326 ms 1 /src/Adapter/EntityMapper.php:71
3652
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3198) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.325 ms 1 Yes Yes /classes/Product.php:4524
3711
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (6101) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.325 ms 1 Yes Yes /classes/Product.php:4524
1204
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 8356
ORDER BY f.position ASC
1.323 ms 5 Yes /classes/Product.php:6021
339
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2835
ORDER BY f.position ASC
1.318 ms 5 Yes /classes/Product.php:6021
2318
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 9743 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 9743 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.318 ms 0 /classes/Cart.php:1430
1169
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3999 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3999 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.315 ms 0 /classes/Cart.php:1430
3770
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4989) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.306 ms 1 Yes Yes /classes/Product.php:4524
259
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2514 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2514 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.305 ms 0 /classes/Cart.php:1430
3202
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3978) AND (b.`id_shop` = 1) LIMIT 1
1.305 ms 1 /src/Adapter/EntityMapper.php:71
406
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3196 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3196 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.304 ms 0 /classes/Cart.php:1430
3088
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4241) AND (b.`id_shop` = 1) LIMIT 1
1.303 ms 1 /src/Adapter/EntityMapper.php:71
3067
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4033) AND (b.`id_shop` = 1) LIMIT 1
1.302 ms 1 /src/Adapter/EntityMapper.php:71
1777
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 5080 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 5080 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.301 ms 0 /classes/Cart.php:1430
2329
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 9744 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 9744 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.301 ms 0 /classes/Cart.php:1430
3640
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2601) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.301 ms 1 Yes Yes /classes/Product.php:4524
3078
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4036
1.301 ms 1 /classes/Product.php:2902
531
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3236 LIMIT 1
1.299 ms 10 /classes/SpecificPrice.php:435
871
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 5106 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 5106 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.299 ms 0 /classes/Cart.php:1430
2975
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 6101) AND (b.`id_shop` = 1) LIMIT 1
1.298 ms 1 /src/Adapter/EntityMapper.php:71
3719
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3018) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.298 ms 1 Yes Yes /classes/Product.php:4524
3647
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2898) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.297 ms 1 Yes Yes /classes/Product.php:4524
395
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2899
ORDER BY f.position ASC
1.296 ms 5 Yes /classes/Product.php:6021
396
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3196
AND image_shop.`cover` = 1 LIMIT 1
1.295 ms 1 /classes/Product.php:3570
135
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3799
ORDER BY f.position ASC
1.294 ms 5 Yes /classes/Product.php:6021
3106
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4507) AND (b.`id_shop` = 1) LIMIT 1
1.292 ms 1 /src/Adapter/EntityMapper.php:71
1701
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4702
ORDER BY f.position ASC
1.290 ms 5 Yes /classes/Product.php:6021
2170
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 6105 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.282 ms 10 Yes /classes/SpecificPrice.php:576
3774
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (5102) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.276 ms 1 Yes Yes /classes/Product.php:4524
3785
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4488) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.276 ms 1 Yes Yes /classes/Product.php:4524
922
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3986)
1.275 ms 1 /classes/Product.php:3860
2181
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 6134 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.275 ms 10 Yes /classes/SpecificPrice.php:576
732
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3801 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.274 ms 11 Yes /classes/SpecificPrice.php:576
966
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3988 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.274 ms 10 Yes /classes/SpecificPrice.php:576
316
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2890 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2890 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.271 ms 0 /classes/Cart.php:1430
1729
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4718)
1.271 ms 1 /classes/Product.php:3860
361
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2836 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2836 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.270 ms 0 /classes/Cart.php:1430
3630
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2475) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.270 ms 1 Yes Yes /classes/Product.php:4524
715
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3949 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3949 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.270 ms 0 /classes/Cart.php:1430
1026
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 6054 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 6054 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.269 ms 0 /classes/Cart.php:1430
2115
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 5642 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.269 ms 10 Yes /classes/SpecificPrice.php:576
3074
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4035
ORDER BY `position`
1.266 ms 1 Yes /classes/Product.php:3545
2588
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 9842 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.265 ms 11 Yes /classes/SpecificPrice.php:576
233
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2513 AND id_shop=1 LIMIT 1
1.264 ms 1 /classes/Product.php:6876
473
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3011
ORDER BY f.position ASC
1.264 ms 5 Yes /classes/Product.php:6021
3767
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4703) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.263 ms 1 Yes Yes /classes/Product.php:4524
3633
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2448) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.262 ms 1 Yes Yes /classes/Product.php:4524
2885
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3802) AND (b.`id_shop` = 1) LIMIT 1
1.259 ms 1 /src/Adapter/EntityMapper.php:71
1037
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3992 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3992 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.257 ms 0 /classes/Cart.php:1430
225
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2448 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2448 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.253 ms 0 /classes/Cart.php:1430
517
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3235
ORDER BY f.position ASC
1.251 ms 5 Yes /classes/Product.php:6021
3064
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4032) AND (b.`id_shop` = 1) LIMIT 1
1.250 ms 1 /src/Adapter/EntityMapper.php:71
2027
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 5084 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.249 ms 10 Yes /classes/SpecificPrice.php:576
1115
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 6102
ORDER BY f.position ASC
1.248 ms 5 Yes /classes/Product.php:6021
3187
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 5337) AND (b.`id_shop` = 1) LIMIT 1
1.247 ms 1 /src/Adapter/EntityMapper.php:71
1183
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 78 LIMIT 1
1.247 ms 1 /classes/Product.php:5659
1159
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3998
ORDER BY f.position ASC
1.242 ms 5 Yes /classes/Product.php:6021
3781
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (5336) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.242 ms 1 Yes Yes /classes/Product.php:4524
2951
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3990) AND (b.`id_shop` = 1) LIMIT 1
1.241 ms 1 /src/Adapter/EntityMapper.php:71
2978
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3995) AND (b.`id_shop` = 1) LIMIT 1
1.240 ms 1 /src/Adapter/EntityMapper.php:71
418
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3197
ORDER BY f.position ASC
1.236 ms 5 Yes /classes/Product.php:6021
1236
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4002 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4002 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.235 ms 0 /classes/Cart.php:1430
1420
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4032 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.235 ms 10 Yes /classes/SpecificPrice.php:576
2939
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 5509) AND (b.`id_shop` = 1) LIMIT 1
1.233 ms 1 /src/Adapter/EntityMapper.php:71
3697
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (5418) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.231 ms 1 Yes Yes /classes/Product.php:4524
1088
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 6101)
1.230 ms 1 /classes/Product.php:3860
3775
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (5103) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.230 ms 1 Yes Yes /classes/Product.php:4524
611
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3788)
1.229 ms 1 /classes/Product.php:3860
3705
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (6054) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.229 ms 1 Yes Yes /classes/Product.php:4524
1766
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 5077 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 5077 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.226 ms 0 /classes/Cart.php:1430
3047
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4018) AND (b.`id_shop` = 1) LIMIT 1
1.225 ms 1 /src/Adapter/EntityMapper.php:71
3161
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5080
ORDER BY `position`
1.224 ms 1 Yes /classes/Product.php:3545
3745
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4036) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.223 ms 1 Yes Yes /classes/Product.php:4524
2921
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 5373) AND (b.`id_shop` = 1) LIMIT 1
1.222 ms 1 /src/Adapter/EntityMapper.php:71
1153
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3998 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.221 ms 10 Yes /classes/SpecificPrice.php:576
3071
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4034
ORDER BY `position`
1.221 ms 1 Yes /classes/Product.php:3545
3786
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4489) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.220 ms 1 Yes Yes /classes/Product.php:4524
1185
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4000
ORDER BY `id_specific_price_priority` DESC LIMIT 1
1.220 ms 0 /classes/SpecificPrice.php:259
3370
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 9794) AND (b.`id_shop` = 1) LIMIT 1
1.215 ms 1 /src/Adapter/EntityMapper.php:71
3784
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (5639) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.215 ms 1 Yes Yes /classes/Product.php:4524
2038
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 5083 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.214 ms 10 Yes /classes/SpecificPrice.php:576
3692
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (5113) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.212 ms 1 Yes Yes /classes/Product.php:4524
399
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3196 LIMIT 1
1.209 ms 10 /classes/SpecificPrice.php:435
2825
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3236) AND (b.`id_shop` = 1) LIMIT 1
1.209 ms 1 /src/Adapter/EntityMapper.php:71
3765
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4701) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.204 ms 1 Yes Yes /classes/Product.php:4524
3763
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4699) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.200 ms 1 Yes Yes /classes/Product.php:4524
838
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4947 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4947 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.198 ms 0 /classes/Cart.php:1430
2379
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 9751 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.198 ms 11 Yes /classes/SpecificPrice.php:576
3490
SELECT SQL_NO_CACHE c.*, cl.*
FROM `hgt78_category` c
INNER JOIN hgt78_category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1)
LEFT JOIN `hgt78_category_lang` cl ON c.`id_category` = cl.`id_category` AND cl.id_shop = 1 
LEFT JOIN `hgt78_category_group` cg ON c.`id_category` = cg.`id_category`
RIGHT JOIN `hgt78_category` c2 ON c2.`id_category` = 344 AND c.`nleft` >= c2.`nleft` AND c.`nright` <= c2.`nright`
WHERE 1  AND `id_lang` = 1
AND c.`active` = 1
AND cg.`id_group` IN (1)
GROUP BY c.`id_category`
ORDER BY c.`level_depth` ASC
, category_shop.`position` ASC
1.198 ms 15 Yes Yes /classes/Category.php:799
862
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 5106
AND image_shop.`cover` = 1 LIMIT 1
1.195 ms 1 /classes/Product.php:3570
2049
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 5085 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.195 ms 10 Yes /classes/SpecificPrice.php:576
539
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3236
ORDER BY f.position ASC
1.194 ms 5 Yes /classes/Product.php:6021
3744
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4035) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.191 ms 1 Yes Yes /classes/Product.php:4524
3061
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4030) AND (b.`id_shop` = 1) LIMIT 1
1.191 ms 1 /src/Adapter/EntityMapper.php:71
350
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2918 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2918 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.189 ms 0 /classes/Cart.php:1430
2314
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 9743)
1.189 ms 1 /classes/Product.php:3860
3530
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 37) AND (b.`id_shop` = 1) LIMIT 1
1.189 ms 1 /src/Adapter/EntityMapper.php:71
1346
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4017 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4017 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.188 ms 0 /classes/Cart.php:1430
168
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3795 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3795 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.187 ms 0 /classes/Cart.php:1430
2247
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 8969 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.187 ms 17 Yes /classes/SpecificPrice.php:576
3404
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 9848
ORDER BY `position`
1.186 ms 1 Yes /classes/Product.php:3545
3196
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4488) AND (b.`id_shop` = 1) LIMIT 1
1.186 ms 1 /src/Adapter/EntityMapper.php:71
1341
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4017 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.185 ms 10 Yes /classes/SpecificPrice.php:576
2286
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 9721
ORDER BY f.position ASC
1.185 ms 5 Yes /classes/Product.php:6021
3058
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4029) AND (b.`id_shop` = 1) LIMIT 1
1.184 ms 1 /src/Adapter/EntityMapper.php:71
1723
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4704
ORDER BY f.position ASC
1.183 ms 5 Yes /classes/Product.php:6021
2670
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 9849 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 9849 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.183 ms 0 /classes/Cart.php:1430
3292
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 8970) AND (b.`id_shop` = 1) LIMIT 1
1.181 ms 1 /src/Adapter/EntityMapper.php:71
264
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2808 LIMIT 1
1.180 ms 10 /classes/SpecificPrice.php:435
849
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 5074 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 5074 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.180 ms 0 /classes/Cart.php:1430
2936
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3987) AND (b.`id_shop` = 1) LIMIT 1
1.180 ms 1 /src/Adapter/EntityMapper.php:71
1805
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 5104 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.177 ms 10 Yes /classes/SpecificPrice.php:576
910
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 5415 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.176 ms 11 Yes /classes/SpecificPrice.php:576
465
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3011 LIMIT 1
1.175 ms 10 /classes/SpecificPrice.php:435
193
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2447
AND image_shop.`cover` = 1 LIMIT 1
1.175 ms 2 /classes/Product.php:3570
557
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3258 AND id_shop=1 LIMIT 1
1.174 ms 1 /classes/Product.php:6876
2828
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3257) AND (b.`id_shop` = 1) LIMIT 1
1.173 ms 1 /src/Adapter/EntityMapper.php:71
3769
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4718) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.173 ms 1 Yes Yes /classes/Product.php:4524
528
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3242
ORDER BY f.position ASC
1.172 ms 5 Yes /classes/Product.php:6021
1004
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3990 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3990 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.172 ms 0 /classes/Cart.php:1430
1960
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3981 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.172 ms 10 Yes /classes/SpecificPrice.php:576
3068
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4033
ORDER BY `position`
1.172 ms 1 Yes /classes/Product.php:3545
2769
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2834
ORDER BY `position`
1.171 ms 1 Yes /classes/Product.php:3545
3185
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5336
ORDER BY `position`
1.170 ms 2 Yes /classes/Product.php:3545
3097
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4491) AND (b.`id_shop` = 1) LIMIT 1
1.167 ms 1 /src/Adapter/EntityMapper.php:71
3133
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4700) AND (b.`id_shop` = 1) LIMIT 1
1.166 ms 1 /src/Adapter/EntityMapper.php:71
407
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3196
ORDER BY f.position ASC
1.165 ms 5 Yes /classes/Product.php:6021
2982
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 6102
ORDER BY `position`
1.165 ms 1 Yes /classes/Product.php:3545
3179
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5166
ORDER BY `position`
1.165 ms 1 Yes /classes/Product.php:3545
3724
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4002) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.164 ms 1 Yes Yes /classes/Product.php:4524
3783
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (5638) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.164 ms 1 Yes Yes /classes/Product.php:4524
192
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2475
ORDER BY f.position ASC
1.163 ms 5 Yes /classes/Product.php:6021
1789
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 5102
ORDER BY f.position ASC
1.163 ms 5 Yes /classes/Product.php:6021
2915
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 5106) AND (b.`id_shop` = 1) LIMIT 1
1.163 ms 1 /src/Adapter/EntityMapper.php:71
367
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2944 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.162 ms 10 Yes /classes/SpecificPrice.php:576
721
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3950 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.162 ms 10 Yes /classes/SpecificPrice.php:576
3178
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 5166) AND (b.`id_shop` = 1) LIMIT 1
1.162 ms 1 /src/Adapter/EntityMapper.php:71
3182
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5167
ORDER BY `position`
1.162 ms 1 Yes /classes/Product.php:3545
238
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2504
AND image_shop.`cover` = 1 LIMIT 1
1.161 ms 1 /classes/Product.php:3570
3776
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (5104) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.160 ms 1 Yes Yes /classes/Product.php:4524
86
SELECT SQL_NO_CACHE DISTINCT f.id_feature, f.*, fl.*, IF(liflv.`url_name` IS NULL OR liflv.`url_name` = "", NULL, liflv.`url_name`) AS url_name, IF(liflv.`meta_title` IS NULL OR liflv.`meta_title` = "", NULL, liflv.`meta_title`) AS meta_title, lif.indexable FROM `hgt78_feature` f  INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1) LEFT JOIN `hgt78_feature_lang` fl ON (f.`id_feature` = fl.`id_feature` AND fl.`id_lang` = 1) LEFT JOIN `hgt78_layered_indexable_feature` lif ON (f.`id_feature` = lif.`id_feature`) LEFT JOIN `hgt78_layered_indexable_feature_lang_value` liflv ON (f.`id_feature` = liflv.`id_feature` AND liflv.`id_lang` = 1) ORDER BY f.`position` ASC
1.159 ms 25 Yes /modules/ps_facetedsearch/src/Filters/DataAccessor.php:171
592
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3520) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
1.159 ms 1 /classes/stock/StockAvailable.php:453
2374
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 9749
ORDER BY f.position ASC
1.158 ms 5 Yes /classes/Product.php:6021
2807
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3011) AND (b.`id_shop` = 1) LIMIT 1
1.158 ms 1 /src/Adapter/EntityMapper.php:71
599
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3500 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.157 ms 11 Yes /classes/SpecificPrice.php:576
2109
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 5641 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 5641 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.157 ms 0 /classes/Cart.php:1430
3083
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4238
ORDER BY `position`
1.156 ms 1 Yes /classes/Product.php:3545
191
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2475 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2475 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.155 ms 0 /classes/Cart.php:1430
1043
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 6099 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.154 ms 10 Yes /classes/SpecificPrice.php:576
2159
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 6025 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.154 ms 10 Yes /classes/SpecificPrice.php:576
380
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2898 AND id_shop=1 LIMIT 1
1.153 ms 1 /classes/Product.php:6876
3648
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2899) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.153 ms 1 Yes Yes /classes/Product.php:4524
3756
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4508) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.153 ms 1 Yes Yes /classes/Product.php:4524
2566
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 9821 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.151 ms 10 Yes /classes/SpecificPrice.php:576
3780
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (5167) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.149 ms 1 Yes Yes /classes/Product.php:4524
648
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3942 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3942 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.147 ms 0 /classes/Cart.php:1430
1065
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 6100 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.146 ms 10 Yes /classes/SpecificPrice.php:576
2632
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 9846 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.146 ms 10 Yes /classes/SpecificPrice.php:576
2643
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 9847 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.146 ms 11 Yes /classes/SpecificPrice.php:576
3698
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3987) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.145 ms 1 Yes Yes /classes/Product.php:4524
2888
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3952) AND (b.`id_shop` = 1) LIMIT 1
1.145 ms 1 /src/Adapter/EntityMapper.php:71
147
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3797
ORDER BY f.position ASC
1.142 ms 5 Yes /classes/Product.php:6021
1021
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 6054 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.142 ms 9 Yes /classes/SpecificPrice.php:576
3699
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (5509) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.141 ms 1 Yes Yes /classes/Product.php:4524
3373
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 9819) AND (b.`id_shop` = 1) LIMIT 1
1.141 ms 1 /src/Adapter/EntityMapper.php:71
3080
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4236
ORDER BY `position`
1.139 ms 1 Yes /classes/Product.php:3545
754
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3802 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.138 ms 11 Yes /classes/SpecificPrice.php:576
3742
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4033) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.138 ms 1 Yes Yes /classes/Product.php:4524
142
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3797)
1.137 ms 1 /classes/Product.php:3860
2927
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 5415) AND (b.`id_shop` = 1) LIMIT 1
1.137 ms 1 /src/Adapter/EntityMapper.php:71
3203
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3978
ORDER BY `position`
1.136 ms 1 Yes /classes/Product.php:3545
3175
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 5165) AND (b.`id_shop` = 1) LIMIT 1
1.134 ms 1 /src/Adapter/EntityMapper.php:71
529
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3236
AND image_shop.`cover` = 1 LIMIT 1
1.133 ms 1 /classes/Product.php:3570
1927
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3978 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.132 ms 10 Yes /classes/SpecificPrice.php:576
1356
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4018) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
1.131 ms 1 /classes/stock/StockAvailable.php:453
2970
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 6100
ORDER BY `position`
1.131 ms 1 Yes /classes/Product.php:3545
2214
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 8946 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.128 ms 16 Yes /classes/SpecificPrice.php:576
107
SELECT SQL_NO_CACHE pac.id_attribute, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM hgt78_product p LEFT JOIN hgt78_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN hgt78_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN hgt78_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN hgt78_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN hgt78_category_product cp ON (p.id_product = cp.id_product) INNER JOIN hgt78_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN hgt78_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN hgt78_category_group cg ON (cg.id_category = c.id_category) WHERE ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND cp.id_category IN (44, 34) AND p.id_manufacturer='2' GROUP BY p.id_product) p LEFT JOIN hgt78_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN hgt78_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) INNER JOIN hgt78_attribute a ON (a.id_attribute = pac.id_attribute) WHERE ((a.id_attribute_group=3)) GROUP BY pac.id_attribute
1.127 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
933
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 5418)
1.127 ms 1 /classes/Product.php:3860
1497
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4239 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.127 ms 10 Yes /classes/SpecificPrice.php:576
2650
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 9848
AND image_shop.`cover` = 1 LIMIT 1
1.127 ms 1 /classes/Product.php:3570
1193
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 8356
AND image_shop.`cover` = 1 LIMIT 1
1.125 ms 2 /classes/Product.php:3570
516
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3235 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3235 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.123 ms 0 /classes/Cart.php:1430
3777
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (5164) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.122 ms 1 Yes Yes /classes/Product.php:4524
2120
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 5642 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 5642 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.121 ms 0 /classes/Cart.php:1430
2996
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3999) AND (b.`id_shop` = 1) LIMIT 1
1.121 ms 1 /src/Adapter/EntityMapper.php:71
3721
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (8356) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.119 ms 1 Yes Yes /classes/Product.php:4524
700
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3947)
1.119 ms 1 /classes/Product.php:3860
3512
SELECT SQL_NO_CACHE c.*, cl.*
FROM `hgt78_category` c
INNER JOIN hgt78_category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1)
LEFT JOIN `hgt78_category_lang` cl ON c.`id_category` = cl.`id_category` AND cl.id_shop = 1 
LEFT JOIN `hgt78_category_group` cg ON c.`id_category` = cg.`id_category`
RIGHT JOIN `hgt78_category` c2 ON c2.`id_category` = 200 AND c.`nleft` >= c2.`nleft` AND c.`nright` <= c2.`nright`
WHERE 1  AND `id_lang` = 1
AND c.`active` = 1
AND cg.`id_group` IN (1)
GROUP BY c.`id_category`
ORDER BY c.`level_depth` ASC
, category_shop.`position` ASC
1.119 ms 14 Yes Yes /classes/Category.php:799
2236
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 8948 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.118 ms 9 Yes /classes/SpecificPrice.php:576
155
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3796 AND `id_group` = 1 LIMIT 1
1.118 ms 0 /classes/GroupReduction.php:156
2060
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 5101 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.118 ms 10 Yes /classes/SpecificPrice.php:576
2126
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 6018 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.117 ms 10 Yes /classes/SpecificPrice.php:576
2754
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2808
ORDER BY `position`
1.116 ms 1 Yes /classes/Product.php:3545
3275
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 6135
ORDER BY `position`
1.116 ms 1 Yes /classes/Product.php:3545
109
SELECT SQL_NO_CACHE pac.id_attribute, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM hgt78_product p LEFT JOIN hgt78_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN hgt78_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN hgt78_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN hgt78_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN hgt78_category_product cp ON (p.id_product = cp.id_product) INNER JOIN hgt78_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN hgt78_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN hgt78_category_group cg ON (cg.id_category = c.id_category) WHERE ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND cp.id_category IN (44, 34) AND p.id_manufacturer='2' GROUP BY p.id_product) p LEFT JOIN hgt78_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN hgt78_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) INNER JOIN hgt78_attribute a ON (a.id_attribute = pac.id_attribute) WHERE ((a.id_attribute_group=4)) GROUP BY pac.id_attribute
1.113 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
2882
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3951) AND (b.`id_shop` = 1) LIMIT 1
1.111 ms 1 /src/Adapter/EntityMapper.php:71
3518
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 216) AND (b.`id_shop` = 1) LIMIT 1
1.111 ms 1 /src/Adapter/EntityMapper.php:71
688
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3946 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.106 ms 10 Yes /classes/SpecificPrice.php:576
3166
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 5103) AND (b.`id_shop` = 1) LIMIT 1
1.105 ms 1 /src/Adapter/EntityMapper.php:71
561
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3258
ORDER BY f.position ASC
1.104 ms 5 Yes /classes/Product.php:6021
616
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3788
ORDER BY f.position ASC
1.104 ms 5 Yes /classes/Product.php:6021
627
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3790
ORDER BY f.position ASC
1.104 ms 5 Yes /classes/Product.php:6021
117
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3799 LIMIT 1
1.103 ms 10 /classes/SpecificPrice.php:435
783
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4297
AND image_shop.`cover` = 1 LIMIT 1
1.103 ms 1 /classes/Product.php:3570
3399
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 9846
1.102 ms 1 /classes/Product.php:2902
2626
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 9845 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 9845 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.102 ms 0 /classes/Cart.php:1430
1184
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4000 LIMIT 1
1.101 ms 10 /classes/SpecificPrice.php:435
3155
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5076
ORDER BY `position`
1.101 ms 2 Yes /classes/Product.php:3545
3391
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 9844) AND (b.`id_shop` = 1) LIMIT 1
1.101 ms 1 /src/Adapter/EntityMapper.php:71
3635
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2504) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.101 ms 1 Yes Yes /classes/Product.php:4524
3710
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3994) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.099 ms 1 Yes Yes /classes/Product.php:4524
356
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2836 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.097 ms 10 Yes /classes/SpecificPrice.php:576
1711
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4703 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4703 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.097 ms 0 /classes/Cart.php:1430
1249
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4003
AND image_shop.`cover` = 1 LIMIT 1
1.096 ms 1 /classes/Product.php:3570
3729
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (10235) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.096 ms 1 Yes Yes /classes/Product.php:4524
1827
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 5165 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.093 ms 10 Yes /classes/SpecificPrice.php:576
484
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3200
ORDER BY f.position ASC
1.092 ms 5 Yes /classes/Product.php:6021
1077
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3994)
1.091 ms 1 /classes/Product.php:3860
571
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3497 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3497 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.090 ms 0 /classes/Cart.php:1430
2801
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3010) AND (b.`id_shop` = 1) LIMIT 1
1.090 ms 1 /src/Adapter/EntityMapper.php:71
3646
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2944) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.090 ms 1 Yes Yes /classes/Product.php:4524
738
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3801
ORDER BY f.position ASC
1.087 ms 5 Yes /classes/Product.php:6021
434
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3198 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.084 ms 10 Yes /classes/SpecificPrice.php:576
1486
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4238 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.084 ms 10 Yes /classes/SpecificPrice.php:576
1292
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 10235
ORDER BY f.position ASC
1.083 ms 5 Yes /classes/Product.php:6021
3208
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3980) AND (b.`id_shop` = 1) LIMIT 1
1.083 ms 1 /src/Adapter/EntityMapper.php:71
3731
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (10236) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.083 ms 1 Yes Yes /classes/Product.php:4524
327
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2834 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2834 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.081 ms 0 /classes/Cart.php:1430
2043
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 5083 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 5083 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.081 ms 0 /classes/Cart.php:1430
2093
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 5640 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.080 ms 10 Yes /classes/SpecificPrice.php:576
1071
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 6100
ORDER BY f.position ASC
1.077 ms 5 Yes /classes/Product.php:6021
2846
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3788) AND (b.`id_shop` = 1) LIMIT 1
1.077 ms 1 /src/Adapter/EntityMapper.php:71
214
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2502 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2502 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.077 ms 0 /classes/Cart.php:1430
3158
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5077
ORDER BY `position`
1.077 ms 1 Yes /classes/Product.php:3545
1342
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4017)
1.076 ms 1 /classes/Product.php:3860
3488
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 34) AND (b.`id_shop` = 1) LIMIT 1
1.075 ms 1 /src/Adapter/EntityMapper.php:71
3727
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (9521) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.075 ms 1 Yes Yes /classes/Product.php:4524
3268
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 6105) AND (b.`id_shop` = 1) LIMIT 1
1.074 ms 1 /src/Adapter/EntityMapper.php:71
3747
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4238) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.074 ms 1 Yes Yes /classes/Product.php:4524
2864
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3945) AND (b.`id_shop` = 1) LIMIT 1
1.073 ms 1 /src/Adapter/EntityMapper.php:71
1179
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3018) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
1.072 ms 1 /classes/stock/StockAvailable.php:453
2010
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2930 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2930 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.071 ms 0 /classes/Cart.php:1430
788
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4297)
1.070 ms 1 /classes/Product.php:3860
251
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 56 LIMIT 1
1.070 ms 1 /classes/Product.php:5659
3614
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 221 AND `id_shop` = 1
1.069 ms 6 /src/Adapter/EntityMapper.php:79
2777
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2836) AND (b.`id_shop` = 1) LIMIT 1
1.068 ms 1 /src/Adapter/EntityMapper.php:71
2654
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 9848 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.067 ms 11 Yes /classes/SpecificPrice.php:576
3286
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 8948) AND (b.`id_shop` = 1) LIMIT 1
1.065 ms 1 /src/Adapter/EntityMapper.php:71
3314
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 9745
ORDER BY `position`
1.064 ms 1 Yes /classes/Product.php:3545
877
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 5113 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.064 ms 10 Yes /classes/SpecificPrice.php:576
794
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4298
AND image_shop.`cover` = 1 LIMIT 1
1.063 ms 1 /classes/Product.php:3570
1778
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 5080
ORDER BY f.position ASC
1.062 ms 5 Yes /classes/Product.php:6021
3086
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4239
ORDER BY `position`
1.062 ms 1 Yes /classes/Product.php:3545
3109
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4508) AND (b.`id_shop` = 1) LIMIT 1
1.062 ms 1 /src/Adapter/EntityMapper.php:71
748
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3951 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3951 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.061 ms 0 /classes/Cart.php:1430
943
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3987 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.059 ms 10 Yes /classes/SpecificPrice.php:576
474
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3200
AND image_shop.`cover` = 1 LIMIT 1
1.058 ms 1 /classes/Product.php:3570
1165
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3999)
1.058 ms 1 /classes/Product.php:3860
527
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3242 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3242 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.055 ms 0 /classes/Cart.php:1430
3502
SELECT SQL_NO_CACHE c.*, cl.*
FROM `hgt78_category` c
INNER JOIN hgt78_category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1)
LEFT JOIN `hgt78_category_lang` cl ON c.`id_category` = cl.`id_category` AND cl.id_shop = 1 
LEFT JOIN `hgt78_category_group` cg ON c.`id_category` = cg.`id_category`
RIGHT JOIN `hgt78_category` c2 ON c2.`id_category` = 64 AND c.`nleft` >= c2.`nleft` AND c.`nright` <= c2.`nright`
WHERE 1  AND `id_lang` = 1
AND c.`active` = 1
AND cg.`id_group` IN (1)
GROUP BY c.`id_category`
ORDER BY c.`level_depth` ASC
, category_shop.`position` ASC
1.055 ms 10 Yes Yes /classes/Category.php:799
218
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2448 LIMIT 1
1.054 ms 10 /classes/SpecificPrice.php:435
489
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3028 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.054 ms 11 Yes /classes/SpecificPrice.php:576
1998
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3984 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3984 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.054 ms 0 /classes/Cart.php:1430
1734
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4718
ORDER BY f.position ASC
1.054 ms 5 Yes /classes/Product.php:6021
3713
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (6102) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.052 ms 1 Yes Yes /classes/Product.php:4524
1199
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 8356)
1.051 ms 1 /classes/Product.php:3860
1409
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4030 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.051 ms 10 Yes /classes/SpecificPrice.php:576
3725
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (8637) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.051 ms 1 Yes Yes /classes/Product.php:4524
3716
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3997) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.049 ms 1 Yes Yes /classes/Product.php:4524
1337
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4017
AND image_shop.`cover` = 1 LIMIT 1
1.048 ms 2 /classes/Product.php:3570
1331
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4016)
1.048 ms 1 /classes/Product.php:3860
485
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3028
AND image_shop.`cover` = 1 LIMIT 1
1.046 ms 1 /classes/Product.php:3570
3503
SELECT SQL_NO_CACHE c.*, cl.*
FROM `hgt78_category` c
INNER JOIN hgt78_category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1)
LEFT JOIN `hgt78_category_lang` cl ON c.`id_category` = cl.`id_category` AND cl.id_shop = 1 
LEFT JOIN `hgt78_category_group` cg ON c.`id_category` = cg.`id_category`
RIGHT JOIN `hgt78_category` c2 ON c2.`id_category` = 70 AND c.`nleft` >= c2.`nleft` AND c.`nright` <= c2.`nright`
WHERE 1  AND `id_lang` = 1
AND c.`active` = 1
AND cg.`id_group` IN (1)
GROUP BY c.`id_category`
ORDER BY c.`level_depth` ASC
, category_shop.`position` ASC
1.046 ms 11 Yes Yes /classes/Category.php:799
1740
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4989)
1.045 ms 1 /classes/Product.php:3860
1943
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3979 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3979 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.044 ms 0 /classes/Cart.php:1430
1971
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3982 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.043 ms 10 Yes /classes/SpecificPrice.php:576
638
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3791
ORDER BY f.position ASC
1.042 ms 5 Yes /classes/Product.php:6021
3718
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3999) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.041 ms 1 Yes Yes /classes/Product.php:4524
705
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3947
ORDER BY f.position ASC
1.038 ms 5 Yes /classes/Product.php:6021
2783
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2898) AND (b.`id_shop` = 1) LIMIT 1
1.038 ms 1 /src/Adapter/EntityMapper.php:71
1291
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 10235 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 10235 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.038 ms 0 /classes/Cart.php:1430
468
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3011)
1.037 ms 1 /classes/Product.php:3860
1933
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3978
ORDER BY f.position ASC
1.035 ms 5 Yes /classes/Product.php:6021
408
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3197
AND image_shop.`cover` = 1 LIMIT 1
1.034 ms 1 /classes/Product.php:3570
2948
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3989) AND (b.`id_shop` = 1) LIMIT 1
1.034 ms 1 /src/Adapter/EntityMapper.php:71
377
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2898
ORDER BY `id_specific_price_priority` DESC LIMIT 1
1.033 ms 0 /classes/SpecificPrice.php:259
2804
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3199) AND (b.`id_shop` = 1) LIMIT 1
1.032 ms 1 /src/Adapter/EntityMapper.php:71
3044
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4017) AND (b.`id_shop` = 1) LIMIT 1
1.031 ms 1 /src/Adapter/EntityMapper.php:71
917
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3986
AND image_shop.`cover` = 1 LIMIT 1
1.030 ms 1 /classes/Product.php:3570
1297
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4005 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.030 ms 10 Yes /classes/SpecificPrice.php:576
3039
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 10932
ORDER BY `position`
1.030 ms 1 Yes /classes/Product.php:3545
1469
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4036 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4036 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.029 ms 0 /classes/Cart.php:1430
1508
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4241 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.029 ms 10 Yes /classes/SpecificPrice.php:576
612
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3788 AND id_shop=1 LIMIT 1
1.028 ms 1 /classes/Product.php:6876
1475
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4236 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.028 ms 10 Yes /classes/SpecificPrice.php:576
463
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3011
AND image_shop.`cover` = 1 LIMIT 1
1.027 ms 1 /classes/Product.php:3570
1215
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4001
ORDER BY f.position ASC
1.026 ms 5 Yes /classes/Product.php:6021
441
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3010
AND image_shop.`cover` = 1 LIMIT 1
1.026 ms 1 /classes/Product.php:3570
281
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2600) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
1.025 ms 1 /classes/stock/StockAvailable.php:453
3730
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4005) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.025 ms 1 Yes Yes /classes/Product.php:4524
3615
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 39) AND (b.`id_shop` = 1) LIMIT 1
1.023 ms 1 /src/Adapter/EntityMapper.php:71
1949
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3980 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.021 ms 10 Yes /classes/SpecificPrice.php:576
2780
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2944) AND (b.`id_shop` = 1) LIMIT 1
1.020 ms 1 /src/Adapter/EntityMapper.php:71
814
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4299 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4299 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.020 ms 0 /classes/Cart.php:1430
1
SELECT SQL_NO_CACHE gs.*, s.*, gs.name AS group_name, s.name AS shop_name, s.active, su.domain, su.domain_ssl, su.physical_uri, su.virtual_uri
FROM hgt78_shop_group gs
LEFT JOIN hgt78_shop s
ON s.id_shop_group = gs.id_shop_group
LEFT JOIN hgt78_shop_url su
ON s.id_shop = su.id_shop AND su.main = 1
WHERE s.deleted = 0
AND gs.deleted = 0
ORDER BY gs.name, s.name
1.019 ms 1 Yes /classes/shop/Shop.php:715
2148
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 6024 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.018 ms 10 Yes /classes/SpecificPrice.php:576
306
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2601
ORDER BY f.position ASC
1.018 ms 5 Yes /classes/Product.php:6021
1363
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4019 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.017 ms 10 Yes /classes/SpecificPrice.php:576
3421
SELECT SQL_NO_CACHE `id_hook`, `name` FROM `hgt78_hook`
1.017 ms 1185 /classes/Hook.php:1348
3509
SELECT SQL_NO_CACHE c.*, cl.*
FROM `hgt78_category` c
INNER JOIN hgt78_category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1)
LEFT JOIN `hgt78_category_lang` cl ON c.`id_category` = cl.`id_category` AND cl.id_shop = 1 
LEFT JOIN `hgt78_category_group` cg ON c.`id_category` = cg.`id_category`
RIGHT JOIN `hgt78_category` c2 ON c2.`id_category` = 199 AND c.`nleft` >= c2.`nleft` AND c.`nright` <= c2.`nright`
WHERE 1  AND `id_lang` = 1
AND c.`active` = 1
AND cg.`id_group` IN (1)
GROUP BY c.`id_category`
ORDER BY c.`level_depth` ASC
, category_shop.`position` ASC
1.017 ms 13 Yes Yes /classes/Category.php:799
3053
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4021) AND (b.`id_shop` = 1) LIMIT 1
1.016 ms 1 /src/Adapter/EntityMapper.php:71
1519
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4413 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.016 ms 10 Yes /classes/SpecificPrice.php:576
1333
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4016 AND `id_group` = 1 LIMIT 1
1.014 ms 0 /classes/GroupReduction.php:156
1718
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4704)
1.013 ms 1 /classes/Product.php:3860
3193
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 5639) AND (b.`id_shop` = 1) LIMIT 1
1.013 ms 1 /src/Adapter/EntityMapper.php:71
1210
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4001)
1.011 ms 1 /classes/Product.php:3860
2175
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 6105 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 6105 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.010 ms 0 /classes/Cart.php:1430
1248
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 8637
ORDER BY f.position ASC
1.010 ms 5 Yes /classes/Product.php:6021
2511
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 9791 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.010 ms 11 Yes /classes/SpecificPrice.php:576
1192
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4000
ORDER BY f.position ASC
1.009 ms 5 Yes /classes/Product.php:6021
3759
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4580) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.009 ms 1 Yes Yes /classes/Product.php:4524
133
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3799) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
1.008 ms 1 /classes/stock/StockAvailable.php:453
267
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2808)
1.008 ms 1 /classes/Product.php:3860
40
SELECT SQL_NO_CACHE c.*, cl.`id_lang`, cl.`name`, cl.`description`, cl.`additional_description`, cl.`link_rewrite`, cl.`meta_title`, cl.`meta_keywords`, cl.`meta_description`
FROM `hgt78_category` c
INNER JOIN hgt78_category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1)
LEFT JOIN `hgt78_category_lang` cl ON (c.`id_category` = cl.`id_category` AND `id_lang` = 1  AND cl.id_shop = 1 )
LEFT JOIN `hgt78_category_group` cg ON (cg.`id_category` = c.`id_category`)
WHERE `id_parent` = 2
AND `active` = 1
AND cg.`id_group` =1
GROUP BY c.`id_category`
ORDER BY `level_depth` ASC, category_shop.`position` ASC
1.007 ms 31 Yes Yes /classes/Category.php:924
277
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2600 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.007 ms 10 Yes /classes/SpecificPrice.php:576
1585
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4508 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.007 ms 10 Yes /classes/SpecificPrice.php:576
1800
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 5103
ORDER BY f.position ASC
1.006 ms 5 Yes /classes/Product.php:6021
3715
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (6120) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.006 ms 1 Yes Yes /classes/Product.php:4524
3779
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (5166) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.006 ms 1 Yes Yes /classes/Product.php:4524
3041
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4016) AND (b.`id_shop` = 1) LIMIT 1
1.005 ms 1 /src/Adapter/EntityMapper.php:71
3506
SELECT SQL_NO_CACHE c.*, cl.*
FROM `hgt78_category` c
INNER JOIN hgt78_category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1)
LEFT JOIN `hgt78_category_lang` cl ON c.`id_category` = cl.`id_category` AND cl.id_shop = 1 
LEFT JOIN `hgt78_category_group` cg ON c.`id_category` = cg.`id_category`
RIGHT JOIN `hgt78_category` c2 ON c2.`id_category` = 78 AND c.`nleft` >= c2.`nleft` AND c.`nright` <= c2.`nright`
WHERE 1  AND `id_lang` = 1
AND c.`active` = 1
AND cg.`id_group` IN (1)
GROUP BY c.`id_category`
ORDER BY c.`level_depth` ASC
, category_shop.`position` ASC
1.004 ms 12 Yes Yes /classes/Category.php:799
555
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3258 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.003 ms 10 Yes /classes/SpecificPrice.php:576
1916
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4489 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.003 ms 10 Yes /classes/SpecificPrice.php:576
2976
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 6101
ORDER BY `position`
1.003 ms 1 Yes /classes/Product.php:3545
1187
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4000)
1.001 ms 1 /classes/Product.php:3860
1502
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4239 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4239 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.000 ms 0 /classes/Cart.php:1430
1491
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4238 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4238 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.000 ms 0 /classes/Cart.php:1430
1932
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3978 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3978 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.000 ms 0 /classes/Cart.php:1430
2137
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 6023 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.000 ms 10 Yes /classes/SpecificPrice.php:576
159
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3795
AND image_shop.`cover` = 1 LIMIT 1
0.998 ms 1 /classes/Product.php:3570
201
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2447) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.998 ms 1 /classes/stock/StockAvailable.php:453
2648
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 9847 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 9847 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.998 ms 0 /classes/Cart.php:1430
2593
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 9842 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 9842 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.997 ms 0 /classes/Cart.php:1430
1270
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 9521
ORDER BY f.position ASC
0.995 ms 5 Yes /classes/Product.php:6021
404
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3196 AND `id_group` = 1 LIMIT 1
0.994 ms 0 /classes/GroupReduction.php:156
2920
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 5113
0.994 ms 1 /classes/Product.php:2902
3140
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4702
ORDER BY `position`
0.994 ms 1 Yes /classes/Product.php:3545
3401
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 9847
ORDER BY `position`
0.994 ms 1 Yes /classes/Product.php:3545
573
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3499
AND image_shop.`cover` = 1 LIMIT 1
0.993 ms 1 /classes/Product.php:3570
3641
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2890) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.993 ms 1 Yes Yes /classes/Product.php:4524
1326
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4016
AND image_shop.`cover` = 1 LIMIT 1
0.992 ms 1 /classes/Product.php:3570
2270
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 9264)
0.992 ms 1 /classes/Product.php:3860
2583
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 9830
ORDER BY f.position ASC
0.992 ms 5 Yes /classes/Product.php:6021
3709
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (6100) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.992 ms 1 Yes Yes /classes/Product.php:4524
3496
SELECT SQL_NO_CACHE c.*, cl.*
FROM `hgt78_category` c
INNER JOIN hgt78_category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1)
LEFT JOIN `hgt78_category_lang` cl ON c.`id_category` = cl.`id_category` AND cl.id_shop = 1 
LEFT JOIN `hgt78_category_group` cg ON c.`id_category` = cg.`id_category`
RIGHT JOIN `hgt78_category` c2 ON c2.`id_category` = 46 AND c.`nleft` >= c2.`nleft` AND c.`nright` <= c2.`nright`
WHERE 1  AND `id_lang` = 1
AND c.`active` = 1
AND cg.`id_group` IN (1)
GROUP BY c.`id_category`
ORDER BY c.`level_depth` ASC
, category_shop.`position` ASC
0.992 ms 9 Yes Yes /classes/Category.php:799
2423
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 9769 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.991 ms 11 Yes /classes/SpecificPrice.php:576
2578
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 9830)
0.991 ms 1 /classes/Product.php:3860
3152
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4989
ORDER BY `position`
0.991 ms 1 Yes /classes/Product.php:3545
2111
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 5642
AND image_shop.`cover` = 1 LIMIT 1
0.990 ms 1 /classes/Product.php:3570
2362
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 9747 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 9747 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.990 ms 0 /classes/Cart.php:1430
3098
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4491
ORDER BY `position`
0.990 ms 1 Yes /classes/Product.php:3545
3050
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4019) AND (b.`id_shop` = 1) LIMIT 1
0.989 ms 1 /src/Adapter/EntityMapper.php:71
2186
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 6134 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 6134 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.988 ms 0 /classes/Cart.php:1430
2676
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 9850 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.987 ms 11 Yes /classes/SpecificPrice.php:576
110
REPLACE INTO hgt78_layered_filter_block (hash, data) VALUES ("cb46ccca810f5afe42821fb778778a0b", "a:1:{s:7:\"filters\";a:6:{i:0;a:7:{s:9:\"type_lite\";s:8:\"category\";s:4:\"type\";s:8:\"category\";s:6:\"id_key\";i:0;s:4:\"name\";s:11:\"Catégories\";s:6:\"values\";a:9:{i:33;a:2:{s:4:\"name\";s:12:\"Articles SPA\";s:3:\"nbr\";s:2:\"42\";}i:34;a:3:{s:4:\"name\";s:9:\"Bien-etre\";s:3:\"nbr\";s:3:\"173\";s:7:\"checked\";b:1;}i:35;a:2:{s:4:\"name\";s:11:\"Décoration\";s:3:\"nbr\";s:3:\"146\";}i:36;a:2:{s:4:\"name\";s:11:\"Esotérisme\";s:3:\"nbr\";s:3:\"299\";}i:37;a:2:{s:4:\"name\";s:14:\"Lithothérapie\";s:3:\"nbr\";s:4:\"1569\";}i:38;a:2:{s:4:\"name\";s:10:\"Luminaires\";s:3:\"nbr\";s:3:\"291\";}i:39;a:2:{s:4:\"name\";s:7:\"Saveurs\";s:3:\"nbr\";s:2:\"13\";}i:40;a:2:{s:4:\"name\";s:8:\"Senteurs\";s:3:\"nbr\";s:3:\"794\";}i:44;a:3:{s:4:\"name\";s:22:\"Encensoirs & Bougeoirs\";s:3:\"nbr\";s:2:\"61\";s:7:\"checked\";b:1;}}s:17:\"filter_show_limit\";i:0;s:11:\"filter_type\";s:1:\"0\";}i:1;a:7:{s:9:\"type_lite\";s:12:\"availability\";s:4:\"type\";s:12:\"availability\";s:6:\"id_key\";i:0;s:4:\"name\";s:14:\"Disponibilité\";s:6:\"values\";a:2:{i:2;a:2:{s:4:\"name\";s:8:\"En stock\";s:3:\"nbr\";i:204;}i:0;a:2:{s:4:\"name\";s:14:\"Non disponible\";s:3:\"nbr\";i:30;}}s:17:\"filter_show_limit\";i:0;s:11:\"filter_type\";s:1:\"0\";}i:2;a:7:{s:9:\"type_lite\";s:12:\"manufacturer\";s:4:\"type\";s:12:\"manufacturer\";s:6:\"id_key\";i:0;s:4:\"name\";s:6:\"Marque\";s:6:\"values\";a:1:{i:2;a:3:{s:4:\"name\";s:3:\"WLM\";s:3:\"nbr\";s:3:\"234\";s:7:\"checked\";b:1;}}s:17:\"filter_show_limit\";i:0;s:11:\"filter_type\";s:1:\"0\";}i:3;a:7:{s:9:\"type_lite\";s:9:\"condition\";s:4:\"type\";s:9:\"condition\";s:6:\"id_key\";i:0;s:4:\"name\";s:5:\"État\";s:6:\"values\";a:3:{s:3:\"new\";a:2:{s:4:\"name\";s:4:\"Neuf\";s:3:\"nbr\";s:3:\"234\";}s:4:\"used\";a:2:{s:4:\"name\";s:8:\"Utilisé\";s:3:\"nbr\";i:0;}s:11:\"refurbished\";a:2:{s:4:\"name\";s:14:\"Reconditionné\";s:3:\"nbr\";i:0;}}s:17:\"filter_show_limit\";i:0;s:11:\"filter_type\";s:1:\"0\";}i:4;a:12:{s:9:\"type_lite\";s:6:\"weight\";s:4:\"type\";s:6:\"weight\";s:6:\"id_key\";i:0;s:4:\"name\";s:5:\"Poids\";s:3:\"max\";d:2443;s:3:\"min\";d:0;s:4:\"unit\";s:2:\"Kg\";s:14:\"specifications\";N;s:17:\"filter_show_limit\";i:0;s:11:\"filter_type\";i:3;s:5:\"value\";N;s:3:\"nbr\";i:234;}i:5;a:12:{s:9:\"type_lite\";s:5:\"price\";s:4:\"type\";s:5:\"price\";s:6:\"id_key\";i:0;s:4:\"name\";s:4:\"Prix\";s:3:\"max\";d:275;s:3:\"min\";d:0;s:4:\"unit\";s:3:\"€\";s:14:\"specifications\";a:11:{s:6:\"symbol\";a:11:{i:0;s:1:\",\";i:1;s:3:\" \";i:2;s:1:\";\";i:3;s:1:\"%\";i:4;s:1:\"-\";i:5;s:1:\"+\";i:6;s:1:\"E\";i:7;s:2:\"×\";i:8;s:3:\"‰\";i:9;s:3:\"∞\";i:10;s:3:\"NaN\";}s:12:\"currencyCode\";s:3:\"EUR\";s:14:\"currencySymbol\";s:3:\"€\";s:13:\"numberSymbols\";a:11:{i:0;s:1:\",\";i:1;s:3:\" \";i:2;s:1:\";\";i:3;s:1:\"%\";i:4;s:1:\"-\";i:5;s:1:\"+\";i:6;s:1:\"E\";i:7;s:2:\"×\";i:8;s:3:\"‰\";i:9;s:3:\"∞\";i:10;s:3:\"NaN\";}s:15:\"positivePattern\";s:12:\"#,##0.00 ¤\";s:15:\"negativePattern\";s:13:\"-#,##0.00 ¤\";s:17:\"maxFractionDigits\";i:2;s:17:\"minFractionDigits\";i:2;s:12:\"groupingUsed\";b:1;s:16:\"primaryGroupSize\";i:3;s:18:\"secondaryGroupSize\";i:3;}s:17:\"filter_show_limit\";i:0;s:11:\"filter_type\";i:3;s:3:\"nbr\";i:234;s:5:\"value\";N;}}}")
0.987 ms 1 /modules/ps_facetedsearch/src/Filters/Block.php:211
3095
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4490
ORDER BY `position`
0.986 ms 1 Yes /classes/Product.php:3545
3529
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 195 AND `id_shop` = 1
0.986 ms 6 /src/Adapter/EntityMapper.php:79
1832
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 5165 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 5165 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.985 ms 0 /classes/Cart.php:1430
3289
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 8969) AND (b.`id_shop` = 1) LIMIT 1
0.985 ms 1 /src/Adapter/EntityMapper.php:71
2065
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 5101 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 5101 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.984 ms 0 /classes/Cart.php:1430
2351
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 9746 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 9746 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.983 ms 0 /classes/Cart.php:1430
2727
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3795
ORDER BY `position`
0.982 ms 1 Yes /classes/Product.php:3545
402
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3196)
0.981 ms 1 /classes/Product.php:3860
2909
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 5074) AND (b.`id_shop` = 1) LIMIT 1
0.980 ms 1 /src/Adapter/EntityMapper.php:71
2296
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 9723 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 9723 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.979 ms 0 /classes/Cart.php:1430
2306
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 9742) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.978 ms 1 /classes/stock/StockAvailable.php:453
3750
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4413) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.978 ms 1 Yes Yes /classes/Product.php:4524
2599
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 9843 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.977 ms 11 Yes /classes/SpecificPrice.php:576
1651
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4698 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.977 ms 10 Yes /classes/SpecificPrice.php:576
3752
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4491) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.976 ms 1 Yes Yes /classes/Product.php:4524
1640
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4583 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.975 ms 10 Yes /classes/SpecificPrice.php:576
2478
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 9788 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.975 ms 11 Yes /classes/SpecificPrice.php:576
3755
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4507) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.975 ms 1 Yes Yes /classes/Product.php:4524
242
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2504 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.975 ms 10 Yes /classes/SpecificPrice.php:576
3265
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 6025) AND (b.`id_shop` = 1) LIMIT 1
0.974 ms 1 /src/Adapter/EntityMapper.php:71
1436
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4033 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4033 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.974 ms 0 /classes/Cart.php:1430
2456
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 9773 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.974 ms 11 Yes /classes/SpecificPrice.php:576
3642
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2834) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.974 ms 1 Yes Yes /classes/Product.php:4524
2071
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 5328 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.973 ms 10 Yes /classes/SpecificPrice.php:576
2088
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 5352
ORDER BY f.position ASC
0.971 ms 5 Yes /classes/Product.php:6021
2445
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 9772 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.970 ms 12 Yes /classes/SpecificPrice.php:576
3112
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4540) AND (b.`id_shop` = 1) LIMIT 1
0.968 ms 1 /src/Adapter/EntityMapper.php:71
158
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3796
ORDER BY f.position ASC
0.967 ms 5 Yes /classes/Product.php:6021
83
SELECT SQL_NO_CACHE c.*, cl.*
FROM `hgt78_category` c
LEFT JOIN `hgt78_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 )
WHERE `name` = 'Encensoirs & Bougeoirs'
AND c.`id_category` != 2
AND c.`id_parent` = 2 LIMIT 1
0.966 ms 7 /classes/Category.php:1500
2500
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 9790 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.966 ms 11 Yes /classes/SpecificPrice.php:576
2834
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3497) AND (b.`id_shop` = 1) LIMIT 1
0.966 ms 1 /src/Adapter/EntityMapper.php:71
2325
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 9744)
0.966 ms 1 /classes/Product.php:3860
341
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `hgt78_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 54 LIMIT 1
0.965 ms 1 /classes/Category.php:1378
2225
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 8947 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.964 ms 11 Yes /classes/SpecificPrice.php:576
3274
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 6135) AND (b.`id_shop` = 1) LIMIT 1
0.964 ms 1 /src/Adapter/EntityMapper.php:71
315
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2890) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.963 ms 1 /classes/stock/StockAvailable.php:453
2203
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 8429 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.962 ms 10 Yes /classes/SpecificPrice.php:576
157
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3796 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3796 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.961 ms 0 /classes/Cart.php:1430
2930
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3986) AND (b.`id_shop` = 1) LIMIT 1
0.960 ms 1 /src/Adapter/EntityMapper.php:71
2121
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 5642
ORDER BY f.position ASC
0.959 ms 5 Yes /classes/Product.php:6021
3104
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4506
ORDER BY `position`
0.959 ms 1 Yes /classes/Product.php:3545
1976
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3982 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3982 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.958 ms 0 /classes/Cart.php:1430
2434
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 9771 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.958 ms 11 Yes /classes/SpecificPrice.php:576
2879
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3801) AND (b.`id_shop` = 1) LIMIT 1
0.958 ms 1 /src/Adapter/EntityMapper.php:71
3746
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4236) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.958 ms 1 Yes Yes /classes/Product.php:4524
3143
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4703
ORDER BY `position`
0.957 ms 1 Yes /classes/Product.php:3545
3368
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 9792
ORDER BY `position`
0.957 ms 1 Yes /classes/Product.php:3545
2369
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 9749)
0.956 ms 1 /classes/Product.php:3860
3758
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4541) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.956 ms 1 Yes Yes /classes/Product.php:4524
954
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 5509 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.955 ms 11 Yes /classes/SpecificPrice.php:576
2823
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3242
ORDER BY `position`
0.955 ms 1 Yes /classes/Product.php:3545
3146
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4704
ORDER BY `position`
0.955 ms 1 Yes /classes/Product.php:3545
16
SELECT SQL_NO_CACHE `id_hook`, `name` FROM `hgt78_hook`
0.954 ms 1185 /classes/Hook.php:1348
169
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3795
ORDER BY f.position ASC
0.954 ms 5 Yes /classes/Product.php:6021
2330
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 9744
ORDER BY f.position ASC
0.954 ms 5 Yes /classes/Product.php:6021
2571
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 9821 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 9821 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.954 ms 0 /classes/Cart.php:1430
1205
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4001
AND image_shop.`cover` = 1 LIMIT 1
0.952 ms 1 /classes/Product.php:3570
1275
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4004 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.952 ms 10 Yes /classes/SpecificPrice.php:576
2957
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 6054) AND (b.`id_shop` = 1) LIMIT 1
0.952 ms 1 /src/Adapter/EntityMapper.php:71
3733
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4016) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.951 ms 1 Yes Yes /classes/Product.php:4524
2082
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 5352 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.949 ms 10 Yes /classes/SpecificPrice.php:576
727
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3950
ORDER BY f.position ASC
0.949 ms 5 Yes /classes/Product.php:6021
1049
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 6099
ORDER BY f.position ASC
0.949 ms 5 Yes /classes/Product.php:6021
2891
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3803) AND (b.`id_shop` = 1) LIMIT 1
0.949 ms 1 /src/Adapter/EntityMapper.php:71
2859
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3943
ORDER BY `position`
0.948 ms 1 Yes /classes/Product.php:3545
3753
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4492) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.948 ms 1 Yes Yes /classes/Product.php:4524
231
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2513 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.947 ms 10 Yes /classes/SpecificPrice.php:576
1662
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4699 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.947 ms 10 Yes /classes/SpecificPrice.php:576
1142
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3997 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.945 ms 10 Yes /classes/SpecificPrice.php:576
2346
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 9746 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.944 ms 11 Yes /classes/SpecificPrice.php:576
2979
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3995
ORDER BY `position`
0.943 ms 1 Yes /classes/Product.php:3545
1348
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4018
AND image_shop.`cover` = 1 LIMIT 1
0.942 ms 1 /classes/Product.php:3570
2489
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 9789 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.942 ms 11 Yes /classes/SpecificPrice.php:576
666
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3944 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.941 ms 10 Yes /classes/SpecificPrice.php:576
3418
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 10738) AND (b.`id_shop` = 1) LIMIT 1
0.940 ms 1 /src/Adapter/EntityMapper.php:71
567
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3497)
0.940 ms 1 /classes/Product.php:3860
2467
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 9774 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.939 ms 11 Yes /classes/SpecificPrice.php:576
3188
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5337
ORDER BY `position`
0.938 ms 4 Yes /classes/Product.php:3545
2858
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3943) AND (b.`id_shop` = 1) LIMIT 1
0.938 ms 1 /src/Adapter/EntityMapper.php:71
2903
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4856) AND (b.`id_shop` = 1) LIMIT 1
0.938 ms 1 /src/Adapter/EntityMapper.php:71
3107
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4507
ORDER BY `position`
0.938 ms 1 Yes /classes/Product.php:3545
2906
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4947) AND (b.`id_shop` = 1) LIMIT 1
0.937 ms 1 /src/Adapter/EntityMapper.php:71
3278
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 8429
ORDER BY `position`
0.937 ms 1 Yes /classes/Product.php:3545
1060
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3993
ORDER BY f.position ASC
0.936 ms 5 Yes /classes/Product.php:6021
2054
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 5085 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 5085 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.936 ms 0 /classes/Cart.php:1430
2637
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 9846 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 9846 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.936 ms 0 /classes/Cart.php:1430
1712
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4703
ORDER BY f.position ASC
0.935 ms 5 Yes /classes/Product.php:6021
2741
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2448) AND (b.`id_shop` = 1) LIMIT 1
0.934 ms 1 /src/Adapter/EntityMapper.php:71
3466
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 38) AND (b.`id_shop` = 1) LIMIT 1
0.933 ms 1 /src/Adapter/EntityMapper.php:71
3493
SELECT SQL_NO_CACHE c.*, cl.*
FROM `hgt78_category` c
INNER JOIN hgt78_category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1)
LEFT JOIN `hgt78_category_lang` cl ON c.`id_category` = cl.`id_category` AND cl.id_shop = 1 
LEFT JOIN `hgt78_category_group` cg ON c.`id_category` = cg.`id_category`
RIGHT JOIN `hgt78_category` c2 ON c2.`id_category` = 45 AND c.`nleft` >= c2.`nleft` AND c.`nright` <= c2.`nright`
WHERE 1  AND `id_lang` = 1
AND c.`active` = 1
AND cg.`id_group` IN (1)
GROUP BY c.`id_category`
ORDER BY c.`level_depth` ASC
, category_shop.`position` ASC
0.933 ms 8 Yes Yes /classes/Category.php:799
334
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2835)
0.932 ms 1 /classes/Product.php:3860
1048
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 6099 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 6099 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.930 ms 0 /classes/Cart.php:1430
1302
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4005 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4005 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.930 ms 0 /classes/Cart.php:1430
2862
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3944
ORDER BY `position`
0.930 ms 1 Yes /classes/Product.php:3545
575
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3499 LIMIT 1
0.929 ms 10 /classes/SpecificPrice.php:435
749
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3951
ORDER BY f.position ASC
0.929 ms 5 Yes /classes/Product.php:6021
3394
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 9845) AND (b.`id_shop` = 1) LIMIT 1
0.929 ms 1 /src/Adapter/EntityMapper.php:71
222
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2448 AND id_shop=1 LIMIT 1
0.928 ms 1 /classes/Product.php:6876
1033
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3992)
0.927 ms 1 /classes/Product.php:3860
1618
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4580 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.927 ms 10 Yes /classes/SpecificPrice.php:576
1286
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 10235 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.924 ms 11 Yes /classes/SpecificPrice.php:576
1530
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4490 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.924 ms 10 Yes /classes/SpecificPrice.php:576
2865
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3945
ORDER BY `position`
0.924 ms 1 Yes /classes/Product.php:3545
3108
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4507
0.924 ms 1 /classes/Product.php:2902
1673
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4700 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.923 ms 10 Yes /classes/SpecificPrice.php:576
2604
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 9843 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 9843 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.922 ms 0 /classes/Cart.php:1430
759
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3802 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3802 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.922 ms 0 /classes/Cart.php:1430
2723
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3796) AND (b.`id_shop` = 1) LIMIT 1
0.922 ms 1 /src/Adapter/EntityMapper.php:71
1987
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3983 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3983 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.921 ms 0 /classes/Cart.php:1430
3645
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2836) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.921 ms 1 Yes Yes /classes/Product.php:4524
179
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2415 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2415 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.920 ms 0 /classes/Cart.php:1430
3089
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4241
ORDER BY `position`
0.920 ms 1 Yes /classes/Product.php:3545
3311
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 9744
ORDER BY `position`
0.920 ms 1 Yes /classes/Product.php:3545
3643
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2835) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.920 ms 1 Yes Yes /classes/Product.php:4524
2973
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3994
ORDER BY `position`
0.920 ms 1 Yes /classes/Product.php:3545
148
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3796
AND image_shop.`cover` = 1 LIMIT 1
0.919 ms 1 /classes/Product.php:3570
3760
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4582) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.918 ms 1 Yes Yes /classes/Product.php:4524
3358
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 9789) AND (b.`id_shop` = 1) LIMIT 1
0.917 ms 1 /src/Adapter/EntityMapper.php:71
1308
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 10236 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.916 ms 11 Yes /classes/SpecificPrice.php:576
1607
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4541 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.915 ms 10 Yes /classes/SpecificPrice.php:576
2912
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 5075) AND (b.`id_shop` = 1) LIMIT 1
0.915 ms 1 /src/Adapter/EntityMapper.php:71
2994
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3998
ORDER BY `position`
0.915 ms 1 Yes /classes/Product.php:3545
1513
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4241 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4241 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.915 ms 0 /classes/Cart.php:1430
2768
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2834) AND (b.`id_shop` = 1) LIMIT 1
0.914 ms 1 /src/Adapter/EntityMapper.php:71
2110
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 5641
ORDER BY f.position ASC
0.913 ms 5 Yes /classes/Product.php:6021
2302
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 9742 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.913 ms 11 Yes /classes/SpecificPrice.php:576
3214
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3982) AND (b.`id_shop` = 1) LIMIT 1
0.912 ms 1 /src/Adapter/EntityMapper.php:71
317
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2890
ORDER BY f.position ASC
0.910 ms 5 Yes /classes/Product.php:6021
588
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3520 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.910 ms 10 Yes /classes/SpecificPrice.php:576
3624
SELECT SQL_NO_CACHE *
FROM `hgt78_currency` c
INNER JOIN hgt78_currency_shop currency_shop
ON (currency_shop.id_currency = c.id_currency AND currency_shop.id_shop = 1)
WHERE c.`deleted` = 0 AND c.`active` = 1 ORDER BY `iso_code` ASC
0.909 ms 2 Yes /classes/Currency.php:694
82
SELECT SQL_NO_CACHE type, id_value, filter_show_limit, filter_type FROM hgt78_layered_category
WHERE controller = 'category'
AND id_category = 2
AND id_shop = 1
GROUP BY `type`, id_value ORDER BY position ASC
0.908 ms 12 Yes Yes /modules/ps_facetedsearch/src/Filters/Provider.php:61
236
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2513 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2513 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.907 ms 0 /classes/Cart.php:1430
2698
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 9852 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.906 ms 11 Yes /classes/SpecificPrice.php:576
2855
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3942) AND (b.`id_shop` = 1) LIMIT 1
0.906 ms 1 /src/Adapter/EntityMapper.php:71
3430
SELECT SQL_NO_CACHE * FROM `hgt78_cart_rule` cr
LEFT JOIN `hgt78_cart_rule_lang` crl 
ON (cr.`id_cart_rule` = crl.`id_cart_rule` AND crl.`id_lang` = 1) WHERE (cr.`id_customer` = 0) AND NOW() BETWEEN cr.date_from AND cr.date_to
AND cr.`active` = 1
AND free_shipping = 1 AND carrier_restriction = 1
0.906 ms 6 /classes/CartRule.php:423
2949
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3989
ORDER BY `position`
0.905 ms 1 Yes /classes/Product.php:3545
2522
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 9792 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.905 ms 11 Yes /classes/SpecificPrice.php:576
654
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3943 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.904 ms 10 Yes /classes/SpecificPrice.php:576
2610
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 9844 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.904 ms 10 Yes /classes/SpecificPrice.php:576
726
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3950 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3950 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.903 ms 0 /classes/Cart.php:1430
2258
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 8970 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.903 ms 17 Yes /classes/SpecificPrice.php:576
1264
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 9521 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.903 ms 11 Yes /classes/SpecificPrice.php:576
678
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3945)
0.902 ms 1 /classes/Product.php:3860
2710
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 10738 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.902 ms 10 Yes /classes/SpecificPrice.php:576
1596
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4540 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.901 ms 10 Yes /classes/SpecificPrice.php:576
1368
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4019 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4019 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.901 ms 0 /classes/Cart.php:1430
3054
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4021
ORDER BY `position`
0.901 ms 1 Yes /classes/Product.php:3545
2886
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3802
ORDER BY `position`
0.900 ms 1 Yes /classes/Product.php:3545
3042
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4016
ORDER BY `position`
0.900 ms 1 Yes /classes/Product.php:3545
502
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3234 AND id_shop=1 LIMIT 1
0.899 ms 1 /classes/Product.php:6876
2809
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3011
0.899 ms 1 /classes/Product.php:2902
3591
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 66) LIMIT 1
0.899 ms 1 /src/Adapter/EntityMapper.php:71
670
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3944) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.897 ms 1 /classes/stock/StockAvailable.php:453
828
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4947
AND image_shop.`cover` = 1 LIMIT 1
0.897 ms 1 /classes/Product.php:3570
2789
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3196) AND (b.`id_shop` = 1) LIMIT 1
0.897 ms 1 /src/Adapter/EntityMapper.php:71
2997
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3999
ORDER BY `position`
0.897 ms 1 Yes /classes/Product.php:3545
123
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3799)
0.896 ms 1 /classes/Product.php:3860
1118
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3996 LIMIT 1
0.894 ms 10 /classes/SpecificPrice.php:435
3726
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4003) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.893 ms 1 Yes Yes /classes/Product.php:4524
195
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2447 LIMIT 1
0.893 ms 10 /classes/SpecificPrice.php:435
822
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4856)
0.893 ms 1 /classes/Product.php:3860
208
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2502
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.892 ms 0 /classes/SpecificPrice.php:259
1667
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4699 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4699 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.892 ms 0 /classes/Cart.php:1430
413
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3197)
0.892 ms 1 /classes/Product.php:3860
3397
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 9846) AND (b.`id_shop` = 1) LIMIT 1
0.892 ms 1 /src/Adapter/EntityMapper.php:71
3148
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4718) AND (b.`id_shop` = 1) LIMIT 1
0.891 ms 1 /src/Adapter/EntityMapper.php:71
493
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3028) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.891 ms 1 /classes/stock/StockAvailable.php:453
3008
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4001) AND (b.`id_shop` = 1) LIMIT 1
0.891 ms 1 /src/Adapter/EntityMapper.php:71
282
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2600 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2600 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.890 ms 0 /classes/Cart.php:1430
899
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3985 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.889 ms 10 Yes /classes/SpecificPrice.php:576
2385
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 9751
ORDER BY f.position ASC
0.889 ms 5 Yes /classes/Product.php:6021
3062
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4030
ORDER BY `position`
0.889 ms 1 Yes /classes/Product.php:3545
916
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 5415
ORDER BY f.position ASC
0.887 ms 5 Yes /classes/Product.php:6021
1936
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3979 LIMIT 1
0.887 ms 10 /classes/SpecificPrice.php:435
1871
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 5337 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.887 ms 10 Yes /classes/SpecificPrice.php:576
1541
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4491 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.886 ms 10 Yes /classes/SpecificPrice.php:576
3751
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4490) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.886 ms 1 Yes Yes /classes/Product.php:4524
1384
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4022) AND (b.`id_shop` = 1) LIMIT 1
0.885 ms 1 /src/Adapter/EntityMapper.php:71
2309
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 9743
AND image_shop.`cover` = 1 LIMIT 1
0.885 ms 1 /classes/Product.php:3570
1999
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3984
ORDER BY f.position ASC
0.884 ms 5 Yes /classes/Product.php:6021
3298
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 9721) AND (b.`id_shop` = 1) LIMIT 1
0.884 ms 1 /src/Adapter/EntityMapper.php:71
136
SELECT SQL_NO_CACHE tr.*
FROM `hgt78_tax_rule` tr
JOIN `hgt78_tax_rules_group` trg ON (tr.`id_tax_rules_group` = trg.`id_tax_rules_group`)
WHERE trg.`active` = 1
AND tr.`id_country` = 8
AND tr.`id_tax_rules_group` = 28
AND tr.`id_state` IN (0, 0)
AND ('0' BETWEEN tr.`zipcode_from` AND tr.`zipcode_to`
OR (tr.`zipcode_to` = 0 AND tr.`zipcode_from` IN(0, '0')))
ORDER BY tr.`zipcode_from` DESC, tr.`zipcode_to` DESC, tr.`id_state` DESC, tr.`id_country` DESC
0.884 ms 1 /classes/tax/TaxRulesTaxManager.php:109
2934
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5418
ORDER BY `position`
0.883 ms 1 Yes /classes/Product.php:3545
2032
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 5084 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 5084 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.882 ms 0 /classes/Cart.php:1430
3115
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4541) AND (b.`id_shop` = 1) LIMIT 1
0.882 ms 1 /src/Adapter/EntityMapper.php:71
3197
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4488
ORDER BY `position`
0.881 ms 1 Yes /classes/Product.php:3545
1696
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4702)
0.881 ms 1 /classes/Product.php:3860
772
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3803
AND image_shop.`cover` = 1 LIMIT 1
0.880 ms 1 /classes/Product.php:3570
988
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3989 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.880 ms 10 Yes /classes/SpecificPrice.php:576
1110
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 6102)
0.880 ms 1 /classes/Product.php:3860
1232
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4002)
0.880 ms 1 /classes/Product.php:3860
3280
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 8946) AND (b.`id_shop` = 1) LIMIT 1
0.880 ms 1 /src/Adapter/EntityMapper.php:71
2544
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 9819 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.879 ms 10 Yes /classes/SpecificPrice.php:576
3190
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 5638) AND (b.`id_shop` = 1) LIMIT 1
0.879 ms 1 /src/Adapter/EntityMapper.php:71
3271
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 6134) AND (b.`id_shop` = 1) LIMIT 1
0.878 ms 1 /src/Adapter/EntityMapper.php:71
1954
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3980 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3980 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.877 ms 0 /classes/Cart.php:1430
1504
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4241
AND image_shop.`cover` = 1 LIMIT 1
0.875 ms 1 /classes/Product.php:3570
2861
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3944) AND (b.`id_shop` = 1) LIMIT 1
0.875 ms 1 /src/Adapter/EntityMapper.php:71
3217
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3983) AND (b.`id_shop` = 1) LIMIT 1
0.875 ms 1 /src/Adapter/EntityMapper.php:71
888
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 5373 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.874 ms 10 Yes /classes/SpecificPrice.php:576
1590
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4508 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4508 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.874 ms 0 /classes/Cart.php:1430
2384
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 9751 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 9751 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.873 ms 0 /classes/Cart.php:1430
87
SELECT SQL_NO_CACHE m.*, ml.`description`, ml.`short_description`
FROM `hgt78_manufacturer` m INNER JOIN hgt78_manufacturer_shop manufacturer_shop
ON (manufacturer_shop.id_manufacturer = m.id_manufacturer AND manufacturer_shop.id_shop = 1)INNER JOIN `hgt78_manufacturer_lang` ml ON (m.`id_manufacturer` = ml.`id_manufacturer` AND ml.`id_lang` = 1)WHERE 1 AND m.`active` = 1 ORDER BY m.`name` ASC
0.873 ms 4 Yes /classes/Manufacturer.php:211
351
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2918
ORDER BY f.position ASC
0.873 ms 5 Yes /classes/Product.php:6021
2870
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3947) AND (b.`id_shop` = 1) LIMIT 1
0.872 ms 1 /src/Adapter/EntityMapper.php:71
2988
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 6120
ORDER BY `position`
0.872 ms 1 Yes /classes/Product.php:3545
3427
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4022) AND (b.`id_shop` = 1) LIMIT 1
0.872 ms 1 /src/Adapter/EntityMapper.php:71
3359
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 9789
ORDER BY `position`
0.871 ms 1 Yes /classes/Product.php:3545
2817
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3234
ORDER BY `position`
0.870 ms 1 Yes /classes/Product.php:3545
318
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2834
AND image_shop.`cover` = 1 LIMIT 1
0.870 ms 1 /classes/Product.php:3570
882
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 5113 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 5113 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.870 ms 0 /classes/Cart.php:1430
1849
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 5167 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.869 ms 10 Yes /classes/SpecificPrice.php:576
3367
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 9792) AND (b.`id_shop` = 1) LIMIT 1
0.869 ms 1 /src/Adapter/EntityMapper.php:71
3172
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 5164) AND (b.`id_shop` = 1) LIMIT 1
0.868 ms 1 /src/Adapter/EntityMapper.php:71
247
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2504 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2504 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.867 ms 0 /classes/Cart.php:1430
226
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2448
ORDER BY f.position ASC
0.867 ms 5 Yes /classes/Product.php:6021
311
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2890 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.867 ms 10 Yes /classes/SpecificPrice.php:576
2880
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3801
ORDER BY `position`
0.867 ms 1 Yes /classes/Product.php:3545
3262
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 6024) AND (b.`id_shop` = 1) LIMIT 1
0.867 ms 1 /src/Adapter/EntityMapper.php:71
2826
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3236
ORDER BY `position`
0.866 ms 1 Yes /classes/Product.php:3545
3714
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3996) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.866 ms 1 Yes Yes /classes/Product.php:4524
637
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3791 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3791 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.865 ms 0 /classes/Cart.php:1430
1656
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4698 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4698 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.865 ms 0 /classes/Cart.php:1430
2889
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3952
ORDER BY `position`
0.865 ms 1 Yes /classes/Product.php:3545
3712
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3995) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.865 ms 1 Yes Yes /classes/Product.php:4524
2021
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4027 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4027 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.864 ms 0 /classes/Cart.php:1430
1751
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 5076)
0.864 ms 1 /classes/Product.php:3860
2319
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 9743
ORDER BY f.position ASC
0.863 ms 5 Yes /classes/Product.php:6021
175
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2415)
0.862 ms 1 /classes/Product.php:3860
1745
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4989
ORDER BY f.position ASC
0.862 ms 5 Yes /classes/Product.php:6021
1821
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 5164 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 5164 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.862 ms 0 /classes/Cart.php:1430
2952
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3990
ORDER BY `position`
0.862 ms 1 Yes /classes/Product.php:3545
3754
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4506) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.861 ms 1 Yes Yes /classes/Product.php:4524
2876
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3950) AND (b.`id_shop` = 1) LIMIT 1
0.861 ms 1 /src/Adapter/EntityMapper.php:71
3599
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 36) AND (b.`id_shop` = 1) LIMIT 1
0.861 ms 1 /src/Adapter/EntityMapper.php:71
89
SELECT SQL_NO_CACHE data FROM hgt78_layered_filter_block WHERE hash="cb46ccca810f5afe42821fb778778a0b" LIMIT 1
0.859 ms 1 /modules/ps_facetedsearch/src/Filters/Block.php:186
540
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3257
AND image_shop.`cover` = 1 LIMIT 1
0.858 ms 1 /classes/Product.php:3570
999
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3990 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.857 ms 10 Yes /classes/SpecificPrice.php:576
131
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_group`
WHERE `id_group` = 1 LIMIT 1
0.857 ms 1 /classes/Group.php:154
1092
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 6101 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 6101 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.856 ms 0 /classes/Cart.php:1430
344
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2918
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.854 ms 0 /classes/SpecificPrice.php:259
2098
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 5640 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 5640 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.854 ms 0 /classes/Cart.php:1430
2732
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2475) AND (b.`id_shop` = 1) LIMIT 1
0.854 ms 1 /src/Adapter/EntityMapper.php:71
2778
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2836
ORDER BY `position`
0.854 ms 1 Yes /classes/Product.php:3545
716
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3949
ORDER BY f.position ASC
0.853 ms 5 Yes /classes/Product.php:6021
1038
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3992
ORDER BY f.position ASC
0.853 ms 5 Yes /classes/Product.php:6021
2798
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3198) AND (b.`id_shop` = 1) LIMIT 1
0.853 ms 1 /src/Adapter/EntityMapper.php:71
3596
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 80 AND `id_shop` = 1
0.853 ms 6 /src/Adapter/EntityMapper.php:79
1762
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 5077)
0.852 ms 1 /classes/Product.php:3860
178
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2415) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.852 ms 1 /classes/stock/StockAvailable.php:453
3592
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 66 AND `id_shop` = 1
0.851 ms 6 /src/Adapter/EntityMapper.php:79
300
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2601 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.851 ms 10 Yes /classes/SpecificPrice.php:576
948
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3987 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3987 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.851 ms 0 /classes/Cart.php:1430
2963
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 6099) AND (b.`id_shop` = 1) LIMIT 1
0.851 ms 1 /src/Adapter/EntityMapper.php:71
3644
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2918) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.850 ms 1 Yes Yes /classes/Product.php:4524
2966
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3993) AND (b.`id_shop` = 1) LIMIT 1
0.849 ms 1 /src/Adapter/EntityMapper.php:71
293
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2889 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2889 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.848 ms 0 /classes/Cart.php:1430
3199
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4489) AND (b.`id_shop` = 1) LIMIT 1
0.847 ms 1 /src/Adapter/EntityMapper.php:71
3110
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4508
ORDER BY `position`
0.847 ms 1 Yes /classes/Product.php:3545
3362
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 9790
ORDER BY `position`
0.846 ms 1 Yes /classes/Product.php:3545
1724
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4718
AND image_shop.`cover` = 1 LIMIT 1
0.845 ms 1 /classes/Product.php:3570
2555
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 9820 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.845 ms 10 Yes /classes/SpecificPrice.php:576
2985
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3996
ORDER BY `position`
0.845 ms 1 Yes /classes/Product.php:3545
3638
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2600) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.844 ms 1 Yes Yes /classes/Product.php:4524
340
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2918
AND image_shop.`cover` = 1 LIMIT 1
0.841 ms 1 /classes/Product.php:3570
1921
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4489 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4489 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.840 ms 0 /classes/Cart.php:1430
403
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3196 AND id_shop=1 LIMIT 1
0.840 ms 1 /classes/Product.php:6876
1254
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4003)
0.840 ms 1 /classes/Product.php:3860
3232
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 5083) AND (b.`id_shop` = 1) LIMIT 1
0.840 ms 1 /src/Adapter/EntityMapper.php:71
3371
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 9794
ORDER BY `position`
0.840 ms 1 Yes /classes/Product.php:3545
3176
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5165
ORDER BY `position`
0.839 ms 1 Yes /classes/Product.php:3545
614
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3788) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.838 ms 1 /classes/stock/StockAvailable.php:453
3283
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 8947) AND (b.`id_shop` = 1) LIMIT 1
0.838 ms 1 /src/Adapter/EntityMapper.php:71
3092
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4413
ORDER BY `position`
0.837 ms 1 Yes /classes/Product.php:3545
3149
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4718
ORDER BY `position`
0.837 ms 1 Yes /classes/Product.php:3545
2894
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4297) AND (b.`id_shop` = 1) LIMIT 1
0.836 ms 1 /src/Adapter/EntityMapper.php:71
3797
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (5083) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.836 ms 1 Yes Yes /classes/Product.php:4524
1732
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4718) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.835 ms 1 /classes/stock/StockAvailable.php:453
537
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3236) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.835 ms 1 /classes/stock/StockAvailable.php:453
609
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3788
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.835 ms 1 /classes/SpecificPrice.php:259
1160
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3999
AND image_shop.`cover` = 1 LIMIT 1
0.835 ms 1 /classes/Product.php:3570
210
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2502)
0.833 ms 1 /classes/Product.php:3860
470
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3011 AND `id_group` = 1 LIMIT 1
0.833 ms 0 /classes/GroupReduction.php:156
2892
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3803
ORDER BY `position`
0.833 ms 1 Yes /classes/Product.php:3545
3191
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5638
ORDER BY `position`
0.833 ms 1 Yes /classes/Product.php:3545
1375
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4021 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.832 ms 10 Yes /classes/SpecificPrice.php:576
3101
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4492
ORDER BY `position`
0.832 ms 1 Yes /classes/Product.php:3545
1226
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 8357
ORDER BY f.position ASC
0.831 ms 5 Yes /classes/Product.php:6021
617
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3790
AND image_shop.`cover` = 1 LIMIT 1
0.830 ms 1 /classes/Product.php:3570
832
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4947
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.829 ms 0 /classes/SpecificPrice.php:259
512
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3235)
0.828 ms 1 /classes/Product.php:3860
2197
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 6135 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 6135 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.828 ms 0 /classes/Cart.php:1430
2867
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3946) AND (b.`id_shop` = 1) LIMIT 1
0.828 ms 1 /src/Adapter/EntityMapper.php:71
1243
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 8637)
0.828 ms 1 /classes/Product.php:3860
604
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3500 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3500 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.827 ms 0 /classes/Cart.php:1430
739
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3951
AND image_shop.`cover` = 1 LIMIT 1
0.827 ms 1 /classes/Product.php:3570
1702
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4703
AND image_shop.`cover` = 1 LIMIT 1
0.827 ms 1 /classes/Product.php:3570
1344
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4017 AND `id_group` = 1 LIMIT 1
0.826 ms 0 /classes/GroupReduction.php:156
3748
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4239) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.826 ms 1 Yes Yes /classes/Product.php:4524
893
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 5373 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 5373 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.826 ms 0 /classes/Cart.php:1430
977
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 5510 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.826 ms 11 Yes /classes/SpecificPrice.php:576
1126
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3996
ORDER BY f.position ASC
0.825 ms 5 Yes /classes/Product.php:6021
1480
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4236 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4236 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.824 ms 0 /classes/Cart.php:1430
1905
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4488 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.824 ms 10 Yes /classes/SpecificPrice.php:576
2219
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 8946 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 8946 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.824 ms 0 /classes/Cart.php:1430
2406
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 9767 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 9767 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.824 ms 0 /classes/Cart.php:1430
2933
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 5418) AND (b.`id_shop` = 1) LIMIT 1
0.824 ms 1 /src/Adapter/EntityMapper.php:71
3077
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4036
ORDER BY `position`
0.822 ms 1 Yes /classes/Product.php:3545
2829
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3257
ORDER BY `position`
0.821 ms 1 Yes /classes/Product.php:3545
549
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3257 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3257 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.821 ms 0 /classes/Cart.php:1430
3728
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4004) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.821 ms 1 Yes Yes /classes/Product.php:4524
856
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 5075)
0.820 ms 1 /classes/Product.php:3860
1746
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 5076
AND image_shop.`cover` = 1 LIMIT 1
0.820 ms 2 /classes/Product.php:3570
278
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2600)
0.819 ms 1 /classes/Product.php:3860
1773
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 5080)
0.818 ms 1 /classes/Product.php:3860
2336
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 9745)
0.818 ms 1 /classes/Product.php:3860
1535
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4490 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4490 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.816 ms 0 /classes/Cart.php:1430
3732
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (10932) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.816 ms 1 Yes Yes /classes/Product.php:4524
1280
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4004 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4004 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.815 ms 0 /classes/Cart.php:1430
261
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2808
AND image_shop.`cover` = 1 LIMIT 1
0.813 ms 1 /classes/Product.php:3570
2840
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3520) AND (b.`id_shop` = 1) LIMIT 1
0.813 ms 1 /src/Adapter/EntityMapper.php:71
1127
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 6120
AND image_shop.`cover` = 1 LIMIT 1
0.812 ms 1 /classes/Product.php:3570
3220
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3984) AND (b.`id_shop` = 1) LIMIT 1
0.812 ms 1 /src/Adapter/EntityMapper.php:71
137
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3797
AND image_shop.`cover` = 1 LIMIT 1
0.811 ms 1 /classes/Product.php:3570
2077
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 5328
ORDER BY f.position ASC
0.811 ms 5 Yes /classes/Product.php:6021
348
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2918 AND `id_group` = 1 LIMIT 1
0.810 ms 0 /classes/GroupReduction.php:156
525
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3242 AND `id_group` = 1 LIMIT 1
0.810 ms 0 /classes/GroupReduction.php:156
383
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2898 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2898 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.810 ms 0 /classes/Cart.php:1430
1965
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3981 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3981 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.810 ms 0 /classes/Cart.php:1430
2960
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3992) AND (b.`id_shop` = 1) LIMIT 1
0.810 ms 1 /src/Adapter/EntityMapper.php:71
3749
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4241) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.810 ms 1 Yes Yes /classes/Product.php:4524
1221
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 8357)
0.809 ms 1 /classes/Product.php:3860
3230
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5084
ORDER BY `position`
0.808 ms 1 Yes /classes/Product.php:3545
372
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2944 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2944 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.807 ms 0 /classes/Cart.php:1430
2897
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4298) AND (b.`id_shop` = 1) LIMIT 1
0.806 ms 1 /src/Adapter/EntityMapper.php:71
3700
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3988) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.806 ms 1 Yes Yes /classes/Product.php:4524
3322
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 9747) AND (b.`id_shop` = 1) LIMIT 1
0.805 ms 1 /src/Adapter/EntityMapper.php:71
3454
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 40) AND (b.`id_shop` = 1) LIMIT 1
0.805 ms 1 /src/Adapter/EntityMapper.php:71
3121
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4582) AND (b.`id_shop` = 1) LIMIT 1
0.804 ms 1 /src/Adapter/EntityMapper.php:71
330
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 44 LIMIT 1
0.803 ms 1 /classes/Product.php:5659
1132
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 6120)
0.803 ms 1 /classes/Product.php:3860
1313
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 10236 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 10236 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.803 ms 0 /classes/Cart.php:1430
2164
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 6025 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 6025 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.803 ms 0 /classes/Cart.php:1430
2852
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3791) AND (b.`id_shop` = 1) LIMIT 1
0.803 ms 1 /src/Adapter/EntityMapper.php:71
272
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2808
ORDER BY f.position ASC
0.801 ms 5 Yes /classes/Product.php:6021
2611
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 9844)
0.801 ms 1 /classes/Product.php:3860
2786
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2899) AND (b.`id_shop` = 1) LIMIT 1
0.800 ms 1 /src/Adapter/EntityMapper.php:71
3637
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2808) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.800 ms 1 Yes Yes /classes/Product.php:4524
3639
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2889) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.799 ms 1 Yes Yes /classes/Product.php:4524
1105
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 6102
AND image_shop.`cover` = 1 LIMIT 1
0.799 ms 1 /classes/Product.php:3570
1415
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4030
ORDER BY f.position ASC
0.798 ms 5 Yes /classes/Product.php:6021
3277
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 8429) AND (b.`id_shop` = 1) LIMIT 1
0.798 ms 1 /src/Adapter/EntityMapper.php:71
505
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3234 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3234 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.797 ms 0 /classes/Cart.php:1430
2760
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2889
ORDER BY `position`
0.796 ms 1 Yes /classes/Product.php:3545
1841
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 5166 AND `id_group` = 1 LIMIT 1
0.796 ms 0 /classes/GroupReduction.php:156
1147
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3997 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3997 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.795 ms 0 /classes/Cart.php:1430
850
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 5074
ORDER BY f.position ASC
0.794 ms 5 Yes /classes/Product.php:6021
3169
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 5104) AND (b.`id_shop` = 1) LIMIT 1
0.794 ms 1 /src/Adapter/EntityMapper.php:71
3453
SELECT SQL_NO_CACHE c.id_cms, cl.link_rewrite, cl.meta_title
FROM hgt78_cms c
LEFT JOIN hgt78_cms_lang cl ON (c.id_cms = cl.id_cms AND cl.id_lang = 1 AND cl.id_shop = 1)
INNER JOIN hgt78_cms_shop cms_shop
ON (cms_shop.id_cms = c.id_cms AND cms_shop.id_shop = 1)
WHERE 1
AND c.id_cms IN (17) AND c.`active` = 1 GROUP BY c.id_cms
ORDER BY c.`position`
0.794 ms 1 Yes /classes/CMS.php:151
151
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3796
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.793 ms 0 /classes/SpecificPrice.php:259
2681
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 9850 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 9850 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.793 ms 0 /classes/Cart.php:1430
456
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3199 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.792 ms 10 Yes /classes/SpecificPrice.php:576
2687
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 9851 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.792 ms 11 Yes /classes/SpecificPrice.php:576
182
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `hgt78_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 200 LIMIT 1
0.791 ms 1 /classes/Category.php:1378
246
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2504) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.790 ms 1 /classes/stock/StockAvailable.php:453
2751
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2514
ORDER BY `position`
0.790 ms 1 Yes /classes/Product.php:3545
2946
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5510
ORDER BY `position`
0.790 ms 1 Yes /classes/Product.php:3545
445
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3010 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.790 ms 10 Yes /classes/SpecificPrice.php:576
2131
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 6018 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 6018 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.790 ms 0 /classes/Cart.php:1430
3463
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 165 AND `id_shop` = 1
0.790 ms 6 /src/Adapter/EntityMapper.php:79
3717
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3998) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.790 ms 1 Yes Yes /classes/Product.php:4524
1237
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4002
ORDER BY f.position ASC
0.789 ms 5 Yes /classes/Product.php:6021
1027
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 6054
ORDER BY f.position ASC
0.787 ms 5 Yes /classes/Product.php:6021
1258
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4003 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4003 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.786 ms 0 /classes/Cart.php:1430
2005
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2930 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.786 ms 10 Yes /classes/SpecificPrice.php:576
2292
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 9723)
0.785 ms 1 /classes/Product.php:3860
2849
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3790) AND (b.`id_shop` = 1) LIMIT 1
0.785 ms 1 /src/Adapter/EntityMapper.php:71
1005
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3990
ORDER BY f.position ASC
0.785 ms 5 Yes /classes/Product.php:6021
2784
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2898
ORDER BY `position`
0.784 ms 1 Yes /classes/Product.php:3545
804
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4298
ORDER BY f.position ASC
0.782 ms 5 Yes /classes/Product.php:6021
1687
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4701 AND `id_group` = 1 LIMIT 1
0.782 ms 0 /classes/GroupReduction.php:156
2533
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 9794 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.782 ms 11 Yes /classes/SpecificPrice.php:576
780
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3803) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.780 ms 1 /classes/stock/StockAvailable.php:453
3223
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2930) AND (b.`id_shop` = 1) LIMIT 1
0.780 ms 1 /src/Adapter/EntityMapper.php:71
644
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3942)
0.779 ms 1 /classes/Product.php:3860
3118
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4580) AND (b.`id_shop` = 1) LIMIT 1
0.779 ms 1 /src/Adapter/EntityMapper.php:71
3059
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4029
ORDER BY `position`
0.778 ms 1 Yes /classes/Product.php:3545
778
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3803 AND id_shop=1 LIMIT 1
0.777 ms 1 /classes/Product.php:6876
919
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3986 LIMIT 1
0.777 ms 10 /classes/SpecificPrice.php:435
930
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 5418 LIMIT 1
0.777 ms 10 /classes/SpecificPrice.php:435
1055
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3993)
0.777 ms 1 /classes/Product.php:3860
3590
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 61 AND `id_shop` = 1
0.777 ms 6 /src/Adapter/EntityMapper.php:79
419
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2945
AND image_shop.`cover` = 1 LIMIT 1
0.776 ms 1 /classes/Product.php:3570
3226
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4027) AND (b.`id_shop` = 1) LIMIT 1
0.776 ms 1 /src/Adapter/EntityMapper.php:71
3229
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 5084) AND (b.`id_shop` = 1) LIMIT 1
0.776 ms 1 /src/Adapter/EntityMapper.php:71
3618
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 39 AND `id_shop` = 1
0.776 ms 6 /src/Adapter/EntityMapper.php:79
139
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3797 LIMIT 1
0.775 ms 10 /classes/SpecificPrice.php:435
2527
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 9792 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 9792 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.775 ms 0 /classes/Cart.php:1430
2665
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 9849 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.775 ms 11 Yes /classes/SpecificPrice.php:576
514
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3235 AND `id_group` = 1 LIMIT 1
0.775 ms 0 /classes/GroupReduction.php:156
2945
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 5510) AND (b.`id_shop` = 1) LIMIT 1
0.775 ms 1 /src/Adapter/EntityMapper.php:71
1790
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 5103
AND image_shop.`cover` = 1 LIMIT 1
0.774 ms 1 /classes/Product.php:3570
3036
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 10236
ORDER BY `position`
0.774 ms 1 Yes /classes/Product.php:3545
2483
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 9788 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 9788 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.773 ms 0 /classes/Cart.php:1430
283
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2600
ORDER BY f.position ASC
0.773 ms 5 Yes /classes/Product.php:6021
1136
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 6120 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 6120 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.773 ms 0 /classes/Cart.php:1430
1431
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4033 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.773 ms 10 Yes /classes/SpecificPrice.php:576
2274
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 9264 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 9264 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.773 ms 0 /classes/Cart.php:1430
2401
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 9767 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.773 ms 11 Yes /classes/SpecificPrice.php:576
1338
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 45 LIMIT 1
0.772 ms 1 /classes/Product.php:5659
2775
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2918
ORDER BY `position`
0.772 ms 1 Yes /classes/Product.php:3545
3056
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4022
ORDER BY `position`
0.772 ms 1 Yes /classes/Product.php:3545
867
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 5106)
0.771 ms 1 /classes/Product.php:3860
227
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2513
AND image_shop.`cover` = 1 LIMIT 1
0.770 ms 1 /classes/Product.php:3570
3703
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3990) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.770 ms 1 Yes Yes /classes/Product.php:4524
3441
SELECT SQL_NO_CACHE *
FROM `hgt78_currency` c
INNER JOIN hgt78_currency_shop currency_shop
ON (currency_shop.id_currency = c.id_currency AND currency_shop.id_shop = 1)
WHERE c.`deleted` = 0 AND c.`active` = 1 ORDER BY `iso_code` ASC
0.770 ms 2 Yes /classes/Currency.php:694
1251
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4003 LIMIT 1
0.769 ms 10 /classes/SpecificPrice.php:435
2584
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 9842
AND image_shop.`cover` = 1 LIMIT 1
0.769 ms 1 /classes/Product.php:3570
3301
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 9723) AND (b.`id_shop` = 1) LIMIT 1
0.769 ms 1 /src/Adapter/EntityMapper.php:71
1838
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 5166 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.768 ms 10 Yes /classes/SpecificPrice.php:576
693
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3946 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3946 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.768 ms 0 /classes/Cart.php:1430
2931
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3986
ORDER BY `position`
0.768 ms 1 Yes /classes/Product.php:3545
584
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3520
AND image_shop.`cover` = 1 LIMIT 1
0.767 ms 1 /classes/Product.php:3570
2703
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 9852 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 9852 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.767 ms 0 /classes/Cart.php:1430
2925
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3985
ORDER BY `position`
0.767 ms 1 Yes /classes/Product.php:3545
3211
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3981) AND (b.`id_shop` = 1) LIMIT 1
0.767 ms 1 /src/Adapter/EntityMapper.php:71
3465
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 169 AND `id_shop` = 1
0.767 ms 6 /src/Adapter/EntityMapper.php:79
1353
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4018)
0.766 ms 1 /classes/Product.php:3860
3290
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 8969
ORDER BY `position`
0.766 ms 4 Yes /classes/Product.php:3545
3701
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (5510) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.766 ms 1 Yes Yes /classes/Product.php:4524
521
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3242
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.765 ms 0 /classes/SpecificPrice.php:259
562
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3497
AND image_shop.`cover` = 1 LIMIT 1
0.765 ms 1 /classes/Product.php:3570
815
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4299
ORDER BY f.position ASC
0.765 ms 5 Yes /classes/Product.php:6021
959
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 5509 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 5509 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.765 ms 0 /classes/Cart.php:1430
2505
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 9790 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 9790 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.765 ms 0 /classes/Cart.php:1430
3415
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 9852) AND (b.`id_shop` = 1) LIMIT 1
0.765 ms 1 /src/Adapter/EntityMapper.php:71
683
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3945
ORDER BY f.position ASC
0.765 ms 5 Yes /classes/Product.php:6021
1182
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4000
AND image_shop.`cover` = 1 LIMIT 1
0.764 ms 1 /classes/Product.php:3570
2781
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2944
ORDER BY `position`
0.764 ms 1 Yes /classes/Product.php:3545
3398
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 9846
ORDER BY `position`
0.763 ms 1 Yes /classes/Product.php:3545
388
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2899
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.763 ms 0 /classes/SpecificPrice.php:259
2814
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3028
ORDER BY `position`
0.763 ms 1 Yes /classes/Product.php:3545
769
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3952) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.762 ms 1 /classes/stock/StockAvailable.php:453
872
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 5106
ORDER BY f.position ASC
0.762 ms 5 Yes /classes/Product.php:6021
1410
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4030)
0.762 ms 1 /classes/Product.php:3860
2375
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 9751
AND image_shop.`cover` = 1 LIMIT 1
0.762 ms 1 /classes/Product.php:3570
3796
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (5084) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.762 ms 1 Yes Yes /classes/Product.php:4524
1085
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 6101 LIMIT 1
0.760 ms 10 /classes/SpecificPrice.php:435
2076
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 5328 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 5328 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.760 ms 0 /classes/Cart.php:1430
260
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2514
ORDER BY f.position ASC
0.759 ms 5 Yes /classes/Product.php:6021
1629
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4582 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.759 ms 10 Yes /classes/SpecificPrice.php:576
3235
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 5085) AND (b.`id_shop` = 1) LIMIT 1
0.759 ms 1 /src/Adapter/EntityMapper.php:71
766
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3952)
0.758 ms 1 /classes/Product.php:3860
2772
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2835
ORDER BY `position`
0.757 ms 1 Yes /classes/Product.php:3545
3238
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 5101) AND (b.`id_shop` = 1) LIMIT 1
0.757 ms 1 /src/Adapter/EntityMapper.php:71
3795
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4027) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.757 ms 1 Yes Yes /classes/Product.php:4524
1320
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 10932)
0.756 ms 1 /classes/Product.php:3860
1646
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4583
ORDER BY f.position ASC
0.756 ms 5 Yes /classes/Product.php:6021
2549
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 9819 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 9819 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.756 ms 0 /classes/Cart.php:1430
3820
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (9723) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.756 ms 1 Yes Yes /classes/Product.php:4524
2622
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 9845)
0.755 ms 1 /classes/Product.php:3860
3295
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 9264) AND (b.`id_shop` = 1) LIMIT 1
0.754 ms 1 /src/Adapter/EntityMapper.php:71
2874
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3949
ORDER BY `position`
0.754 ms 1 Yes /classes/Product.php:3545
1442
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4034 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.753 ms 10 Yes /classes/SpecificPrice.php:576
2428
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 9769 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 9769 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.753 ms 0 /classes/Cart.php:1430
3204
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3978
0.753 ms 1 /classes/Product.php:2902
273
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2600
AND image_shop.`cover` = 1 LIMIT 1
0.752 ms 1 /classes/Product.php:3570
2617
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 9845
AND image_shop.`cover` = 1 LIMIT 1
0.752 ms 1 /classes/Product.php:3570
321
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2834
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.751 ms 0 /classes/SpecificPrice.php:259
1707
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4703)
0.751 ms 1 /classes/Product.php:3860
3307
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 9743) AND (b.`id_shop` = 1) LIMIT 1
0.750 ms 1 /src/Adapter/EntityMapper.php:71
799
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4298)
0.749 ms 1 /classes/Product.php:3860
164
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3795)
0.747 ms 1 /classes/Product.php:3860
2472
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 9774 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 9774 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.747 ms 0 /classes/Cart.php:1430
3002
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4000) AND (b.`id_shop` = 1) LIMIT 1
0.747 ms 1 /src/Adapter/EntityMapper.php:71
1181
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3018
ORDER BY f.position ASC
0.746 ms 5 Yes /classes/Product.php:6021
2099
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 5640
ORDER BY f.position ASC
0.746 ms 5 Yes /classes/Product.php:6021
2843
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3500) AND (b.`id_shop` = 1) LIMIT 1
0.746 ms 1 /src/Adapter/EntityMapper.php:71
1083
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 6101
AND image_shop.`cover` = 1 LIMIT 1
0.745 ms 1 /classes/Product.php:3570
2671
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 9849
ORDER BY f.position ASC
0.745 ms 5 Yes /classes/Product.php:6021
3304
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 9742) AND (b.`id_shop` = 1) LIMIT 1
0.744 ms 1 /src/Adapter/EntityMapper.php:71
857
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 5075 AND id_shop=1 LIMIT 1
0.744 ms 1 /classes/Product.php:6876
1552
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4492 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.744 ms 10 Yes /classes/SpecificPrice.php:576
1951
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3980 AND id_shop=1 LIMIT 1
0.744 ms 1 /classes/Product.php:6876
775
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3803
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.743 ms 0 /classes/SpecificPrice.php:259
1464
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4036 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.743 ms 10 Yes /classes/SpecificPrice.php:576
3206
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3979
ORDER BY `position`
0.743 ms 1 Yes /classes/Product.php:3545
1685
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4701)
0.743 ms 1 /classes/Product.php:3860
1816
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 5164 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.743 ms 10 Yes /classes/SpecificPrice.php:576
1039
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 6099
AND image_shop.`cover` = 1 LIMIT 1
0.742 ms 1 /classes/Product.php:3570
1080
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3994) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.742 ms 1 /classes/stock/StockAvailable.php:453
1645
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4583 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4583 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.742 ms 0 /classes/Cart.php:1430
2916
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5106
ORDER BY `position`
0.742 ms 1 Yes /classes/Product.php:3545
1767
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 5077
ORDER BY f.position ASC
0.741 ms 5 Yes /classes/Product.php:6021
1795
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 5103)
0.741 ms 1 /classes/Product.php:3860
3706
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3992) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.741 ms 1 Yes Yes /classes/Product.php:4524
127
SELECT SQL_NO_CACHE tr.*
FROM `hgt78_tax_rule` tr
JOIN `hgt78_tax_rules_group` trg ON (tr.`id_tax_rules_group` = trg.`id_tax_rules_group`)
WHERE trg.`active` = 1
AND tr.`id_country` = 8
AND tr.`id_tax_rules_group` = 28
AND tr.`id_state` IN (0, 0)
AND ('04510' BETWEEN tr.`zipcode_from` AND tr.`zipcode_to`
OR (tr.`zipcode_to` = 0 AND tr.`zipcode_from` IN(0, '04510')))
ORDER BY tr.`zipcode_from` DESC, tr.`zipcode_to` DESC, tr.`id_state` DESC, tr.`id_country` DESC
0.740 ms 1 /classes/tax/TaxRulesTaxManager.php:109
703
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3947) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.740 ms 1 /classes/stock/StockAvailable.php:453
1121
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3996)
0.739 ms 1 /classes/Product.php:3860
2372
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 9749) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.739 ms 1 /classes/stock/StockAvailable.php:453
2808
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3011
ORDER BY `position`
0.738 ms 1 Yes /classes/Product.php:3545
810
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4299)
0.738 ms 1 /classes/Product.php:3860
2153
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 6024 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 6024 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.738 ms 0 /classes/Cart.php:1430
1066
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 6100)
0.737 ms 1 /classes/Product.php:3860
2494
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 9789 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 9789 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.737 ms 0 /classes/Cart.php:1430
215
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2502
ORDER BY f.position ASC
0.737 ms 5 Yes /classes/Product.php:6021
1099
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3995)
0.737 ms 1 /classes/Product.php:3860
1860
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 5336 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.737 ms 10 Yes /classes/SpecificPrice.php:576
2692
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 9851 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 9851 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.737 ms 0 /classes/Cart.php:1430
1944
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3979
ORDER BY f.position ASC
0.735 ms 5 Yes /classes/Product.php:6021
3065
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4032
ORDER BY `position`
0.735 ms 1 Yes /classes/Product.php:3545
1898
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 5639 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 5639 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.734 ms 0 /classes/Cart.php:1430
2937
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3987
ORDER BY `position`
0.734 ms 1 Yes /classes/Product.php:3545
3045
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4017
ORDER BY `position`
0.733 ms 2 Yes /classes/Product.php:3545
1699
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4702) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.733 ms 1 /classes/stock/StockAvailable.php:453
328
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2834
ORDER BY f.position ASC
0.732 ms 5 Yes /classes/Product.php:6021
2281
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 9721)
0.732 ms 1 /classes/Product.php:3860
2831
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3258) AND (b.`id_shop` = 1) LIMIT 1
0.732 ms 1 /src/Adapter/EntityMapper.php:71
3135
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4700
0.732 ms 1 /classes/Product.php:2902
2922
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5373
ORDER BY `position`
0.731 ms 1 Yes /classes/Product.php:3545
1358
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4018
ORDER BY f.position ASC
0.731 ms 5 Yes /classes/Product.php:6021
2357
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 9747 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.730 ms 11 Yes /classes/SpecificPrice.php:576
2450
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 9772 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 9772 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.730 ms 0 /classes/Cart.php:1430
19
SELECT SQL_NO_CACHE m.page, ml.url_rewrite, ml.id_lang
FROM `hgt78_meta` m
LEFT JOIN `hgt78_meta_lang` ml ON (m.id_meta = ml.id_meta AND ml.id_shop = 1 )
ORDER BY LENGTH(ml.url_rewrite) DESC
0.729 ms 129 Yes /classes/Dispatcher.php:654
1748
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 5076 LIMIT 1
0.729 ms 10 /classes/SpecificPrice.php:435
3102
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4492
0.727 ms 1 /classes/Product.php:2902
600
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3500)
0.727 ms 1 /classes/Product.php:3860
1978
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3983
AND image_shop.`cover` = 1 LIMIT 1
0.727 ms 1 /classes/Product.php:3570
2729
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2415) AND (b.`id_shop` = 1) LIMIT 1
0.727 ms 1 /src/Adapter/EntityMapper.php:71
2735
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2447) AND (b.`id_shop` = 1) LIMIT 1
0.727 ms 1 /src/Adapter/EntityMapper.php:71
392
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2899 AND `id_group` = 1 LIMIT 1
0.726 ms 0 /classes/GroupReduction.php:156
3194
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5639
ORDER BY `position`
0.725 ms 1 Yes /classes/Product.php:3545
506
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3234
ORDER BY f.position ASC
0.724 ms 5 Yes /classes/Product.php:6021
3805
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (6018) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.724 ms 1 Yes Yes /classes/Product.php:4524
711
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3949)
0.724 ms 1 /classes/Product.php:3860
3651
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2945) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.723 ms 1 Yes Yes /classes/Product.php:4524
1015
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 6053 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 6053 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.723 ms 0 /classes/Cart.php:1430
2366
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 9749 LIMIT 1
0.723 ms 11 /classes/SpecificPrice.php:435
1634
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4582 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4582 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.722 ms 0 /classes/Cart.php:1430
249
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2514
AND image_shop.`cover` = 1 LIMIT 1
0.721 ms 1 /classes/Product.php:3570
853
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 5075 LIMIT 1
0.721 ms 10 /classes/SpecificPrice.php:435
1245
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 8637 AND `id_group` = 1 LIMIT 1
0.721 ms 0 /classes/GroupReduction.php:156
1380
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4021 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4021 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.721 ms 0 /classes/Cart.php:1430
2928
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5415
ORDER BY `position`
0.721 ms 2 Yes /classes/Product.php:3545
3636
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2514) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.721 ms 1 Yes Yes /classes/Product.php:4524
398
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 45 LIMIT 1
0.720 ms 1 /classes/Product.php:5659
305
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2601 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2601 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.719 ms 0 /classes/Cart.php:1430
3824
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (9745) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.719 ms 1 Yes Yes /classes/Product.php:4524
3838
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (9789) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.719 ms 1 Yes Yes /classes/Product.php:4524
0
SELECT SQL_NO_CACHE s.id_shop, CONCAT(su.physical_uri, su.virtual_uri) AS uri, su.domain, su.main
FROM hgt78_shop_url su
LEFT JOIN hgt78_shop s ON (s.id_shop = su.id_shop)
WHERE (su.domain = 'www.encens.fr' OR su.domain_ssl = 'www.encens.fr')
AND s.active = 1
AND s.deleted = 0
ORDER BY LENGTH(CONCAT(su.physical_uri, su.virtual_uri)) DESC
0.718 ms 1 Yes /classes/shop/Shop.php:1364
2365
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 54 LIMIT 1
0.718 ms 1 /classes/Product.php:5659
2516
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 9791 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 9791 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.718 ms 0 /classes/Cart.php:1430
2883
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3951
ORDER BY `position`
0.718 ms 1 Yes /classes/Product.php:3545
3848
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (9843) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.718 ms 1 Yes Yes /classes/Product.php:4524
3310
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 9744) AND (b.`id_shop` = 1) LIMIT 1
0.718 ms 1 /src/Adapter/EntityMapper.php:71
2011
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2930
ORDER BY f.position ASC
0.717 ms 5 Yes /classes/Product.php:6021
1810
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 5104 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 5104 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.716 ms 0 /classes/Cart.php:1430
1966
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3981
ORDER BY f.position ASC
0.716 ms 5 Yes /classes/Product.php:6021
2311
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 9743 LIMIT 1
0.715 ms 11 /classes/SpecificPrice.php:435
2919
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5113
ORDER BY `position`
0.715 ms 1 Yes /classes/Product.php:3545
633
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3791)
0.714 ms 1 /classes/Product.php:3860
3412
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 9851) AND (b.`id_shop` = 1) LIMIT 1
0.714 ms 1 /src/Adapter/EntityMapper.php:71
3707
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (6099) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.714 ms 1 Yes Yes /classes/Product.php:4524
145
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3797) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.712 ms 1 /classes/stock/StockAvailable.php:453
1028
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3992
AND image_shop.`cover` = 1 LIMIT 1
0.712 ms 1 /classes/Product.php:3570
1116
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3996
AND image_shop.`cover` = 1 LIMIT 1
0.712 ms 1 /classes/Product.php:3570
2390
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 9752 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.712 ms 11 Yes /classes/SpecificPrice.php:576
216
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2448
AND image_shop.`cover` = 1 LIMIT 1
0.712 ms 1 /classes/Product.php:3570
3048
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4018
ORDER BY `position`
0.712 ms 1 Yes /classes/Product.php:3545
1988
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3983
ORDER BY f.position ASC
0.711 ms 5 Yes /classes/Product.php:6021
2044
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 5083
ORDER BY f.position ASC
0.711 ms 5 Yes /classes/Product.php:6021
2297
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 9723
ORDER BY f.position ASC
0.711 ms 5 Yes /classes/Product.php:6021
3113
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4540
ORDER BY `position`
0.711 ms 1 Yes /classes/Product.php:3545
3250
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 5641) AND (b.`id_shop` = 1) LIMIT 1
0.711 ms 1 /src/Adapter/EntityMapper.php:71
2263
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 8970 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 8970 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.709 ms 0 /classes/Cart.php:1430
2871
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3947
ORDER BY `position`
0.708 ms 1 Yes /classes/Product.php:3545
1721
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4704) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.708 ms 1 /classes/stock/StockAvailable.php:453
1273
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4004 LIMIT 1
0.707 ms 10 /classes/SpecificPrice.php:435
221
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2448)
0.707 ms 1 /classes/Product.php:3860
1623
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4580 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4580 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.707 ms 0 /classes/Cart.php:1430
3130
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4699) AND (b.`id_shop` = 1) LIMIT 1
0.707 ms 1 /src/Adapter/EntityMapper.php:71
3585
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 33) AND (b.`id_shop` = 1) LIMIT 1
0.707 ms 1 /src/Adapter/EntityMapper.php:71
2267
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 9264 LIMIT 1
0.706 ms 10 /classes/SpecificPrice.php:435
2287
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 9723
AND image_shop.`cover` = 1 LIMIT 1
0.706 ms 1 /classes/Product.php:3570
2940
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5509
ORDER BY `position`
0.706 ms 1 Yes /classes/Product.php:3545
3687
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4856) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.706 ms 1 Yes Yes /classes/Product.php:4524
2763
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2601
ORDER BY `position`
0.705 ms 1 Yes /classes/Product.php:3545
2877
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3950
ORDER BY `position`
0.705 ms 1 Yes /classes/Product.php:3545
3520
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 44) LIMIT 1
0.705 ms 1 /src/Adapter/EntityMapper.php:71
2837
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3499) AND (b.`id_shop` = 1) LIMIT 1
0.704 ms 1 /src/Adapter/EntityMapper.php:71
3340
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 9769) AND (b.`id_shop` = 1) LIMIT 1
0.704 ms 1 /src/Adapter/EntityMapper.php:71
1016
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 6053
ORDER BY f.position ASC
0.703 ms 5 Yes /classes/Product.php:6021
3337
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 9768) AND (b.`id_shop` = 1) LIMIT 1
0.703 ms 1 /src/Adapter/EntityMapper.php:71
3622
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 84 AND `id_shop` = 1
0.703 ms 6 /src/Adapter/EntityMapper.php:79
3287
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 8948
ORDER BY `position`
0.702 ms 1 Yes /classes/Product.php:3545
3834
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (9772) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.702 ms 1 Yes Yes /classes/Product.php:4524
3857
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (9852) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.701 ms 1 Yes Yes /classes/Product.php:4524
2241
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 8948 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 8948 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.701 ms 0 /classes/Cart.php:1430
2594
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 9842
ORDER BY f.position ASC
0.701 ms 5 Yes /classes/Product.php:6021
2868
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3946
ORDER BY `position`
0.701 ms 1 Yes /classes/Product.php:3545
673
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3945
AND image_shop.`cover` = 1 LIMIT 1
0.700 ms 1 /classes/Product.php:3570
993
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3989 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3989 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.700 ms 0 /classes/Cart.php:1430
1044
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 6099)
0.700 ms 1 /classes/Product.php:3860
1757
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 5077
AND image_shop.`cover` = 1 LIMIT 1
0.700 ms 1 /classes/Product.php:3570
2720
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3797) AND (b.`id_shop` = 1) LIMIT 1
0.700 ms 1 /src/Adapter/EntityMapper.php:71
3458
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 55) LIMIT 1
0.700 ms 1 /src/Adapter/EntityMapper.php:71
1323
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 10932) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.699 ms 1 /classes/stock/StockAvailable.php:453
2715
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 10738 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 10738 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.699 ms 0 /classes/Cart.php:1430
3005
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 8356) AND (b.`id_shop` = 1) LIMIT 1
0.699 ms 1 /src/Adapter/EntityMapper.php:71
3704
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (6053) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.699 ms 1 Yes Yes /classes/Product.php:4524
960
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 5509
ORDER BY f.position ASC
0.699 ms 5 Yes /classes/Product.php:6021
1612
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4541 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4541 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.698 ms 0 /classes/Cart.php:1430
3325
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 9749) AND (b.`id_shop` = 1) LIMIT 1
0.698 ms 1 /src/Adapter/EntityMapper.php:71
3023
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 9521) AND (b.`id_shop` = 1) LIMIT 1
0.697 ms 1 /src/Adapter/EntityMapper.php:71
2627
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 9845
ORDER BY f.position ASC
0.696 ms 5 Yes /classes/Product.php:6021
3464
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 169) LIMIT 1
0.696 ms 1 /src/Adapter/EntityMapper.php:71
2969
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 6100) AND (b.`id_shop` = 1) LIMIT 1
0.695 ms 1 /src/Adapter/EntityMapper.php:71
3244
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 5352) AND (b.`id_shop` = 1) LIMIT 1
0.695 ms 1 /src/Adapter/EntityMapper.php:71
3653
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3010) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.695 ms 1 Yes Yes /classes/Product.php:4524
385
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2899
AND image_shop.`cover` = 1 LIMIT 1
0.694 ms 1 /classes/Product.php:3570
2907
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4947
ORDER BY `position`
0.694 ms 1 Yes /classes/Product.php:3545
1381
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4021
ORDER BY f.position ASC
0.694 ms 5 Yes /classes/Product.php:6021
761
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3952
AND image_shop.`cover` = 1 LIMIT 1
0.693 ms 1 /classes/Product.php:3570
2730
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2415
ORDER BY `position`
0.693 ms 1 Yes /classes/Product.php:3545
2176
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 6105
ORDER BY f.position ASC
0.693 ms 5 Yes /classes/Product.php:6021
2821
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3235
0.693 ms 1 /classes/Product.php:2902
270
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2808) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.692 ms 1 /classes/stock/StockAvailable.php:453
1704
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4703 LIMIT 1
0.692 ms 10 /classes/SpecificPrice.php:435
1955
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3980
ORDER BY f.position ASC
0.692 ms 5 Yes /classes/Product.php:6021
3247
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 5640) AND (b.`id_shop` = 1) LIMIT 1
0.692 ms 1 /src/Adapter/EntityMapper.php:71
2717
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3799) AND (b.`id_shop` = 1) LIMIT 1
0.691 ms 1 /src/Adapter/EntityMapper.php:71
2083
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 5352)
0.691 ms 1 /classes/Product.php:3860
744
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3951)
0.690 ms 1 /classes/Product.php:3860
3051
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4019
ORDER BY `position`
0.690 ms 2 Yes /classes/Product.php:3545
3376
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 9820) AND (b.`id_shop` = 1) LIMIT 1
0.690 ms 1 /src/Adapter/EntityMapper.php:71
3814
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (8947) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.690 ms 1 Yes Yes /classes/Product.php:4524
1421
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4032)
0.689 ms 1 /classes/Product.php:3860
3296
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 9264
ORDER BY `position`
0.688 ms 1 Yes /classes/Product.php:3545
1259
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4003
ORDER BY f.position ASC
0.687 ms 5 Yes /classes/Product.php:6021
1492
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4238
ORDER BY f.position ASC
0.686 ms 5 Yes /classes/Product.php:6021
2853
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3791
ORDER BY `position`
0.686 ms 1 Yes /classes/Product.php:3545
3689
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (5074) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.686 ms 1 Yes Yes /classes/Product.php:4524
3349
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 9773) AND (b.`id_shop` = 1) LIMIT 1
0.685 ms 1 /src/Adapter/EntityMapper.php:71
138
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 44 LIMIT 1
0.685 ms 1 /classes/Product.php:5659
461
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3199 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3199 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.685 ms 0 /classes/Cart.php:1430
649
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3942
ORDER BY f.position ASC
0.685 ms 5 Yes /classes/Product.php:6021
1931
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3978) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.685 ms 1 /classes/stock/StockAvailable.php:453
3654
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3199) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.685 ms 1 Yes Yes /classes/Product.php:4524
3841
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (9792) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.685 ms 1 Yes Yes /classes/Product.php:4524
1170
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3999
ORDER BY f.position ASC
0.684 ms 5 Yes /classes/Product.php:6021
2913
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5075
ORDER BY `position`
0.684 ms 1 Yes /classes/Product.php:3545
3355
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 9788) AND (b.`id_shop` = 1) LIMIT 1
0.684 ms 1 /src/Adapter/EntityMapper.php:71
583
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3499
ORDER BY f.position ASC
0.683 ms 5 Yes /classes/Product.php:6021
982
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 5510 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 5510 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.683 ms 0 /classes/Cart.php:1430
1350
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4018 LIMIT 1
0.683 ms 10 /classes/SpecificPrice.php:435
2298
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 9742
AND image_shop.`cover` = 1 LIMIT 1
0.683 ms 1 /classes/Product.php:3570
3124
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4583) AND (b.`id_shop` = 1) LIMIT 1
0.683 ms 1 /src/Adapter/EntityMapper.php:71
1470
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4036
ORDER BY f.position ASC
0.682 ms 5 Yes /classes/Product.php:6021
1514
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4241
ORDER BY f.position ASC
0.682 ms 5 Yes /classes/Product.php:6021
2649
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 9847
ORDER BY f.position ASC
0.682 ms 5 Yes /classes/Product.php:6021
3612
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 217 AND `id_shop` = 1
0.682 ms 6 /src/Adapter/EntityMapper.php:79
605
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3500
ORDER BY f.position ASC
0.681 ms 5 Yes /classes/Product.php:6021
1854
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 5167 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 5167 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.681 ms 0 /classes/Cart.php:1430
3302
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 9723
ORDER BY `position`
0.681 ms 1 Yes /classes/Product.php:3545
443
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3010 LIMIT 1
0.680 ms 10 /classes/SpecificPrice.php:435
2707
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 10738) AND (b.`id_shop` = 1) LIMIT 1
0.680 ms 1 /src/Adapter/EntityMapper.php:71
3215
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3982
ORDER BY `position`
0.680 ms 1 Yes /classes/Product.php:3545
3388
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 9843) AND (b.`id_shop` = 1) LIMIT 1
0.680 ms 1 /src/Adapter/EntityMapper.php:71
428
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2945 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2945 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.679 ms 0 /classes/Cart.php:1430
1176
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3018)
0.679 ms 1 /classes/Product.php:3860
1833
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 5165
ORDER BY f.position ASC
0.679 ms 5 Yes /classes/Product.php:6021
3343
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 9771) AND (b.`id_shop` = 1) LIMIT 1
0.679 ms 1 /src/Adapter/EntityMapper.php:71
2072
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 5328)
0.678 ms 1 /classes/Product.php:3860
2495
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 9789
ORDER BY f.position ASC
0.678 ms 5 Yes /classes/Product.php:6021
1989
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3984
AND image_shop.`cover` = 1 LIMIT 1
0.678 ms 1 /classes/Product.php:3570
1334
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4016) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.677 ms 1 /classes/stock/StockAvailable.php:453
1929
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3978 AND id_shop=1 LIMIT 1
0.677 ms 1 /classes/Product.php:6876
2275
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 9264
ORDER BY f.position ASC
0.677 ms 5 Yes /classes/Product.php:6021
3328
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 9751) AND (b.`id_shop` = 1) LIMIT 1
0.677 ms 1 /src/Adapter/EntityMapper.php:71
3416
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 9852
ORDER BY `position`
0.676 ms 1 Yes /classes/Product.php:3545
304
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2601) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.676 ms 1 /classes/stock/StockAvailable.php:453
3801
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (5352) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.676 ms 1 Yes Yes /classes/Product.php:4524
2252
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 8969 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 8969 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.675 ms 0 /classes/Cart.php:1430
2757
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2600
ORDER BY `position`
0.675 ms 1 Yes /classes/Product.php:3545
3611
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 217) LIMIT 1
0.675 ms 1 /src/Adapter/EntityMapper.php:71
706
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3949
AND image_shop.`cover` = 1 LIMIT 1
0.674 ms 1 /classes/Product.php:3570
501
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3234)
0.673 ms 1 /classes/Product.php:3860
2560
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 9820 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 9820 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.673 ms 0 /classes/Cart.php:1430
275
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2600 LIMIT 1
0.672 ms 10 /classes/SpecificPrice.php:435
1171
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3018
AND image_shop.`cover` = 1 LIMIT 1
0.672 ms 1 /classes/Product.php:3570
2805
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3199
ORDER BY `position`
0.672 ms 1 Yes /classes/Product.php:3545
3026
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4004) AND (b.`id_shop` = 1) LIMIT 1
0.672 ms 1 /src/Adapter/EntityMapper.php:71
3116
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4541
ORDER BY `position`
0.672 ms 1 Yes /classes/Product.php:3545
3688
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4947) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.672 ms 1 Yes Yes /classes/Product.php:4524
2943
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3988
ORDER BY `position`
0.672 ms 1 Yes /classes/Product.php:3545
2961
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3992
ORDER BY `position`
0.672 ms 1 Yes /classes/Product.php:3545
3597
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 191) LIMIT 1
0.671 ms 1 /src/Adapter/EntityMapper.php:71
3164
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5102
ORDER BY `position`
0.671 ms 1 Yes /classes/Product.php:3545
2006
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2930)
0.670 ms 1 /classes/Product.php:3860
1061
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 6100
AND image_shop.`cover` = 1 LIMIT 1
0.670 ms 1 /classes/Product.php:3570
2615
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 9844 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 9844 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.670 ms 0 /classes/Cart.php:1430
2744
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2513) AND (b.`id_shop` = 1) LIMIT 1
0.670 ms 1 /src/Adapter/EntityMapper.php:71
2439
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 9771 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 9771 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.669 ms 0 /classes/Cart.php:1430
3218
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3983
ORDER BY `position`
0.668 ms 1 Yes /classes/Product.php:3545
2802
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3010
ORDER BY `position`
0.666 ms 1 Yes /classes/Product.php:3545
295
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2601
AND image_shop.`cover` = 1 LIMIT 1
0.666 ms 1 /classes/Product.php:3570
3032
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4005) AND (b.`id_shop` = 1) LIMIT 1
0.666 ms 1 /src/Adapter/EntityMapper.php:71
3269
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 6105
ORDER BY `position`
0.666 ms 1 Yes /classes/Product.php:3545
2055
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 5085
ORDER BY f.position ASC
0.665 ms 5 Yes /classes/Product.php:6021
2832
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3258
ORDER BY `position`
0.665 ms 1 Yes /classes/Product.php:3545
2352
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 9746
ORDER BY f.position ASC
0.664 ms 5 Yes /classes/Product.php:6021
3521
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 44 AND `id_shop` = 1
0.664 ms 6 /src/Adapter/EntityMapper.php:79
660
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3943
ORDER BY f.position ASC
0.663 ms 5 Yes /classes/Product.php:6021
994
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3989
ORDER BY f.position ASC
0.663 ms 5 Yes /classes/Product.php:6021
439
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3198 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3198 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.662 ms 0 /classes/Cart.php:1430
659
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3943 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3943 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.662 ms 0 /classes/Cart.php:1430
1754
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 5076) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.662 ms 1 /classes/stock/StockAvailable.php:453
1994
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3984)
0.662 ms 1 /classes/Product.php:3860
2389
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 9752
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.662 ms 0 /classes/SpecificPrice.php:259
3263
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 6024
ORDER BY `position`
0.662 ms 1 Yes /classes/Product.php:3545
3400
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 9847) AND (b.`id_shop` = 1) LIMIT 1
0.661 ms 1 /src/Adapter/EntityMapper.php:71
3658
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3234) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.661 ms 1 Yes Yes /classes/Product.php:4524
2573
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 9830
AND image_shop.`cover` = 1 LIMIT 1
0.661 ms 1 /classes/Product.php:3570
1801
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 5104
AND image_shop.`cover` = 1 LIMIT 1
0.660 ms 1 /classes/Product.php:3570
3819
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (9721) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.660 ms 1 Yes Yes /classes/Product.php:4524
3649
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3196) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.660 ms 1 Yes Yes /classes/Product.php:4524
326
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2834) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.659 ms 1 /classes/stock/StockAvailable.php:453
1303
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4005
ORDER BY f.position ASC
0.659 ms 5 Yes /classes/Product.php:6021
2958
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 6054
ORDER BY `position`
0.658 ms 1 Yes /classes/Product.php:3545
3456
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 40) LIMIT 1
0.658 ms 1 /src/Adapter/EntityMapper.php:71
3844
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (9820) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.658 ms 1 Yes Yes /classes/Product.php:4524
2918
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 5113) AND (b.`id_shop` = 1) LIMIT 1
0.657 ms 1 /src/Adapter/EntityMapper.php:71
3119
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4580
ORDER BY `position`
0.657 ms 2 Yes /classes/Product.php:3545
3338
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 9768
ORDER BY `position`
0.657 ms 1 Yes /classes/Product.php:3545
3650
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3197) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.657 ms 1 Yes Yes /classes/Product.php:4524
3828
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (9751) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.657 ms 1 Yes Yes /classes/Product.php:4524
3589
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 61) LIMIT 1
0.657 ms 1 /src/Adapter/EntityMapper.php:71
3852
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (9847) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.657 ms 1 Yes Yes /classes/Product.php:4524
1779
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 5102
AND image_shop.`cover` = 1 LIMIT 1
0.656 ms 1 /classes/Product.php:3570
2742
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2448
ORDER BY `position`
0.656 ms 1 Yes /classes/Product.php:3545
1635
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4582
ORDER BY f.position ASC
0.656 ms 5 Yes /classes/Product.php:6021
2538
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 9794 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 9794 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.655 ms 0 /classes/Cart.php:1430
1688
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4701) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.654 ms 1 /classes/stock/StockAvailable.php:453
3564
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 35) AND (b.`id_shop` = 1) LIMIT 1
0.654 ms 1 /src/Adapter/EntityMapper.php:71
3821
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (9742) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.654 ms 1 Yes Yes /classes/Product.php:4524
1387
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4022 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.653 ms 10 Yes /classes/SpecificPrice.php:576
834
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4947)
0.652 ms 1 /classes/Product.php:3860
352
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2836
AND image_shop.`cover` = 1 LIMIT 1
0.651 ms 1 /classes/Product.php:3570
2391
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 9752)
0.651 ms 1 /classes/Product.php:3860
523
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3242)
0.651 ms 1 /classes/Product.php:3860
2277
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 200 LIMIT 1
0.651 ms 1 /classes/Product.php:5659
3487
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 334 AND `id_shop` = 1
0.648 ms 6 /src/Adapter/EntityMapper.php:79
3583
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 197) LIMIT 1
0.648 ms 1 /src/Adapter/EntityMapper.php:71
2248
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 8969)
0.647 ms 1 /classes/Product.php:3860
3822
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (9743) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.647 ms 1 Yes Yes /classes/Product.php:4524
358
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2836 AND id_shop=1 LIMIT 1
0.646 ms 1 /classes/Product.php:6876
471
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3011) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.646 ms 1 /classes/stock/StockAvailable.php:453
2022
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4027
ORDER BY f.position ASC
0.646 ms 5 Yes /classes/Product.php:6021
3241
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 5328) AND (b.`id_shop` = 1) LIMIT 1
0.646 ms 1 /src/Adapter/EntityMapper.php:71
2386
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 9752
AND image_shop.`cover` = 1 LIMIT 1
0.645 ms 1 /classes/Product.php:3570
3284
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 8947
ORDER BY `position`
0.645 ms 1 Yes /classes/Product.php:3545
3657
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3028) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.645 ms 1 Yes Yes /classes/Product.php:4524
2412
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 9768 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.644 ms 11 Yes /classes/SpecificPrice.php:576
1403
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4029 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4029 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.644 ms 0 /classes/Cart.php:1430
2917
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 5106
0.644 ms 1 /classes/Product.php:2902
3659
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3235) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.644 ms 1 Yes Yes /classes/Product.php:4524
3382
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 9830) AND (b.`id_shop` = 1) LIMIT 1
0.643 ms 1 /src/Adapter/EntityMapper.php:71
323
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2834)
0.642 ms 1 /classes/Product.php:3860
3331
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 9752) AND (b.`id_shop` = 1) LIMIT 1
0.642 ms 1 /src/Adapter/EntityMapper.php:71
3395
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 9845
ORDER BY `position`
0.642 ms 1 Yes /classes/Product.php:3545
2790
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3196
ORDER BY `position`
0.641 ms 1 Yes /classes/Product.php:3545
3617
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 39) LIMIT 1
0.641 ms 1 /src/Adapter/EntityMapper.php:71
2066
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 5101
ORDER BY f.position ASC
0.639 ms 5 Yes /classes/Product.php:6021
384
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2898
ORDER BY f.position ASC
0.639 ms 5 Yes /classes/Product.php:6021
496
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3234
AND image_shop.`cover` = 1 LIMIT 1
0.639 ms 1 /classes/Product.php:3570
1281
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4004
ORDER BY f.position ASC
0.639 ms 5 Yes /classes/Product.php:6021
1678
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4700 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4700 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.639 ms 0 /classes/Cart.php:1430
1447
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4034 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4034 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.638 ms 0 /classes/Cart.php:1430
1601
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4540 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4540 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.638 ms 0 /classes/Cart.php:1430
2638
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 9846
ORDER BY f.position ASC
0.638 ms 5 Yes /classes/Product.php:6021
3655
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3011) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.638 ms 1 Yes Yes /classes/Product.php:4524
3667
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3500) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.638 ms 1 Yes Yes /classes/Product.php:4524
313
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2890 AND id_shop=1 LIMIT 1
0.636 ms 1 /classes/Product.php:6876
2017
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4027)
0.636 ms 1 /classes/Product.php:3860
2367
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 9749
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.636 ms 0 /classes/SpecificPrice.php:259
1613
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4541
ORDER BY f.position ASC
0.635 ms 5 Yes /classes/Product.php:6021
112
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3799
AND image_shop.`cover` = 1 LIMIT 1
0.634 ms 1 /classes/Product.php:3570
1124
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3996) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.633 ms 1 /classes/stock/StockAvailable.php:453
498
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3234 LIMIT 1
0.632 ms 10 /classes/SpecificPrice.php:435
785
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4297 LIMIT 1
0.632 ms 10 /classes/SpecificPrice.php:435
3810
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (6134) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.632 ms 1 Yes Yes /classes/Product.php:4524
1235
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4002) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.632 ms 1 /classes/stock/StockAvailable.php:453
1546
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4491 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4491 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.631 ms 0 /classes/Cart.php:1430
482
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3200) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.630 ms 1 /classes/stock/StockAvailable.php:453
2856
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3942
ORDER BY `position`
0.630 ms 1 Yes /classes/Product.php:3545
3293
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 8970
ORDER BY `position`
0.630 ms 4 Yes /classes/Product.php:3545
3598
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 191 AND `id_shop` = 1
0.630 ms 6 /src/Adapter/EntityMapper.php:79
1437
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4033
ORDER BY f.position ASC
0.630 ms 5 Yes /classes/Product.php:6021
839
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4947
ORDER BY f.position ASC
0.629 ms 5 Yes /classes/Product.php:6021
1503
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4239
ORDER BY f.position ASC
0.629 ms 5 Yes /classes/Product.php:6021
3365
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 9791
ORDER BY `position`
0.629 ms 1 Yes /classes/Product.php:3545
3833
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (9771) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.629 ms 1 Yes Yes /classes/Product.php:4524
3853
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (9848) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.629 ms 1 Yes Yes /classes/Product.php:4524
3661
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3236) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.628 ms 1 Yes Yes /classes/Product.php:4524
373
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2944
ORDER BY f.position ASC
0.627 ms 5 Yes /classes/Product.php:6021
1798
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 5103) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.627 ms 1 /classes/stock/StockAvailable.php:453
3392
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 9844
ORDER BY `position`
0.627 ms 1 Yes /classes/Product.php:3545
1668
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4699
ORDER BY f.position ASC
0.626 ms 5 Yes /classes/Product.php:6021
3364
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 9791) AND (b.`id_shop` = 1) LIMIT 1
0.626 ms 1 /src/Adapter/EntityMapper.php:71
3792
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3983) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.626 ms 1 Yes Yes /classes/Product.php:4524
3816
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (8969) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.626 ms 1 Yes Yes /classes/Product.php:4524
805
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4299
AND image_shop.`cover` = 1 LIMIT 1
0.625 ms 1 /classes/Product.php:3570
1157
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3998) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.625 ms 1 /classes/stock/StockAvailable.php:453
967
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3988)
0.624 ms 1 /classes/Product.php:3860
1314
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 10236
ORDER BY f.position ASC
0.624 ms 5 Yes /classes/Product.php:6021
2253
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 8969
ORDER BY f.position ASC
0.624 ms 5 Yes /classes/Product.php:6021
3669
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3790) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.624 ms 1 Yes Yes /classes/Product.php:4524
3798
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (5085) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.624 ms 1 Yes Yes /classes/Product.php:4524
2187
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 6134
ORDER BY f.position ASC
0.623 ms 5 Yes /classes/Product.php:6021
2000
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2930
AND image_shop.`cover` = 1 LIMIT 1
0.622 ms 2 /classes/Product.php:3570
2078
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 5352
AND image_shop.`cover` = 1 LIMIT 1
0.622 ms 1 /classes/Product.php:3570
3842
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (9794) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.622 ms 1 Yes Yes /classes/Product.php:4524
329
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2835
AND image_shop.`cover` = 1 LIMIT 1
0.622 ms 1 /classes/Product.php:3570
2165
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 6025
ORDER BY f.position ASC
0.622 ms 5 Yes /classes/Product.php:6021
918
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 199 LIMIT 1
0.621 ms 1 /classes/Product.php:5659
1359
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4019
AND image_shop.`cover` = 1 LIMIT 1
0.621 ms 2 /classes/Product.php:3570
1839
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 5166)
0.621 ms 1 /classes/Product.php:3860
3281
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 8946
ORDER BY `position`
0.621 ms 1 Yes /classes/Product.php:3545
3468
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 38) LIMIT 1
0.621 ms 1 /src/Adapter/EntityMapper.php:71
3666
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3520) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.621 ms 1 Yes Yes /classes/Product.php:4524
3684
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4297) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.621 ms 1 Yes Yes /classes/Product.php:4524
2395
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 9752 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 9752 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.620 ms 0 /classes/Cart.php:1430
3660
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3242) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.620 ms 1 Yes Yes /classes/Product.php:4524
3845
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (9821) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.620 ms 1 Yes Yes /classes/Product.php:4524
3847
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (9842) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.620 ms 1 Yes Yes /classes/Product.php:4524
774
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3803 LIMIT 1
0.619 ms 10 /classes/SpecificPrice.php:435
3656
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3200) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.619 ms 1 Yes Yes /classes/Product.php:4524
3663
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3258) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.619 ms 1 Yes Yes /classes/Product.php:4524
628
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3791
AND image_shop.`cover` = 1 LIMIT 1
0.618 ms 1 /classes/Product.php:3570
784
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 44 LIMIT 1
0.618 ms 1 /classes/Product.php:5659
1481
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4236
ORDER BY f.position ASC
0.618 ms 5 Yes /classes/Product.php:6021
2105
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 5641)
0.618 ms 1 /classes/Product.php:3860
3524
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 56) LIMIT 1
0.617 ms 1 /src/Adapter/EntityMapper.php:71
1216
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 8357
AND image_shop.`cover` = 1 LIMIT 1
0.616 ms 2 /classes/Product.php:3570
3122
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4582
ORDER BY `position`
0.616 ms 3 Yes /classes/Product.php:3545
3683
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3803) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.616 ms 1 Yes Yes /classes/Product.php:4524
2376
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 200 LIMIT 1
0.615 ms 1 /classes/Product.php:5659
3236
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5085
ORDER BY `position`
0.615 ms 1 Yes /classes/Product.php:3545
3619
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 83) LIMIT 1
0.615 ms 1 /src/Adapter/EntityMapper.php:71
2910
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5074
ORDER BY `position`
0.614 ms 1 Yes /classes/Product.php:3545
2605
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 9843
ORDER BY f.position ASC
0.614 ms 5 Yes /classes/Product.php:6021
3183
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 5167
0.614 ms 1 /classes/Product.php:2902
17
SELECT SQL_NO_CACHE m.`id_module`, m.`name`, ms.`id_module`as `mshop`
FROM `hgt78_module` m
LEFT JOIN `hgt78_module_shop` ms
ON m.`id_module` = ms.`id_module`
AND ms.`id_shop` = 1
0.613 ms 118 /classes/module/Module.php:346
204
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2502
AND image_shop.`cover` = 1 LIMIT 1
0.613 ms 1 /classes/Product.php:3570
3159
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 5077
0.613 ms 1 /classes/Product.php:2902
3256
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 6018) AND (b.`id_shop` = 1) LIMIT 1
0.613 ms 1 /src/Adapter/EntityMapper.php:71
449
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3010) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.612 ms 1 /classes/stock/StockAvailable.php:453
630
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3791 LIMIT 1
0.612 ms 10 /classes/SpecificPrice.php:435
779
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3803 AND `id_group` = 1 LIMIT 1
0.612 ms 0 /classes/GroupReduction.php:156
3813
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (8946) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.612 ms 1 Yes Yes /classes/Product.php:4524
1349
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 45 LIMIT 1
0.612 ms 1 /classes/Product.php:5659
1250
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 78 LIMIT 1
0.611 ms 1 /classes/Product.php:5659
2278
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 9721 LIMIT 1
0.611 ms 11 /classes/SpecificPrice.php:435
3522
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 51) LIMIT 1
0.611 ms 1 /src/Adapter/EntityMapper.php:71
2904
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4856
ORDER BY `position`
0.611 ms 1 Yes /classes/Product.php:3545
1691
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4702
AND image_shop.`cover` = 1 LIMIT 1
0.610 ms 1 /classes/Product.php:3570
492
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3028 AND `id_group` = 1 LIMIT 1
0.610 ms 0 /classes/GroupReduction.php:156
927
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3986
ORDER BY f.position ASC
0.609 ms 5 Yes /classes/Product.php:6021
3186
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 5336
0.609 ms 1 /classes/Product.php:2902
156
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3796) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.609 ms 1 /classes/stock/StockAvailable.php:453
422
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2945
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.609 ms 0 /classes/SpecificPrice.php:259
2230
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 8947 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 8947 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.609 ms 0 /classes/Cart.php:1430
3029
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 10235) AND (b.`id_shop` = 1) LIMIT 1
0.609 ms 1 /src/Adapter/EntityMapper.php:71
3539
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 73 AND `id_shop` = 1
0.609 ms 6 /src/Adapter/EntityMapper.php:79
3674
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3945) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.609 ms 1 Yes Yes /classes/Product.php:4524
3802
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (5640) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.609 ms 1 Yes Yes /classes/Product.php:4524
3850
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (9845) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.609 ms 1 Yes Yes /classes/Product.php:4524
622
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3790)
0.608 ms 1 /classes/Product.php:3860
2835
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3497
ORDER BY `position`
0.608 ms 1 Yes /classes/Product.php:3545
3809
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (6105) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.608 ms 1 Yes Yes /classes/Product.php:4524
3826
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (9747) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.608 ms 1 Yes Yes /classes/Product.php:4524
639
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3942
AND image_shop.`cover` = 1 LIMIT 1
0.607 ms 1 /classes/Product.php:3570
2572
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 9821
ORDER BY f.position ASC
0.607 ms 5 Yes /classes/Product.php:6021
3407
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 9849
ORDER BY `position`
0.607 ms 1 Yes /classes/Product.php:3545
1173
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3018 LIMIT 1
0.607 ms 11 /classes/SpecificPrice.php:435
2971
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 6100
0.607 ms 1 /classes/Product.php:2902
124
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3799 AND id_shop=1 LIMIT 1
0.606 ms 1 /classes/Product.php:6876
1591
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4508
ORDER BY f.position ASC
0.606 ms 5 Yes /classes/Product.php:6021
3173
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5164
ORDER BY `position`
0.606 ms 1 Yes /classes/Product.php:3545
3621
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 84) LIMIT 1
0.606 ms 1 /src/Adapter/EntityMapper.php:71
3678
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3950) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.606 ms 1 Yes Yes /classes/Product.php:4524
1774
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 5080 AND id_shop=1 LIMIT 1
0.605 ms 1 /classes/Product.php:6876
3170
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5104
ORDER BY `position`
0.605 ms 1 Yes /classes/Product.php:3545
3829
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (9752) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.605 ms 1 Yes Yes /classes/Product.php:4524
3153
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4989
0.604 ms 1 /classes/Product.php:2902
3664
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3497) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.604 ms 1 Yes Yes /classes/Product.php:4524
3835
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (9773) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.603 ms 1 Yes Yes /classes/Product.php:4524
1453
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4035 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.603 ms 10 Yes /classes/SpecificPrice.php:576
2317
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 9743) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.603 ms 1 /classes/stock/StockAvailable.php:453
2320
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 9744
AND image_shop.`cover` = 1 LIMIT 1
0.603 ms 1 /classes/Product.php:3570
2589
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 9842)
0.603 ms 1 /classes/Product.php:3860
3138
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4701
0.603 ms 1 /classes/Product.php:2902
3305
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 9742
ORDER BY `position`
0.603 ms 1 Yes /classes/Product.php:3545
2847
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3788
ORDER BY `position`
0.602 ms 1 Yes /classes/Product.php:3545
3681
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3802) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.602 ms 1 Yes Yes /classes/Product.php:4524
1657
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4698
ORDER BY f.position ASC
0.601 ms 5 Yes /classes/Product.php:6021
2198
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 6135
ORDER BY f.position ASC
0.601 ms 5 Yes /classes/Product.php:6021
3673
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3944) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.601 ms 1 Yes Yes /classes/Product.php:4524
3799
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (5101) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.601 ms 1 Yes Yes /classes/Product.php:4524
3811
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (6135) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.601 ms 1 Yes Yes /classes/Product.php:4524
3127
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4698) AND (b.`id_shop` = 1) LIMIT 1
0.601 ms 1 /src/Adapter/EntityMapper.php:71
532
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3236
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.600 ms 0 /classes/SpecificPrice.php:259
3346
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 9772) AND (b.`id_shop` = 1) LIMIT 1
0.600 ms 1 /src/Adapter/EntityMapper.php:71
2733
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2475
ORDER BY `position`
0.600 ms 1 Yes /classes/Product.php:3545
2154
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 6024
ORDER BY f.position ASC
0.599 ms 5 Yes /classes/Product.php:6021
2672
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 9850
AND image_shop.`cover` = 1 LIMIT 1
0.599 ms 1 /classes/Product.php:3570
479
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3200)
0.598 ms 1 /classes/Product.php:3860
2208
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 8429 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 8429 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.598 ms 0 /classes/Cart.php:1430
3224
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2930
ORDER BY `position`
0.598 ms 2 Yes /classes/Product.php:3545
3620
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 83 AND `id_shop` = 1
0.598 ms 6 /src/Adapter/EntityMapper.php:79
3665
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3499) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.598 ms 1 Yes Yes /classes/Product.php:4524
2266
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 199 LIMIT 1
0.596 ms 1 /classes/Product.php:5659
3221
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3984
ORDER BY `position`
0.596 ms 1 Yes /classes/Product.php:3545
3679
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3801) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.595 ms 1 Yes Yes /classes/Product.php:4524
3807
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (6024) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.595 ms 1 Yes Yes /classes/Product.php:4524
2745
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2513
ORDER BY `position`
0.594 ms 1 Yes /classes/Product.php:3545
3156
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 5076
0.594 ms 1 /classes/Product.php:2902
3379
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 9821) AND (b.`id_shop` = 1) LIMIT 1
0.594 ms 1 /src/Adapter/EntityMapper.php:71
3429
SELECT SQL_NO_CACHE 1 FROM `hgt78_cart_rule` WHERE ((date_to >= "2025-05-01 00:00:00" AND date_to <= "2025-05-01 23:59:59") OR (date_from >= "2025-05-01 00:00:00" AND date_from <= "2025-05-01 23:59:59") OR (date_from < "2025-05-01 00:00:00" AND date_to > "2025-05-01 23:59:59")) AND `id_customer` IN (0,0) LIMIT 1
0.594 ms 29 /classes/CartRule.php:357
949
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3987
ORDER BY f.position ASC
0.594 ms 5 Yes /classes/Product.php:6021
1725
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 46 LIMIT 1
0.594 ms 1 /classes/Product.php:5659
3858
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (10738) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.593 ms 1 Yes Yes /classes/Product.php:4524
3545
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 162 AND `id_shop` = 1
0.593 ms 6 /src/Adapter/EntityMapper.php:79
3670
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3791) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.592 ms 1 Yes Yes /classes/Product.php:4524
180
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2415
ORDER BY f.position ASC
0.592 ms 5 Yes /classes/Product.php:6021
1123
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3996 AND `id_group` = 1 LIMIT 1
0.592 ms 0 /classes/GroupReduction.php:156
2932
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3986
0.592 ms 1 /classes/Product.php:2902
3686
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4299) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.592 ms 1 Yes Yes /classes/Product.php:4524
3839
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (9790) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.591 ms 1 Yes Yes /classes/Product.php:4524
3593
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 79) LIMIT 1
0.591 ms 1 /src/Adapter/EntityMapper.php:71
3800
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (5328) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.591 ms 1 Yes Yes /classes/Product.php:4524
337
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2835) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.590 ms 1 /classes/stock/StockAvailable.php:453
2992
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3997
0.590 ms 1 /classes/Product.php:2902
3540
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 74) LIMIT 1
0.589 ms 1 /src/Adapter/EntityMapper.php:71
1271
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4004
AND image_shop.`cover` = 1 LIMIT 1
0.588 ms 1 /classes/Product.php:3570
3685
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4298) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.588 ms 1 Yes Yes /classes/Product.php:4524
3818
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (9264) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.588 ms 1 Yes Yes /classes/Product.php:4524
931
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 5418
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.587 ms 0 /classes/SpecificPrice.php:259
1771
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 5080
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.587 ms 0 /classes/SpecificPrice.php:259
1882
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 5638 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.587 ms 10 Yes /classes/SpecificPrice.php:576
1928
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3978)
0.587 ms 1 /classes/Product.php:3860
3081
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4236
0.587 ms 1 /classes/Product.php:2902
1113
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 6102) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.586 ms 1 /classes/stock/StockAvailable.php:453
1398
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4029 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.586 ms 10 Yes /classes/SpecificPrice.php:576
2567
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 9821)
0.586 ms 1 /classes/Product.php:3860
3854
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (9849) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.586 ms 1 Yes Yes /classes/Product.php:4524
819
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4856 LIMIT 1
0.585 ms 10 /classes/SpecificPrice.php:435
3233
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5083
ORDER BY `position`
0.585 ms 1 Yes /classes/Product.php:3545
3675
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3946) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.585 ms 1 Yes Yes /classes/Product.php:4524
3546
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 163) LIMIT 1
0.585 ms 1 /src/Adapter/EntityMapper.php:71
3672
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3943) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.585 ms 1 Yes Yes /classes/Product.php:4524
3676
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3947) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.585 ms 1 Yes Yes /classes/Product.php:4524
365
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2944 LIMIT 1
0.584 ms 10 /classes/SpecificPrice.php:435
796
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4298 LIMIT 1
0.584 ms 10 /classes/SpecificPrice.php:435
1094
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3995
AND image_shop.`cover` = 1 LIMIT 1
0.584 ms 1 /classes/Product.php:3570
733
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3801)
0.584 ms 1 /classes/Product.php:3860
904
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3985 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3985 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.584 ms 0 /classes/Cart.php:1430
1958
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3981 LIMIT 1
0.584 ms 10 /classes/SpecificPrice.php:435
3006
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 8356
ORDER BY `position`
0.583 ms 2 Yes /classes/Product.php:3545
3804
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (5642) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.583 ms 1 Yes Yes /classes/Product.php:4524
2370
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 9749 AND id_shop=1 LIMIT 1
0.583 ms 1 /classes/Product.php:6876
1697
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4702 AND id_shop=1 LIMIT 1
0.582 ms 1 /classes/Product.php:6876
3003
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4000
ORDER BY `position`
0.582 ms 1 Yes /classes/Product.php:3545
3803
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (5641) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.582 ms 1 Yes Yes /classes/Product.php:4524
2289
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 9723 LIMIT 1
0.581 ms 11 /classes/SpecificPrice.php:435
595
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3500
AND image_shop.`cover` = 1 LIMIT 1
0.580 ms 1 /classes/Product.php:3570
634
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3791 AND id_shop=1 LIMIT 1
0.580 ms 1 /classes/Product.php:6876
1726
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4718 LIMIT 1
0.580 ms 10 /classes/SpecificPrice.php:435
3671
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3942) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.580 ms 1 Yes Yes /classes/Product.php:4524
346
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2918)
0.580 ms 1 /classes/Product.php:3860
92
SELECT SQL_NO_CACHE DISTINCT a.`id_attribute`, a.`color`, al.`name`, agl.`id_attribute_group`, IF(lialv.`url_name` IS NULL OR lialv.`url_name` = "", NULL, lialv.`url_name`) AS url_name, IF(lialv.`meta_title` IS NULL OR lialv.`meta_title` = "", NULL, lialv.`meta_title`) AS meta_title FROM `hgt78_attribute_group` ag INNER JOIN `hgt78_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1) INNER JOIN `hgt78_attribute` a ON a.`id_attribute_group` = ag.`id_attribute_group` INNER JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1) INNER JOIN hgt78_attribute_group_shop attribute_group_shop
ON (attribute_group_shop.id_attribute_group = ag.id_attribute_group AND attribute_group_shop.id_shop = 1)  INNER JOIN hgt78_attribute_shop attribute_shop
ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1) LEFT JOIN `hgt78_layered_indexable_attribute_lang_value` lialv ON (a.`id_attribute` = lialv.`id_attribute` AND lialv.`id_lang` = 1) WHERE ag.id_attribute_group = 1 ORDER BY agl.`name` ASC, a.`position` ASC
0.579 ms 0 /modules/ps_facetedsearch/src/Filters/DataAccessor.php:96
845
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 5074)
0.579 ms 1 /classes/Product.php:3860
878
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 5113)
0.579 ms 1 /classes/Product.php:3860
1086
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 6101
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.579 ms 0 /classes/SpecificPrice.php:259
237
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2513
ORDER BY f.position ASC
0.578 ms 5 Yes /classes/Product.php:6021
1328
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4016 LIMIT 1
0.578 ms 10 /classes/SpecificPrice.php:435
3308
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 9743
ORDER BY `position`
0.578 ms 1 Yes /classes/Product.php:3545
894
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 5373
ORDER BY f.position ASC
0.577 ms 5 Yes /classes/Product.php:6021
923
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3986 AND id_shop=1 LIMIT 1
0.577 ms 1 /classes/Product.php:6876
1693
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4702 LIMIT 1
0.577 ms 10 /classes/SpecificPrice.php:435
1536
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4490
ORDER BY f.position ASC
0.577 ms 5 Yes /classes/Product.php:6021
2033
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 5084
ORDER BY f.position ASC
0.577 ms 5 Yes /classes/Product.php:6021
3830
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (9767) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.577 ms 1 Yes Yes /classes/Product.php:4524
1392
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4022 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4022 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.576 ms 0 /classes/Cart.php:1430
1735
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4989
AND image_shop.`cover` = 1 LIMIT 1
0.576 ms 1 /classes/Product.php:3570
2461
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 9773 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 9773 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.576 ms 0 /classes/Cart.php:1430
3385
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 9842) AND (b.`id_shop` = 1) LIMIT 1
0.576 ms 1 /src/Adapter/EntityMapper.php:71
3680
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3951) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.576 ms 1 Yes Yes /classes/Product.php:4524
336
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2835 AND `id_group` = 1 LIMIT 1
0.575 ms 0 /classes/GroupReduction.php:156
1162
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3999 LIMIT 1
0.575 ms 10 /classes/SpecificPrice.php:435
2380
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 9751)
0.575 ms 1 /classes/Product.php:3860
363
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2944
AND image_shop.`cover` = 1 LIMIT 1
0.575 ms 1 /classes/Product.php:3570
3413
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 9851
ORDER BY `position`
0.575 ms 1 Yes /classes/Product.php:3545
816
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4856
AND image_shop.`cover` = 1 LIMIT 1
0.574 ms 1 /classes/Product.php:3570
2050
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 5085)
0.574 ms 1 /classes/Product.php:3860
3808
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (6025) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.574 ms 1 Yes Yes /classes/Product.php:4524
3846
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (9830) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.574 ms 1 Yes Yes /classes/Product.php:4524
2674
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 9850 LIMIT 1
0.573 ms 11 /classes/SpecificPrice.php:435
3075
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4035
0.573 ms 1 /classes/Product.php:2902
390
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2899)
0.573 ms 1 /classes/Product.php:3860
3299
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 9721
ORDER BY `position`
0.572 ms 1 Yes /classes/Product.php:3545
2964
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 6099
ORDER BY `position`
0.572 ms 1 Yes /classes/Product.php:3545
457
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3199)
0.571 ms 1 /classes/Product.php:3860
1078
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3994 AND id_shop=1 LIMIT 1
0.571 ms 1 /classes/Product.php:6876
1190
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4000) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.571 ms 1 /classes/stock/StockAvailable.php:453
1765
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 5077) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.571 ms 1 /classes/stock/StockAvailable.php:453
2220
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 8946
ORDER BY f.position ASC
0.571 ms 5 Yes /classes/Product.php:6021
2363
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 9747
ORDER BY f.position ASC
0.571 ms 5 Yes /classes/Product.php:6021
3212
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3981
ORDER BY `position`
0.571 ms 1 Yes /classes/Product.php:3545
3565
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 49) LIMIT 1
0.571 ms 1 /src/Adapter/EntityMapper.php:71
357
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2836)
0.570 ms 1 /classes/Product.php:3860
3825
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (9746) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.570 ms 1 Yes Yes /classes/Product.php:4524
94
SELECT SQL_NO_CACHE DISTINCT a.`id_attribute`, a.`color`, al.`name`, agl.`id_attribute_group`, IF(lialv.`url_name` IS NULL OR lialv.`url_name` = "", NULL, lialv.`url_name`) AS url_name, IF(lialv.`meta_title` IS NULL OR lialv.`meta_title` = "", NULL, lialv.`meta_title`) AS meta_title FROM `hgt78_attribute_group` ag INNER JOIN `hgt78_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1) INNER JOIN `hgt78_attribute` a ON a.`id_attribute_group` = ag.`id_attribute_group` INNER JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1) INNER JOIN hgt78_attribute_group_shop attribute_group_shop
ON (attribute_group_shop.id_attribute_group = ag.id_attribute_group AND attribute_group_shop.id_shop = 1)  INNER JOIN hgt78_attribute_shop attribute_shop
ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1) LEFT JOIN `hgt78_layered_indexable_attribute_lang_value` lialv ON (a.`id_attribute` = lialv.`id_attribute` AND lialv.`id_lang` = 1) WHERE ag.id_attribute_group = 2 ORDER BY agl.`name` ASC, a.`position` ASC
0.569 ms 0 /modules/ps_facetedsearch/src/Filters/DataAccessor.php:96
2850
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3790
ORDER BY `position`
0.569 ms 1 Yes /classes/Product.php:3545
3832
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (9769) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.569 ms 1 Yes Yes /classes/Product.php:4524
312
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2890)
0.569 ms 1 /classes/Product.php:3860
519
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 44 LIMIT 1
0.569 ms 1 /classes/Product.php:5659
3167
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5103
ORDER BY `position`
0.569 ms 1 Yes /classes/Product.php:3545
3668
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3788) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.569 ms 1 Yes Yes /classes/Product.php:4524
1404
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4029
ORDER BY f.position ASC
0.568 ms 5 Yes /classes/Product.php:6021
2787
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2899
ORDER BY `position`
0.568 ms 1 Yes /classes/Product.php:3545
3011
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 8357) AND (b.`id_shop` = 1) LIMIT 1
0.568 ms 1 /src/Adapter/EntityMapper.php:71
3812
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (8429) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.568 ms 1 Yes Yes /classes/Product.php:4524
3849
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (9844) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.568 ms 1 Yes Yes /classes/Product.php:4524
364
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 54 LIMIT 1
0.567 ms 1 /classes/Product.php:5659
2682
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 9850
ORDER BY f.position ASC
0.567 ms 5 Yes /classes/Product.php:6021
3823
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (9744) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.567 ms 1 Yes Yes /classes/Product.php:4524
806
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 44 LIMIT 1
0.566 ms 1 /classes/Product.php:5659
3084
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4238
0.566 ms 1 /classes/Product.php:2902
613
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3788 AND `id_group` = 1 LIMIT 1
0.565 ms 0 /classes/GroupReduction.php:156
795
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 44 LIMIT 1
0.565 ms 1 /classes/Product.php:5659
978
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 5510)
0.565 ms 1 /classes/Product.php:3860
3587
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 33) LIMIT 1
0.565 ms 1 /src/Adapter/EntityMapper.php:71
1425
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4032 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4032 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.565 ms 0 /classes/Cart.php:1430
2693
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 9851
ORDER BY f.position ASC
0.565 ms 5 Yes /classes/Product.php:6021
1000
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3990)
0.564 ms 1 /classes/Product.php:3860
1614
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4580
AND image_shop.`cover` = 1 LIMIT 1
0.564 ms 2 /classes/Product.php:3570
2900
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4299) AND (b.`id_shop` = 1) LIMIT 1
0.564 ms 1 /src/Adapter/EntityMapper.php:71
3009
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4001
ORDER BY `position`
0.564 ms 1 Yes /classes/Product.php:3545
3682
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3952) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.564 ms 1 Yes Yes /classes/Product.php:4524
2328
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 9744) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.564 ms 1 /classes/stock/StockAvailable.php:453
1877
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 5337
ORDER BY f.position ASC
0.563 ms 5 Yes /classes/Product.php:6021
1893
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 5639 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.563 ms 10 Yes /classes/SpecificPrice.php:576
1679
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4700
ORDER BY f.position ASC
0.563 ms 5 Yes /classes/Product.php:6021
400
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3196
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.562 ms 0 /classes/SpecificPrice.php:259
1246
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 8637) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.562 ms 1 /classes/stock/StockAvailable.php:453
2473
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 9774
ORDER BY f.position ASC
0.562 ms 5 Yes /classes/Product.php:6021
2827
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3236
0.562 ms 1 /classes/Product.php:2902
3000
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3018
ORDER BY `position`
0.562 ms 1 Yes /classes/Product.php:3545
3162
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 5080
0.562 ms 1 /classes/Product.php:2902
3266
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 6025
ORDER BY `position`
0.562 ms 1 Yes /classes/Product.php:3545
1072
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3994
AND image_shop.`cover` = 1 LIMIT 1
0.561 ms 1 /classes/Product.php:3570
3881
SELECT SQL_NO_CACHE `id_guest`
FROM `hgt78_connections`
WHERE `id_guest` = 191937
AND `date_add` > '2025-05-01 12:55:00'
AND id_shop IN (1) 
ORDER BY `date_add` DESC LIMIT 1
0.561 ms 1 Yes /classes/Connection.php:168
518
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3242
AND image_shop.`cover` = 1 LIMIT 1
0.560 ms 1 /classes/Product.php:3570
971
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3988 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3988 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.560 ms 0 /classes/Cart.php:1430
2315
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 9743 AND id_shop=1 LIMIT 1
0.560 ms 1 /classes/Product.php:6876
3227
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4027
ORDER BY `position`
0.560 ms 1 Yes /classes/Product.php:3545
3541
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 74 AND `id_shop` = 1
0.560 ms 6 /src/Adapter/EntityMapper.php:79
1154
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3998)
0.559 ms 1 /classes/Product.php:3860
3581
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 196) LIMIT 1
0.559 ms 1 /src/Adapter/EntityMapper.php:71
3374
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 9819
ORDER BY `position`
0.558 ms 1 Yes /classes/Product.php:3545
791
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4297) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.558 ms 1 /classes/stock/StockAvailable.php:453
2659
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 9848 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 9848 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.558 ms 0 /classes/Cart.php:1430
3380
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 9821
ORDER BY `position`
0.558 ms 1 Yes /classes/Product.php:3545
3608
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 76 AND `id_shop` = 1
0.558 ms 6 /src/Adapter/EntityMapper.php:79
2595
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 9843
AND image_shop.`cover` = 1 LIMIT 1
0.557 ms 1 /classes/Product.php:3570
3827
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (9749) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.557 ms 1 Yes Yes /classes/Product.php:4524
3843
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (9819) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.557 ms 1 Yes Yes /classes/Product.php:4524
1983
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3983)
0.556 ms 1 /classes/Product.php:3860
2841
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3520
ORDER BY `position`
0.556 ms 1 Yes /classes/Product.php:3545
2895
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4297
ORDER BY `position`
0.556 ms 1 Yes /classes/Product.php:3545
3580
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 145 AND `id_shop` = 1
0.555 ms 6 /src/Adapter/EntityMapper.php:79
3662
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3257) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.555 ms 1 Yes Yes /classes/Product.php:4524
3677
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3949) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.555 ms 1 Yes Yes /classes/Product.php:4524
3806
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (6023) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.555 ms 1 Yes Yes /classes/Product.php:4524
3815
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (8948) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.555 ms 1 Yes Yes /classes/Product.php:4524
3432
SELECT SQL_NO_CACHE * FROM `hgt78_cart_rule` cr
LEFT JOIN `hgt78_cart_rule_lang` crl 
ON (cr.`id_cart_rule` = crl.`id_cart_rule` AND crl.`id_lang` = 0) WHERE (cr.`id_customer` = 0) AND NOW() BETWEEN cr.date_from AND cr.date_to
AND cr.`active` = 1
AND cr.`quantity` > 0 AND highlight = 1 AND code NOT LIKE "BO_ORDER_%"
0.554 ms 1 /classes/CartRule.php:423
694
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3946
ORDER BY f.position ASC
0.554 ms 5 Yes /classes/Product.php:6021
1155
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3998 AND id_shop=1 LIMIT 1
0.553 ms 1 /classes/Product.php:6876
2980
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3995
0.553 ms 1 /classes/Product.php:2902
3253
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 5642) AND (b.`id_shop` = 1) LIMIT 1
0.553 ms 1 /src/Adapter/EntityMapper.php:71
224
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2448) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.552 ms 1 /classes/stock/StockAvailable.php:453
1332
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4016 AND id_shop=1 LIMIT 1
0.552 ms 1 /classes/Product.php:6876
1715
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4704 LIMIT 1
0.552 ms 10 /classes/SpecificPrice.php:435
3588
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 33 AND `id_shop` = 1
0.552 ms 6 /src/Adapter/EntityMapper.php:79
1051
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 78 LIMIT 1
0.551 ms 1 /classes/Product.php:5659
2663
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 9849 LIMIT 1
0.551 ms 11 /classes/SpecificPrice.php:435
2704
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 9852
ORDER BY f.position ASC
0.551 ms 5 Yes /classes/Product.php:6021
3072
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4034
0.551 ms 1 /classes/Product.php:2902
3817
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (8970) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.551 ms 1 Yes Yes /classes/Product.php:4524
1238
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 8637
AND image_shop.`cover` = 1 LIMIT 1
0.550 ms 1 /classes/Product.php:3570
3259
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 6023) AND (b.`id_shop` = 1) LIMIT 1
0.550 ms 1 /src/Adapter/EntityMapper.php:71
2276
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 9721
AND image_shop.`cover` = 1 LIMIT 1
0.549 ms 1 /classes/Product.php:3570
2484
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 9788
ORDER BY f.position ASC
0.549 ms 5 Yes /classes/Product.php:6021
2812
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3200
0.549 ms 1 /classes/Product.php:2902
2977
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 6101
0.548 ms 1 /classes/Product.php:2902
3568
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 59 AND `id_shop` = 1
0.548 ms 6 /src/Adapter/EntityMapper.php:79
2506
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 9790
ORDER BY f.position ASC
0.547 ms 5 Yes /classes/Product.php:6021
2528
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 9792
ORDER BY f.position ASC
0.547 ms 5 Yes /classes/Product.php:6021
2660
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 9848
ORDER BY f.position ASC
0.547 ms 5 Yes /classes/Product.php:6021
3030
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 10235
ORDER BY `position`
0.547 ms 1 Yes /classes/Product.php:3545
3862
SELECT SQL_NO_CACHE DISTINCT c.*
FROM `hgt78_category` c
LEFT JOIN `hgt78_category_lang` cl ON (c.`id_category` = cl.`id_category` AND cl.`id_lang` = 1)
WHERE `level_depth` = 1
0.547 ms 21 /classes/Category.php:2242
825
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4856) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.546 ms 1 /classes/stock/StockAvailable.php:453
1058
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3993) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.546 ms 1 /classes/stock/StockAvailable.php:453
1030
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3992 LIMIT 1
0.545 ms 10 /classes/SpecificPrice.php:435
3851
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (9846) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.545 ms 1 Yes Yes /classes/Product.php:4524
217
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 44 LIMIT 1
0.544 ms 1 /classes/Product.php:5659
410
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3197 LIMIT 1
0.544 ms 10 /classes/SpecificPrice.php:435
2417
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 9768 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 9768 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.544 ms 0 /classes/Cart.php:1430
416
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3197) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.543 ms 1 /classes/stock/StockAvailable.php:453
1563
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4506 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.543 ms 10 Yes /classes/SpecificPrice.php:576
3831
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (9768) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.543 ms 1 Yes Yes /classes/Product.php:4524
1977
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3982
ORDER BY f.position ASC
0.543 ms 5 Yes /classes/Product.php:6021
2061
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 5101)
0.543 ms 1 /classes/Product.php:3860
3020
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4003) AND (b.`id_shop` = 1) LIMIT 1
0.543 ms 1 /src/Adapter/EntityMapper.php:71
1022
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 6054)
0.542 ms 1 /classes/Product.php:3860
1317
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 10932 LIMIT 1
0.542 ms 10 /classes/SpecificPrice.php:435
466
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3011
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.541 ms 0 /classes/SpecificPrice.php:259
2983
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 6102
0.541 ms 1 /classes/Product.php:2902
1797
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 5103 AND `id_group` = 1 LIMIT 1
0.540 ms 0 /classes/GroupReduction.php:156
1776
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 5080) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.540 ms 1 /classes/stock/StockAvailable.php:453
1321
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 10932 AND id_shop=1 LIMIT 1
0.539 ms 1 /classes/Product.php:6876
1694
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4702
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.538 ms 0 /classes/SpecificPrice.php:259
2818
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3234
0.538 ms 1 /classes/Product.php:2902
1227
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4002
AND image_shop.`cover` = 1 LIMIT 1
0.538 ms 1 /classes/Product.php:3570
542
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3257 LIMIT 1
0.537 ms 10 /classes/SpecificPrice.php:435
2288
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 200 LIMIT 1
0.537 ms 1 /classes/Product.php:5659
284
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2889
AND image_shop.`cover` = 1 LIMIT 1
0.536 ms 1 /classes/Product.php:3570
1624
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4580
ORDER BY f.position ASC
0.536 ms 5 Yes /classes/Product.php:6021
3352
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 9774) AND (b.`id_shop` = 1) LIMIT 1
0.536 ms 1 /src/Adapter/EntityMapper.php:71
3431
SELECT SQL_NO_CACHE 1 FROM `hgt78_cart_rule` WHERE ((date_to >= "2025-05-01 00:00:00" AND date_to <= "2025-05-01 23:59:59") OR (date_from >= "2025-05-01 00:00:00" AND date_from <= "2025-05-01 23:59:59") OR (date_from < "2025-05-01 00:00:00" AND date_to > "2025-05-01 23:59:59")) AND `id_customer` IN (0,0) LIMIT 1
0.536 ms 29 /classes/CartRule.php:357
961
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3988
AND image_shop.`cover` = 1 LIMIT 1
0.535 ms 1 /classes/Product.php:3570
252
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2514 LIMIT 1
0.534 ms 10 /classes/SpecificPrice.php:435
906
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 5415
AND image_shop.`cover` = 1 LIMIT 1
0.534 ms 2 /classes/Product.php:3570
925
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3986) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.534 ms 1 /classes/stock/StockAvailable.php:453
3014
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4002) AND (b.`id_shop` = 1) LIMIT 1
0.534 ms 1 /src/Adapter/EntityMapper.php:71
451
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3010
ORDER BY f.position ASC
0.533 ms 5 Yes /classes/Product.php:6021
1240
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 8637 LIMIT 1
0.533 ms 10 /classes/SpecificPrice.php:435
2592
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 9842) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.533 ms 1 /classes/stock/StockAvailable.php:453
3189
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 5337
0.533 ms 1 /classes/Product.php:2902
2716
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 10738
ORDER BY f.position ASC
0.533 ms 5 Yes /classes/Product.php:6021
636
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3791) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.532 ms 1 /classes/stock/StockAvailable.php:453
2012
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4027
AND image_shop.`cover` = 1 LIMIT 1
0.532 ms 1 /classes/Product.php:3570
2284
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 9721) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.532 ms 1 /classes/stock/StockAvailable.php:453
3460
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 71) LIMIT 1
0.532 ms 1 /src/Adapter/EntityMapper.php:71
3836
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (9774) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.532 ms 1 Yes Yes /classes/Product.php:4524
3837
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (9788) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.532 ms 1 Yes Yes /classes/Product.php:4524
2677
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 9850)
0.531 ms 1 /classes/Product.php:3860
1031
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3992
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.530 ms 0 /classes/SpecificPrice.php:259
2586
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 9842 LIMIT 1
0.530 ms 11 /classes/SpecificPrice.php:435
3557
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 264 AND `id_shop` = 1
0.530 ms 6 /src/Adapter/EntityMapper.php:79
21
SELECT SQL_NO_CACHE m.`id_module`, m.`name`, ms.`id_module`as `mshop`
FROM `hgt78_module` m
LEFT JOIN `hgt78_module_shop` ms
ON m.`id_module` = ms.`id_module`
AND ms.`id_shop` = 1
0.529 ms 118 /classes/module/Module.php:346
1458
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4035 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4035 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.529 ms 0 /classes/Cart.php:1430
1509
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4241)
0.529 ms 1 /classes/Product.php:3860
564
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3497 LIMIT 1
0.528 ms 11 /classes/SpecificPrice.php:435
944
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3987)
0.528 ms 1 /classes/Product.php:3860
1233
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4002 AND id_shop=1 LIMIT 1
0.528 ms 1 /classes/Product.php:6876
3840
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (9791) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.528 ms 1 Yes Yes /classes/Product.php:4524
755
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3802)
0.528 ms 1 /classes/Product.php:3860
868
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 5106 AND id_shop=1 LIMIT 1
0.528 ms 1 /classes/Product.php:6876
914
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 5415) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.528 ms 1 /classes/stock/StockAvailable.php:453
936
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 5418) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.527 ms 1 /classes/stock/StockAvailable.php:453
1369
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4019
ORDER BY f.position ASC
0.527 ms 5 Yes /classes/Product.php:6021
1029
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 78 LIMIT 1
0.527 ms 1 /classes/Product.php:5659
2273
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 9264) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.527 ms 1 /classes/stock/StockAvailable.php:453
3523
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 51 AND `id_shop` = 1
0.527 ms 6 /src/Adapter/EntityMapper.php:79
2429
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 9769
ORDER BY f.position ASC
0.526 ms 5 Yes /classes/Product.php:6021
1167
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3999 AND `id_group` = 1 LIMIT 1
0.526 ms 0 /classes/GroupReduction.php:156
1876
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 5337 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 5337 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.526 ms 0 /classes/Cart.php:1430
2721
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3797
ORDER BY `position`
0.526 ms 1 Yes /classes/Product.php:3545
2028
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 5084)
0.525 ms 1 /classes/Product.php:3860
3569
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 60) LIMIT 1
0.525 ms 1 /src/Adapter/EntityMapper.php:71
2310
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 54 LIMIT 1
0.524 ms 1 /classes/Product.php:5659
3272
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 6134
ORDER BY `position`
0.524 ms 1 Yes /classes/Product.php:3545
3855
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (9850) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.524 ms 1 Yes Yes /classes/Product.php:4524
1213
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4001) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.523 ms 1 /classes/stock/StockAvailable.php:453
824
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4856 AND `id_group` = 1 LIMIT 1
0.523 ms 0 /classes/GroupReduction.php:156
873
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 5113
AND image_shop.`cover` = 1 LIMIT 1
0.523 ms 1 /classes/Product.php:3570
1922
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4489
ORDER BY f.position ASC
0.523 ms 5 Yes /classes/Product.php:6021
2282
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 9721 AND id_shop=1 LIMIT 1
0.523 ms 1 /classes/Product.php:6876
2550
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 9819
ORDER BY f.position ASC
0.523 ms 5 Yes /classes/Product.php:6021
460
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3199) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.522 ms 1 /classes/stock/StockAvailable.php:453
674
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 199 LIMIT 1
0.522 ms 1 /classes/Product.php:5659
3334
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 9767) AND (b.`id_shop` = 1) LIMIT 1
0.522 ms 1 /src/Adapter/EntityMapper.php:71
3856
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (9851) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.522 ms 1 Yes Yes /classes/Product.php:4524
920
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3986
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.521 ms 0 /classes/SpecificPrice.php:259
440
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3198
ORDER BY f.position ASC
0.521 ms 5 Yes /classes/Product.php:6021
1698
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4702 AND `id_group` = 1 LIMIT 1
0.520 ms 0 /classes/GroupReduction.php:156
1910
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4488 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4488 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.520 ms 0 /classes/Cart.php:1430
1930
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3978 AND `id_group` = 1 LIMIT 1
0.520 ms 0 /classes/GroupReduction.php:156
2139
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 6023 AND id_shop=1 LIMIT 1
0.520 ms 1 /classes/Product.php:6876
118
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE `id_product` != 0 LIMIT 1
0.519 ms 22288 /classes/SpecificPrice.php:297
807
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4299 LIMIT 1
0.519 ms 10 /classes/SpecificPrice.php:435
1137
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 6120
ORDER BY f.position ASC
0.519 ms 5 Yes /classes/Product.php:6021
1265
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 9521)
0.519 ms 1 /classes/Product.php:3860
2440
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 9771
ORDER BY f.position ASC
0.519 ms 5 Yes /classes/Product.php:6021
2738
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2502) AND (b.`id_shop` = 1) LIMIT 1
0.519 ms 1 /src/Adapter/EntityMapper.php:71
773
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 44 LIMIT 1
0.518 ms 1 /classes/Product.php:5659
3201
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4489
0.518 ms 1 /classes/Product.php:2902
3867
SELECT SQL_NO_CACHE `id_module` FROM `hgt78_module_shop` WHERE `id_module` = 89 AND `id_shop` = 1 LIMIT 1
0.518 ms 1 /classes/module/Module.php:2137
3017
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 8637) AND (b.`id_shop` = 1) LIMIT 1
0.518 ms 1 /src/Adapter/EntityMapper.php:71
1239
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 100 LIMIT 1
0.517 ms 1 /classes/Product.php:5659
1899
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 5639
ORDER BY f.position ASC
0.517 ms 5 Yes /classes/Product.php:6021
2347
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 9746)
0.517 ms 1 /classes/Product.php:3860
2517
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 9791
ORDER BY f.position ASC
0.517 ms 5 Yes /classes/Product.php:6021
2967
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3993
ORDER BY `position`
0.517 ms 1 Yes /classes/Product.php:3545
3542
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 161) LIMIT 1
0.516 ms 1 /src/Adapter/EntityMapper.php:71
587
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3520
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.515 ms 0 /classes/SpecificPrice.php:259
2820
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3235
ORDER BY `position`
0.515 ms 1 Yes /classes/Product.php:3545
2838
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3499
ORDER BY `position`
0.515 ms 1 Yes /classes/Product.php:3545
3461
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 71 AND `id_shop` = 1
0.515 ms 6 /src/Adapter/EntityMapper.php:79
964
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3988 LIMIT 1
0.514 ms 10 /classes/SpecificPrice.php:435
2132
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 6018
ORDER BY f.position ASC
0.514 ms 5 Yes /classes/Product.php:6021
2341
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 9745
ORDER BY f.position ASC
0.514 ms 5 Yes /classes/Product.php:6021
3312
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 9744
0.514 ms 1 /classes/Product.php:2902
1089
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 6101 AND id_shop=1 LIMIT 1
0.514 ms 1 /classes/Product.php:6876
2796
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2945
ORDER BY `position`
0.514 ms 1 Yes /classes/Product.php:3545
2998
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3999
0.513 ms 1 /classes/Product.php:2902
675
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3945 LIMIT 1
0.512 ms 10 /classes/SpecificPrice.php:435
1828
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 5165)
0.512 ms 1 /classes/Product.php:3860
3248
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5640
ORDER BY `position`
0.512 ms 1 Yes /classes/Product.php:3545
3428
SELECT SQL_NO_CACHE 1 FROM hgt78_cart_product cp INNER JOIN hgt78_product p
ON (p.id_product = cp.id_product) INNER JOIN hgt78_product_shop ps
ON (ps.id_shop = cp.id_shop AND ps.id_product = p.id_product) WHERE cp.id_cart=0 LIMIT 1
0.512 ms 1 /classes/Cart.php:4255
2007
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2930 AND id_shop=1 LIMIT 1
0.511 ms 1 /classes/Product.php:6876
2039
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 5083)
0.511 ms 1 /classes/Product.php:3860
2995
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3998
0.511 ms 1 /classes/Product.php:2902
2160
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 6025)
0.510 ms 1 /classes/Product.php:3860
763
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3952 LIMIT 1
0.510 ms 10 /classes/SpecificPrice.php:435
2736
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2447
ORDER BY `position`
0.510 ms 2 Yes /classes/Product.php:3545
3560
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 266) LIMIT 1
0.510 ms 1 /src/Adapter/EntityMapper.php:71
995
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3990
AND image_shop.`cover` = 1 LIMIT 1
0.509 ms 1 /classes/Product.php:3570
2388
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 9752 LIMIT 1
0.509 ms 11 /classes/SpecificPrice.php:435
2666
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 9849)
0.509 ms 1 /classes/Product.php:3860
1200
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 8356 AND id_shop=1 LIMIT 1
0.508 ms 1 /classes/Product.php:6876
2171
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 6105)
0.508 ms 1 /classes/Product.php:3860
1163
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3999
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.508 ms 0 /classes/SpecificPrice.php:259
594
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3520
ORDER BY f.position ASC
0.507 ms 5 Yes /classes/Product.php:6021
701
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3947 AND id_shop=1 LIMIT 1
0.507 ms 1 /classes/Product.php:6876
1143
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3997)
0.507 ms 1 /classes/Product.php:3860
2264
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 8970
ORDER BY f.position ASC
0.507 ms 5 Yes /classes/Product.php:6021
1382
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4022
AND image_shop.`cover` = 1 LIMIT 1
0.505 ms 1 /classes/Product.php:3570
430
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3198
AND image_shop.`cover` = 1 LIMIT 1
0.505 ms 1 /classes/Product.php:3570
1327
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 45 LIMIT 1
0.505 ms 1 /classes/Product.php:5659
3409
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 9850) AND (b.`id_shop` = 1) LIMIT 1
0.505 ms 1 /src/Adapter/EntityMapper.php:71
3447
SELECT SQL_NO_CACHE SUM(`quantity`)
FROM `hgt78_cart_product`
WHERE `id_cart` = 0 LIMIT 1
0.505 ms 1 /classes/Cart.php:1303
3793
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3984) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.505 ms 1 Yes Yes /classes/Product.php:4524
618
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 44 LIMIT 1
0.504 ms 1 /classes/Product.php:5659
848
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 5074) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.504 ms 1 /classes/stock/StockAvailable.php:453
1939
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3979)
0.504 ms 1 /classes/Product.php:3860
2023
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 5084
AND image_shop.`cover` = 1 LIMIT 1
0.504 ms 1 /classes/Product.php:3570
2141
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 6023) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.503 ms 1 /classes/stock/StockAvailable.php:453
2182
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 6134)
0.503 ms 1 /classes/Product.php:3860
2193
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 6135)
0.503 ms 1 /classes/Product.php:3860
1128
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 44 LIMIT 1
0.503 ms 1 /classes/Product.php:5659
1619
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4580)
0.503 ms 1 /classes/Product.php:3860
1148
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3997
ORDER BY f.position ASC
0.502 ms 5 Yes /classes/Product.php:6021
1345
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4017) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.502 ms 1 /classes/stock/StockAvailable.php:453
3209
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3980
ORDER BY `position`
0.502 ms 1 Yes /classes/Product.php:3545
3436
SELECT SQL_NO_CACHE COUNT(DISTINCT c.id_currency) FROM `hgt78_currency` c
LEFT JOIN hgt78_currency_shop cs ON (cs.id_currency = c.id_currency AND cs.id_shop = 1)
WHERE c.`active` = 1 AND c.`deleted` = 0 LIMIT 1
0.502 ms 2 /classes/Currency.php:1136
462
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3199
ORDER BY f.position ASC
0.501 ms 5 Yes /classes/Product.php:6021
1736
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 46 LIMIT 1
0.500 ms 1 /classes/Product.php:5659
2177
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 6134
AND image_shop.`cover` = 1 LIMIT 1
0.500 ms 1 /classes/Product.php:3570
3547
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 163 AND `id_shop` = 1
0.500 ms 6 /src/Adapter/EntityMapper.php:79
3578
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 96 AND `id_shop` = 1
0.500 ms 6 /src/Adapter/EntityMapper.php:79
294
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2889
ORDER BY f.position ASC
0.499 ms 5 Yes /classes/Product.php:6021
1574
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4507 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.499 ms 10 Yes /classes/SpecificPrice.php:576
1743
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4989) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.499 ms 1 /classes/stock/StockAvailable.php:453
1887
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 5638 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 5638 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.499 ms 0 /classes/Cart.php:1430
3457
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 40 AND `id_shop` = 1
0.499 ms 6 /src/Adapter/EntityMapper.php:79
405
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3196) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.498 ms 1 /classes/stock/StockAvailable.php:453
1666
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4699) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.498 ms 1 /classes/stock/StockAvailable.php:453
1865
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 5336 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 5336 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.498 ms 0 /classes/Cart.php:1430
3444
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 2) AND (b.`id_shop` = 1) LIMIT 1
0.498 ms 1 /src/Adapter/EntityMapper.php:71
1713
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4704
AND image_shop.`cover` = 1 LIMIT 1
0.497 ms 1 /classes/Product.php:3570
3027
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4004
ORDER BY `position`
0.497 ms 1 Yes /classes/Product.php:3545
3613
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 221) LIMIT 1
0.497 ms 1 /src/Adapter/EntityMapper.php:71
1520
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4413)
0.497 ms 1 /classes/Product.php:3860
1542
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4491)
0.497 ms 1 /classes/Product.php:3860
3559
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 265 AND `id_shop` = 1
0.497 ms 6 /src/Adapter/EntityMapper.php:79
2326
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 9744 AND id_shop=1 LIMIT 1
0.496 ms 1 /classes/Product.php:6876
1759
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 5077 LIMIT 1
0.496 ms 10 /classes/SpecificPrice.php:435
1796
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 5103 AND id_shop=1 LIMIT 1
0.496 ms 1 /classes/Product.php:6876
717
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3950
AND image_shop.`cover` = 1 LIMIT 1
0.495 ms 1 /classes/Product.php:3570
728
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3801
AND image_shop.`cover` = 1 LIMIT 1
0.495 ms 1 /classes/Product.php:3570
1149
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3998
AND image_shop.`cover` = 1 LIMIT 1
0.495 ms 1 /classes/Product.php:3570
2074
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 5328 AND `id_group` = 1 LIMIT 1
0.495 ms 0 /classes/GroupReduction.php:156
3069
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4033
0.495 ms 1 /classes/Product.php:2902
3180
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 5166
0.495 ms 1 /classes/Product.php:2902
3876
SELECT SQL_NO_CACHE *
FROM `hgt78_cms` a
LEFT JOIN `hgt78_cms_lang` `b` ON a.`id_cms` = b.`id_cms` AND b.`id_lang` = 1
LEFT JOIN `hgt78_cms_shop` `c` ON a.`id_cms` = c.`id_cms` AND c.`id_shop` = 1
WHERE (a.`id_cms` = 2) AND (b.`id_shop` = 1) LIMIT 1
0.495 ms 1 /src/Adapter/EntityMapper.php:71
113
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `hgt78_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 44 LIMIT 1
0.494 ms 1 /classes/Category.php:1378
698
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3947
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.494 ms 0 /classes/SpecificPrice.php:259
2556
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 9820)
0.494 ms 1 /classes/Product.php:3860
3332
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 9752
ORDER BY `position`
0.494 ms 1 Yes /classes/Product.php:3545
1129
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 6120 LIMIT 1
0.493 ms 2 /classes/SpecificPrice.php:435
1364
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4019)
0.493 ms 1 /classes/Product.php:3860
3317
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 9746
ORDER BY `position`
0.493 ms 1 Yes /classes/Product.php:3545
714
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3949) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.493 ms 1 /classes/stock/StockAvailable.php:453
1811
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 5104
ORDER BY f.position ASC
0.493 ms 5 Yes /classes/Product.php:6021
1727
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4718
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.492 ms 0 /classes/SpecificPrice.php:259
3582
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 196 AND `id_shop` = 1
0.492 ms 6 /src/Adapter/EntityMapper.php:79
2747
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2504) AND (b.`id_shop` = 1) LIMIT 1
0.492 ms 1 /src/Adapter/EntityMapper.php:71
3386
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 9842
ORDER BY `position`
0.491 ms 1 Yes /classes/Product.php:3545
1260
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 9521
AND image_shop.`cover` = 1 LIMIT 1
0.491 ms 1 /classes/Product.php:3570
650
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3943
AND image_shop.`cover` = 1 LIMIT 1
0.490 ms 1 /classes/Product.php:3570
1524
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4413 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4413 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.490 ms 0 /classes/Cart.php:1430
1448
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4034
ORDER BY f.position ASC
0.490 ms 5 Yes /classes/Product.php:6021
1652
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4698)
0.490 ms 1 /classes/Product.php:3860
667
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3944)
0.489 ms 1 /classes/Product.php:3860
1823
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 5165
AND image_shop.`cover` = 1 LIMIT 1
0.489 ms 1 /classes/Product.php:3570
2086
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 5352) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.489 ms 1 /classes/stock/StockAvailable.php:453
2581
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 9830) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.489 ms 1 /classes/stock/StockAvailable.php:453
3577
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 96) LIMIT 1
0.489 ms 1 /src/Adapter/EntityMapper.php:71
1393
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4022
ORDER BY f.position ASC
0.488 ms 5 Yes /classes/Product.php:6021
1487
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4238)
0.488 ms 1 /classes/Product.php:3860
1967
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3982
AND image_shop.`cover` = 1 LIMIT 1
0.488 ms 1 /classes/Product.php:3570
2457
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 9773)
0.488 ms 1 /classes/Product.php:3860
2844
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3500
ORDER BY `position`
0.488 ms 1 Yes /classes/Product.php:3545
689
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3946)
0.488 ms 1 /classes/Product.php:3860
432
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3198 LIMIT 1
0.487 ms 10 /classes/SpecificPrice.php:435
863
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 44 LIMIT 1
0.487 ms 1 /classes/Product.php:5659
1208
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4001
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.487 ms 0 /classes/SpecificPrice.php:259
2539
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 9794
ORDER BY f.position ASC
0.487 ms 5 Yes /classes/Product.php:6021
507
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3235
AND image_shop.`cover` = 1 LIMIT 1
0.487 ms 1 /classes/Product.php:3570
2342
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 9746
AND image_shop.`cover` = 1 LIMIT 1
0.487 ms 1 /classes/Product.php:3570
2725
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3796
0.487 ms 1 /classes/Product.php:2902
3093
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4413
0.487 ms 1 /classes/Product.php:2902
3251
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5641
ORDER BY `position`
0.487 ms 1 Yes /classes/Product.php:3545
1207
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4001 LIMIT 1
0.486 ms 10 /classes/SpecificPrice.php:435
1268
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 9521) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.486 ms 1 /classes/stock/StockAvailable.php:453
387
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2899 LIMIT 1
0.486 ms 10 /classes/SpecificPrice.php:435
1950
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3980)
0.486 ms 1 /classes/Product.php:3860
3558
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 265) LIMIT 1
0.486 ms 1 /src/Adapter/EntityMapper.php:71
3567
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 59) LIMIT 1
0.486 ms 1 /src/Adapter/EntityMapper.php:71
3037
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 10236
0.485 ms 1 /classes/Product.php:2902
2793
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3197
ORDER BY `position`
0.485 ms 1 Yes /classes/Product.php:3545
1084
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 44 LIMIT 1
0.484 ms 1 /classes/Product.php:5659
1102
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3995) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.484 ms 1 /classes/stock/StockAvailable.php:453
1304
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 10236
AND image_shop.`cover` = 1 LIMIT 1
0.484 ms 1 /classes/Product.php:3570
1708
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4703 AND id_shop=1 LIMIT 1
0.484 ms 1 /classes/Product.php:6876
1719
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4704 AND id_shop=1 LIMIT 1
0.484 ms 1 /classes/Product.php:6876
1493
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4239
AND image_shop.`cover` = 1 LIMIT 1
0.483 ms 1 /classes/Product.php:3570
2866
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3945
0.483 ms 1 /classes/Product.php:2902
2644
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 9847)
0.483 ms 1 /classes/Product.php:3860
181
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2475
AND image_shop.`cover` = 1 LIMIT 1
0.482 ms 1 /classes/Product.php:3570
2116
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 5642)
0.482 ms 1 /classes/Product.php:3860
2561
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 9820
ORDER BY f.position ASC
0.482 ms 5 Yes /classes/Product.php:6021
2138
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 6023)
0.481 ms 1 /classes/Product.php:3860
3532
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 37) LIMIT 1
0.481 ms 1 /src/Adapter/EntityMapper.php:71
3538
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 73) LIMIT 1
0.481 ms 1 /src/Adapter/EntityMapper.php:71
1351
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4018
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.481 ms 0 /classes/SpecificPrice.php:259
2799
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3198
ORDER BY `position`
0.480 ms 1 Yes /classes/Product.php:3545
2396
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 9752
ORDER BY f.position ASC
0.480 ms 5 Yes /classes/Product.php:6021
3570
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 60 AND `id_shop` = 1
0.480 ms 6 /src/Adapter/EntityMapper.php:79
702
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3947 AND `id_group` = 1 LIMIT 1
0.479 ms 0 /classes/GroupReduction.php:156
722
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3950)
0.479 ms 1 /classes/Product.php:3860
939
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3987
AND image_shop.`cover` = 1 LIMIT 1
0.479 ms 1 /classes/Product.php:3570
1784
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 5102)
0.479 ms 1 /classes/Product.php:3860
1961
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3981)
0.479 ms 1 /classes/Product.php:3860
3882
INSERT INTO `hgt78_connections_source` (`id_connections`, `http_referer`, `request_uri`, `keywords`, `date_add`) VALUES ('104028', '', 'www.encens.fr/2-accueil?q=Cat%C3%A9gories-Encensoirs+%26+Bougeoirs-Bien%5C-etre%2FMarque-WLM&resultsPerPage=99999', '', '2025-05-01 13:25:26')
0.479 ms 1 /classes/ObjectModel.php:622
140
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3797
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.478 ms 0 /classes/SpecificPrice.php:259
750
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3802
AND image_shop.`cover` = 1 LIMIT 1
0.478 ms 1 /classes/Product.php:3570
1641
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4583)
0.478 ms 1 /classes/Product.php:3860
1872
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 5337)
0.478 ms 1 /classes/Product.php:3860
3419
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 10738
ORDER BY `position`
0.478 ms 1 Yes /classes/Product.php:3545
741
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3951 LIMIT 1
0.477 ms 10 /classes/SpecificPrice.php:435
1586
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4508)
0.477 ms 1 /classes/Product.php:3860
2767
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2890
0.477 ms 1 /classes/Product.php:2902
3245
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5352
ORDER BY `position`
0.477 ms 1 Yes /classes/Product.php:3545
1188
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4000 AND id_shop=1 LIMIT 1
0.477 ms 1 /classes/Product.php:6876
1630
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4582)
0.476 ms 1 /classes/Product.php:3860
1787
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 5102) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.476 ms 1 /classes/stock/StockAvailable.php:453
2600
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 9843)
0.476 ms 1 /classes/Product.php:3860
1498
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4239)
0.476 ms 1 /classes/Product.php:3860
2974
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3994
0.476 ms 1 /classes/Product.php:2902
736
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3801) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.475 ms 1 /classes/stock/StockAvailable.php:453
1768
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 5080
AND image_shop.`cover` = 1 LIMIT 1
0.475 ms 1 /classes/Product.php:3570
3105
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4506
0.475 ms 1 /classes/Product.php:2902
3377
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 9820
ORDER BY `position`
0.475 ms 1 Yes /classes/Product.php:3545
1803
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 5104 LIMIT 1
0.474 ms 10 /classes/SpecificPrice.php:435
2094
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 5640)
0.474 ms 1 /classes/Product.php:3860
2339
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 9745) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.474 ms 1 /classes/stock/StockAvailable.php:453
3794
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2930) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.474 ms 1 Yes Yes /classes/Product.php:4524
187
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2475)
0.473 ms 1 /classes/Product.php:3860
535
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3236 AND id_shop=1 LIMIT 1
0.473 ms 1 /classes/Product.php:6876
1041
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 6099 LIMIT 1
0.473 ms 10 /classes/SpecificPrice.php:435
1705
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4703
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.473 ms 0 /classes/SpecificPrice.php:259
1760
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 5077
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.473 ms 0 /classes/SpecificPrice.php:259
1843
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 5166 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 5166 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.472 ms 0 /classes/Cart.php:1430
3566
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 49 AND `id_shop` = 1
0.472 ms 6 /src/Adapter/EntityMapper.php:79
975
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 5510 LIMIT 1
0.472 ms 11 /classes/SpecificPrice.php:435
851
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 5075
AND image_shop.`cover` = 1 LIMIT 1
0.471 ms 1 /classes/Product.php:3570
2371
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 9749 AND `id_group` = 1 LIMIT 1
0.471 ms 0 /classes/GroupReduction.php:156
2122
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 6018
AND image_shop.`cover` = 1 LIMIT 1
0.470 ms 1 /classes/Product.php:3570
335
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2835 AND id_shop=1 LIMIT 1
0.470 ms 1 /classes/Product.php:6876
817
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `hgt78_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 90 LIMIT 1
0.470 ms 1 /classes/Category.php:1378
1791
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 200 LIMIT 1
0.470 ms 1 /classes/Product.php:5659
1822
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 5164
ORDER BY f.position ASC
0.470 ms 5 Yes /classes/Product.php:6021
1844
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 5166
ORDER BY f.position ASC
0.470 ms 5 Yes /classes/Product.php:6021
3090
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4241
0.470 ms 1 /classes/Product.php:2902
2316
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 9743 AND `id_group` = 1 LIMIT 1
0.469 ms 0 /classes/GroupReduction.php:156
2523
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 9792)
0.469 ms 1 /classes/Product.php:3860
3595
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 80) LIMIT 1
0.469 ms 1 /src/Adapter/EntityMapper.php:71
198
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2447)
0.468 ms 1 /classes/Product.php:3860
1730
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4718 AND id_shop=1 LIMIT 1
0.468 ms 1 /classes/Product.php:6876
1917
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4489)
0.468 ms 1 /classes/Product.php:3860
2633
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 9846)
0.468 ms 1 /classes/Product.php:3860
3021
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4003
ORDER BY `position`
0.468 ms 1 Yes /classes/Product.php:3545
3389
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 9843
ORDER BY `position`
0.468 ms 1 Yes /classes/Product.php:3545
1229
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4002 LIMIT 1
0.467 ms 10 /classes/SpecificPrice.php:435
1763
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 5077 AND id_shop=1 LIMIT 1
0.467 ms 1 /classes/Product.php:6876
2512
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 9791)
0.467 ms 1 /classes/Product.php:3860
840
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 5074
AND image_shop.`cover` = 1 LIMIT 1
0.467 ms 1 /classes/Product.php:3570
3594
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 79 AND `id_shop` = 1
0.467 ms 6 /src/Adapter/EntityMapper.php:79
973
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 5510
AND image_shop.`cover` = 1 LIMIT 1
0.466 ms 1 /classes/Product.php:3570
1597
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4540)
0.466 ms 1 /classes/Product.php:3860
2242
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 8948
ORDER BY f.position ASC
0.466 ms 5 Yes /classes/Product.php:6021
1244
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 8637 AND id_shop=1 LIMIT 1
0.466 ms 1 /classes/Product.php:6876
2271
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 9264 AND id_shop=1 LIMIT 1
0.466 ms 1 /classes/Product.php:6876
550
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3257
ORDER BY f.position ASC
0.465 ms 5 Yes /classes/Product.php:6021
818
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 90 LIMIT 1
0.465 ms 1 /classes/Product.php:5659
2215
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 8946)
0.465 ms 1 /classes/Product.php:3860
740
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 199 LIMIT 1
0.465 ms 1 /classes/Product.php:5659
1287
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 10235)
0.465 ms 1 /classes/Product.php:3860
2761
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2889
0.465 ms 1 /classes/Product.php:2902
3087
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4239
0.465 ms 1 /classes/Product.php:2902
3131
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4699
ORDER BY `position`
0.465 ms 1 Yes /classes/Product.php:3545
3544
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 162) LIMIT 1
0.465 ms 1 /src/Adapter/EntityMapper.php:71
619
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3790 LIMIT 1
0.464 ms 10 /classes/SpecificPrice.php:435
1052
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3993 LIMIT 1
0.464 ms 10 /classes/SpecificPrice.php:435
1189
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4000 AND `id_group` = 1 LIMIT 1
0.464 ms 0 /classes/GroupReduction.php:156
1731
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4718 AND `id_group` = 1 LIMIT 1
0.464 ms 0 /classes/GroupReduction.php:156
1806
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 5104)
0.464 ms 1 /classes/Product.php:3860
3543
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 161 AND `id_shop` = 1
0.464 ms 6 /src/Adapter/EntityMapper.php:79
3584
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 197 AND `id_shop` = 1
0.464 ms 6 /src/Adapter/EntityMapper.php:79
2755
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2808
0.463 ms 1 /classes/Product.php:2902
2875
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3949
0.463 ms 1 /classes/Product.php:2902
3326
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 9749
ORDER BY `position`
0.463 ms 1 Yes /classes/Product.php:3545
829
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `hgt78_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 89 LIMIT 1
0.461 ms 1 /classes/Category.php:1378
2468
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 9774)
0.461 ms 1 /classes/Product.php:3860
2564
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 9821 LIMIT 1
0.461 ms 10 /classes/SpecificPrice.php:435
3533
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 37 AND `id_shop` = 1
0.461 ms 6 /src/Adapter/EntityMapper.php:79
1749
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 5076
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.461 ms 0 /classes/SpecificPrice.php:259
725
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3950) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.460 ms 1 /classes/stock/StockAvailable.php:453
1579
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4507 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4507 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.459 ms 0 /classes/Cart.php:1430
1703
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 200 LIMIT 1
0.459 ms 1 /classes/Product.php:5659
2089
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 5640
AND image_shop.`cover` = 1 LIMIT 1
0.459 ms 1 /classes/Product.php:3570
2424
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 9769)
0.459 ms 1 /classes/Product.php:3860
3024
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 9521
ORDER BY `position`
0.459 ms 1 Yes /classes/Product.php:3545
3451
SELECT SQL_NO_CACHE `width`, `height`
FROM hgt78_image_type
WHERE `name` = 'small_default' LIMIT 1
0.459 ms 1 /classes/Image.php:563
3459
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 55 AND `id_shop` = 1
0.459 ms 6 /src/Adapter/EntityMapper.php:79
924
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3986 AND `id_group` = 1 LIMIT 1
0.458 ms 0 /classes/GroupReduction.php:156
3125
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4583
ORDER BY `position`
0.458 ms 2 Yes /classes/Product.php:3545
3576
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 82 AND `id_shop` = 1
0.458 ms 6 /src/Adapter/EntityMapper.php:79
831
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4947 LIMIT 1
0.457 ms 11 /classes/SpecificPrice.php:435
1073
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 78 LIMIT 1
0.457 ms 1 /classes/Product.php:5659
1298
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4005)
0.457 ms 1 /classes/Product.php:3860
1602
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4540
ORDER BY f.position ASC
0.457 ms 5 Yes /classes/Product.php:6021
1855
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 5167
ORDER BY f.position ASC
0.457 ms 5 Yes /classes/Product.php:6021
2149
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 6024)
0.457 ms 1 /classes/Product.php:3860
676
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3945
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.456 ms 0 /classes/SpecificPrice.php:259
820
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4856
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.456 ms 0 /classes/SpecificPrice.php:259
3099
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4491
0.456 ms 1 /classes/Product.php:2902
3575
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 82) LIMIT 1
0.456 ms 1 /src/Adapter/EntityMapper.php:71
2067
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 5328
AND image_shop.`cover` = 1 LIMIT 1
0.456 ms 1 /classes/Product.php:3570
2451
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 9772
ORDER BY f.position ASC
0.456 ms 5 Yes /classes/Product.php:6021
3329
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 9751
ORDER BY `position`
0.456 ms 1 Yes /classes/Product.php:3545
823
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4856 AND id_shop=1 LIMIT 1
0.455 ms 1 /classes/Product.php:6876
870
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 5106) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.455 ms 1 /classes/stock/StockAvailable.php:453
2574
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 200 LIMIT 1
0.455 ms 1 /classes/Product.php:5659
2718
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3799
ORDER BY `position`
0.455 ms 1 Yes /classes/Product.php:3545
3603
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 42) LIMIT 1
0.455 ms 1 /src/Adapter/EntityMapper.php:71
1309
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 10236)
0.455 ms 1 /classes/Product.php:3860
1543
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4491 AND id_shop=1 LIMIT 1
0.455 ms 1 /classes/Product.php:6876
2268
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 9264
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.455 ms 0 /classes/SpecificPrice.php:259
1547
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4491
ORDER BY f.position ASC
0.454 ms 5 Yes /classes/Product.php:6021
360
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2836) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.454 ms 1 /classes/stock/StockAvailable.php:453
536
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3236 AND `id_group` = 1 LIMIT 1
0.454 ms 0 /classes/GroupReduction.php:156
1476
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4236)
0.453 ms 1 /classes/Product.php:3860
1663
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4699)
0.452 ms 1 /classes/Product.php:3860
2312
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 9743
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.452 ms 0 /classes/SpecificPrice.php:259
170
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2415
AND image_shop.`cover` = 1 LIMIT 1
0.452 ms 1 /classes/Product.php:3570
1107
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 6102 LIMIT 1
0.451 ms 10 /classes/SpecificPrice.php:435
2295
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 9723) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.451 ms 1 /classes/stock/StockAvailable.php:453
106
SELECT SQL_NO_CACHE DISTINCT a.`id_attribute`, a.`color`, al.`name`, agl.`id_attribute_group`, IF(lialv.`url_name` IS NULL OR lialv.`url_name` = "", NULL, lialv.`url_name`) AS url_name, IF(lialv.`meta_title` IS NULL OR lialv.`meta_title` = "", NULL, lialv.`meta_title`) AS meta_title FROM `hgt78_attribute_group` ag INNER JOIN `hgt78_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1) INNER JOIN `hgt78_attribute` a ON a.`id_attribute_group` = ag.`id_attribute_group` INNER JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1) INNER JOIN hgt78_attribute_group_shop attribute_group_shop
ON (attribute_group_shop.id_attribute_group = ag.id_attribute_group AND attribute_group_shop.id_shop = 1)  INNER JOIN hgt78_attribute_shop attribute_shop
ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1) LEFT JOIN `hgt78_layered_indexable_attribute_lang_value` lialv ON (a.`id_attribute` = lialv.`id_attribute` AND lialv.`id_lang` = 1) WHERE ag.id_attribute_group = 3 ORDER BY agl.`name` ASC, a.`position` ASC
0.451 ms 0 /modules/ps_facetedsearch/src/Filters/DataAccessor.php:96
1512
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4241) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.451 ms 1 /classes/stock/StockAvailable.php:453
1557
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4492 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4492 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.451 ms 0 /classes/Cart.php:1430
397
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `hgt78_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 45 LIMIT 1
0.450 ms 1 /classes/Category.php:1378
1416
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4032
AND image_shop.`cover` = 1 LIMIT 1
0.450 ms 1 /classes/Product.php:3570
1531
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4490)
0.450 ms 1 /classes/Product.php:3860
3405
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 9848
0.450 ms 1 /classes/Product.php:2902
1737
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4989 LIMIT 1
0.449 ms 10 /classes/SpecificPrice.php:435
3360
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 9789
0.449 ms 1 /classes/Product.php:2902
911
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 5415)
0.448 ms 1 /classes/Product.php:3860
837
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4947) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.448 ms 1 /classes/stock/StockAvailable.php:453
1034
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3992 AND id_shop=1 LIMIT 1
0.448 ms 1 /classes/Product.php:6876
2303
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 9742)
0.448 ms 1 /classes/Product.php:3860
1025
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 6054) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.447 ms 1 /classes/stock/StockAvailable.php:453
1234
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4002 AND `id_group` = 1 LIMIT 1
0.447 ms 0 /classes/GroupReduction.php:156
2056
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 5101
AND image_shop.`cover` = 1 LIMIT 1
0.447 ms 1 /classes/Product.php:3570
2950
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3989
0.447 ms 1 /classes/Product.php:2902
992
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3989) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.446 ms 1 /classes/stock/StockAvailable.php:453
1119
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3996
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.446 ms 0 /classes/SpecificPrice.php:259
1945
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3980
AND image_shop.`cover` = 1 LIMIT 1
0.446 ms 1 /classes/Product.php:3570
3579
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 145) LIMIT 1
0.446 ms 1 /src/Adapter/EntityMapper.php:71
3866
SELECT SQL_NO_CACHE `id_module` FROM `hgt78_module` WHERE `name` = "iqitlinksmanager" LIMIT 1
0.446 ms 1 /classes/module/Module.php:2664
469
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3011 AND id_shop=1 LIMIT 1
0.446 ms 1 /classes/Product.php:6876
1682
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4701 LIMIT 1
0.445 ms 10 /classes/SpecificPrice.php:435
2045
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 5085
AND image_shop.`cover` = 1 LIMIT 1
0.445 ms 1 /classes/Product.php:3570
2612
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 9844 AND id_shop=1 LIMIT 1
0.445 ms 1 /classes/Product.php:6876
243
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2504)
0.445 ms 1 /classes/Product.php:3860
802
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4298) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.445 ms 1 /classes/stock/StockAvailable.php:453
1050
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3993
AND image_shop.`cover` = 1 LIMIT 1
0.445 ms 1 /classes/Product.php:3570
2989
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 6120
0.445 ms 1 /classes/Product.php:2902
883
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 5113
ORDER BY f.position ASC
0.444 ms 5 Yes /classes/Product.php:6021
1343
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4017 AND id_shop=1 LIMIT 1
0.444 ms 1 /classes/Product.php:6876
546
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3257 AND id_shop=1 LIMIT 1
0.444 ms 1 /classes/Product.php:6876
1074
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3994 LIMIT 1
0.444 ms 10 /classes/SpecificPrice.php:435
1112
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 6102 AND `id_group` = 1 LIMIT 1
0.444 ms 0 /classes/GroupReduction.php:156
1133
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 6120 AND id_shop=1 LIMIT 1
0.444 ms 1 /classes/Product.php:6876
1293
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4005
AND image_shop.`cover` = 1 LIMIT 1
0.444 ms 1 /classes/Product.php:3570
1482
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4238
AND image_shop.`cover` = 1 LIMIT 1
0.444 ms 1 /classes/Product.php:3570
2898
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4298
ORDER BY `position`
0.444 ms 1 Yes /classes/Product.php:3545
3033
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4005
ORDER BY `position`
0.444 ms 1 Yes /classes/Product.php:3545
374
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2898
AND image_shop.`cover` = 1 LIMIT 1
0.443 ms 1 /classes/Product.php:3570
1926
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3978
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.443 ms 0 /classes/SpecificPrice.php:259
3177
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 5165
0.443 ms 1 /classes/Product.php:2902
3548
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 260) LIMIT 1
0.443 ms 1 /src/Adapter/EntityMapper.php:71
955
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 5509)
0.442 ms 1 /classes/Product.php:3860
2300
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 9742 LIMIT 1
0.442 ms 11 /classes/SpecificPrice.php:435
2887
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3802
0.442 ms 1 /classes/Product.php:2902
1674
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4700)
0.441 ms 1 /classes/Product.php:3860
2724
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3796
ORDER BY `position`
0.441 ms 1 Yes /classes/Product.php:3545
1647
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4698
AND image_shop.`cover` = 1 LIMIT 1
0.441 ms 1 /classes/Product.php:3570
1329
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4016
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.440 ms 0 /classes/SpecificPrice.php:259
2254
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 8970
AND image_shop.`cover` = 1 LIMIT 1
0.440 ms 4 /classes/Product.php:3570
307
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2890
AND image_shop.`cover` = 1 LIMIT 1
0.440 ms 1 /classes/Product.php:3570
2462
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 9773
ORDER BY f.position ASC
0.440 ms 5 Yes /classes/Product.php:6021
2127
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 6018)
0.439 ms 1 /classes/Product.php:3860
2446
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 9772)
0.439 ms 1 /classes/Product.php:3860
3350
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 9773
ORDER BY `position`
0.439 ms 1 Yes /classes/Product.php:3545
101
SELECT SQL_NO_CACHE m.*, ml.`description`, ml.`short_description`
FROM `hgt78_manufacturer` m INNER JOIN hgt78_manufacturer_shop manufacturer_shop
ON (manufacturer_shop.id_manufacturer = m.id_manufacturer AND manufacturer_shop.id_shop = 1)INNER JOIN `hgt78_manufacturer_lang` ml ON (m.`id_manufacturer` = ml.`id_manufacturer` AND ml.`id_lang` = 1)WHERE 1 AND m.`active` = 1 ORDER BY m.`name` ASC
0.438 ms 4 Yes /classes/Manufacturer.php:211
1168
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3999) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.438 ms 1 /classes/stock/StockAvailable.php:453
1252
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4003
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.438 ms 0 /classes/SpecificPrice.php:259
3239
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5101
ORDER BY `position`
0.438 ms 1 Yes /classes/Product.php:3545
446
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3010)
0.437 ms 1 /classes/Product.php:3860
989
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3989)
0.437 ms 1 /classes/Product.php:3860
1812
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 5164
AND image_shop.`cover` = 1 LIMIT 1
0.437 ms 1 /classes/Product.php:3570
1972
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3982)
0.437 ms 1 /classes/Product.php:3860
3341
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 9769
ORDER BY `position`
0.437 ms 1 Yes /classes/Product.php:3545
1194
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `hgt78_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 100 LIMIT 1
0.436 ms 1 /classes/Category.php:1378
1196
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 8356 LIMIT 1
0.436 ms 10 /classes/SpecificPrice.php:435
2283
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 9721 AND `id_group` = 1 LIMIT 1
0.436 ms 0 /classes/GroupReduction.php:156
1079
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3994 AND `id_group` = 1 LIMIT 1
0.436 ms 0 /classes/GroupReduction.php:156
2711
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 10738)
0.436 ms 1 /classes/Product.php:3860
379
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2898)
0.435 ms 1 /classes/Product.php:3860
708
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3949 LIMIT 1
0.435 ms 10 /classes/SpecificPrice.php:435
1045
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 6099 AND id_shop=1 LIMIT 1
0.435 ms 1 /classes/Product.php:6876
1130
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 6120
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.435 ms 0 /classes/SpecificPrice.php:259
1568
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4506 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4506 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.435 ms 0 /classes/Cart.php:1430
1669
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4700
AND image_shop.`cover` = 1 LIMIT 1
0.435 ms 1 /classes/Product.php:3570
3344
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 9771
ORDER BY `position`
0.435 ms 1 Yes /classes/Product.php:3545
2479
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 9788)
0.434 ms 1 /classes/Product.php:3860
1067
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 6100 AND id_shop=1 LIMIT 1
0.434 ms 1 /classes/Product.php:6876
1758
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 46 LIMIT 1
0.434 ms 1 /classes/Product.php:5659
1979
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 34 LIMIT 1
0.434 ms 1 /classes/Product.php:5659
2166
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 6105
AND image_shop.`cover` = 1 LIMIT 1
0.434 ms 1 /classes/Product.php:3570
2209
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 8429
ORDER BY f.position ASC
0.434 ms 5 Yes /classes/Product.php:6021
2545
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 9819)
0.434 ms 1 /classes/Product.php:3860
515
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3235) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.433 ms 1 /classes/stock/StockAvailable.php:453
786
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4297
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.433 ms 0 /classes/SpecificPrice.php:259
1122
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3996 AND id_shop=1 LIMIT 1
0.433 ms 1 /classes/Product.php:6876
1376
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4021)
0.433 ms 1 /classes/Product.php:3860
1583
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4508 LIMIT 1
0.433 ms 10 /classes/SpecificPrice.php:435
1956
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3981
AND image_shop.`cover` = 1 LIMIT 1
0.433 ms 1 /classes/Product.php:3570
223
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2448 AND `id_group` = 1 LIMIT 1
0.432 ms 0 /classes/GroupReduction.php:156
623
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3790 AND id_shop=1 LIMIT 1
0.432 ms 1 /classes/Product.php:6876
2080
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 5352 LIMIT 1
0.432 ms 10 /classes/SpecificPrice.php:435
2259
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 8970)
0.432 ms 1 /classes/Product.php:3860
2935
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 5418
0.432 ms 1 /classes/Product.php:2902
3141
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4702
0.432 ms 1 /classes/Product.php:2902
3347
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 9772
ORDER BY `position`
0.432 ms 1 Yes /classes/Product.php:3545
3574
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 81 AND `id_shop` = 1
0.432 ms 6 /src/Adapter/EntityMapper.php:79
429
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2945
ORDER BY f.position ASC
0.431 ms 5 Yes /classes/Product.php:6021
1211
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4001 AND id_shop=1 LIMIT 1
0.431 ms 1 /classes/Product.php:6876
1471
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4236
AND image_shop.`cover` = 1 LIMIT 1
0.431 ms 1 /classes/Product.php:3570
3525
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 56 AND `id_shop` = 1
0.431 ms 6 /src/Adapter/EntityMapper.php:79
3562
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 307) LIMIT 1
0.431 ms 1 /src/Adapter/EntityMapper.php:71
1202
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 8356) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.431 ms 1 /classes/stock/StockAvailable.php:453
983
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 5510
ORDER BY f.position ASC
0.430 ms 5 Yes /classes/Product.php:6021
1322
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 10932 AND `id_group` = 1 LIMIT 1
0.430 ms 0 /classes/GroupReduction.php:156
2364
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 9749
AND image_shop.`cover` = 1 LIMIT 1
0.430 ms 1 /classes/Product.php:3570
565
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3497
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.430 ms 0 /classes/SpecificPrice.php:259
1741
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4989 AND id_shop=1 LIMIT 1
0.430 ms 1 /classes/Product.php:6876
2331
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 9745
AND image_shop.`cover` = 1 LIMIT 1
0.430 ms 1 /classes/Product.php:3570
2496
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 9790
AND image_shop.`cover` = 1 LIMIT 1
0.430 ms 1 /classes/Product.php:3570
1692
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 200 LIMIT 1
0.429 ms 1 /classes/Product.php:5659
2575
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 9830 LIMIT 1
0.429 ms 11 /classes/SpecificPrice.php:435
1608
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4541)
0.429 ms 1 /classes/Product.php:3860
2188
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 6135
AND image_shop.`cover` = 1 LIMIT 1
0.429 ms 1 /classes/Product.php:3570
1161
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 78 LIMIT 1
0.428 ms 1 /classes/Product.php:5659
1405
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4030
AND image_shop.`cover` = 1 LIMIT 1
0.428 ms 1 /classes/Product.php:3570
895
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3985
AND image_shop.`cover` = 1 LIMIT 1
0.428 ms 1 /classes/Product.php:3570
965
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3988
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.428 ms 0 /classes/SpecificPrice.php:259
1775
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 5080 AND `id_group` = 1 LIMIT 1
0.428 ms 0 /classes/GroupReduction.php:156
2661
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 9849
AND image_shop.`cover` = 1 LIMIT 1
0.428 ms 1 /classes/Product.php:3570
149
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 44 LIMIT 1
0.427 ms 1 /classes/Product.php:5659
232
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2513)
0.427 ms 1 /classes/Product.php:3860
490
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3028)
0.427 ms 1 /classes/Product.php:3860
1166
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3999 AND id_shop=1 LIMIT 1
0.427 ms 1 /classes/Product.php:6876
1174
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3018
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.427 ms 0 /classes/SpecificPrice.php:259
1781
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 5102 LIMIT 1
0.427 ms 10 /classes/SpecificPrice.php:435
2407
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 9767
ORDER BY f.position ASC
0.427 ms 5 Yes /classes/Product.php:6021
2824
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3242
0.427 ms 1 /classes/Product.php:2902
3402
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 9847
0.427 ms 1 /classes/Product.php:2902
3571
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 65) LIMIT 1
0.427 ms 1 /src/Adapter/EntityMapper.php:71
3609
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 77) LIMIT 1
0.427 ms 1 /src/Adapter/EntityMapper.php:71
1011
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 6053)
0.426 ms 1 /classes/Product.php:3860
1111
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 6102 AND id_shop=1 LIMIT 1
0.426 ms 1 /classes/Product.php:6876
513
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3235 AND id_shop=1 LIMIT 1
0.426 ms 1 /classes/Product.php:6876
150
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3796 LIMIT 1
0.425 ms 2 /classes/SpecificPrice.php:435
2144
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 6024
AND image_shop.`cover` = 1 LIMIT 1
0.425 ms 1 /classes/Product.php:3570
2869
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3946
0.425 ms 1 /classes/Product.php:2902
3462
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 165) LIMIT 1
0.425 ms 1 /src/Adapter/EntityMapper.php:71
2353
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 9747
AND image_shop.`cover` = 1 LIMIT 1
0.425 ms 1 /classes/Product.php:3570
530
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 200 LIMIT 1
0.424 ms 1 /classes/Product.php:5659
1206
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 78 LIMIT 1
0.424 ms 1 /classes/Product.php:5659
1379
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4021) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.424 ms 1 /classes/stock/StockAvailable.php:453
789
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4297 AND id_shop=1 LIMIT 1
0.424 ms 1 /classes/Product.php:6876
859
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 5075) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.424 ms 1 /classes/stock/StockAvailable.php:453
274
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 44 LIMIT 1
0.423 ms 1 /classes/Product.php:5659
1716
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4704
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.423 ms 0 /classes/SpecificPrice.php:259
606
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3788
AND image_shop.`cover` = 1 LIMIT 1
0.422 ms 1 /classes/Product.php:3570
1069
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 6100) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.422 ms 1 /classes/stock/StockAvailable.php:453
1282
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 10235
AND image_shop.`cover` = 1 LIMIT 1
0.422 ms 1 /classes/Product.php:3570
3865
SELECT SQL_NO_CACHE c.*, cl.*  FROM `hgt78_category` c
LEFT JOIN `hgt78_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`nleft` <= 2 AND c.`nright` >= 577 AND c.`nleft` >= 1 AND c.`nright` <= 590 ORDER BY `nleft` DESC
0.422 ms 2 /classes/Category.php:1600
905
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3985
ORDER BY f.position ASC
0.421 ms 5 Yes /classes/Product.php:6021
3572
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 65 AND `id_shop` = 1
0.421 ms 6 /src/Adapter/EntityMapper.php:79
625
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3790) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.420 ms 1 /classes/stock/StockAvailable.php:453
1817
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 5164)
0.420 ms 1 /classes/Product.php:3860
2418
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 9768
ORDER BY f.position ASC
0.420 ms 5 Yes /classes/Product.php:6021
2655
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 9848)
0.420 ms 1 /classes/Product.php:3860
301
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2601)
0.419 ms 1 /classes/Product.php:3860
981
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 5510) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.419 ms 1 /classes/stock/StockAvailable.php:453
1658
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4699
AND image_shop.`cover` = 1 LIMIT 1
0.419 ms 1 /classes/Product.php:3570
2075
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 5328) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.419 ms 1 /classes/stock/StockAvailable.php:453
3128
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4698
ORDER BY `position`
0.419 ms 1 Yes /classes/Product.php:3545
2155
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 6025
AND image_shop.`cover` = 1 LIMIT 1
0.418 ms 1 /classes/Product.php:3570
1006
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 6053
AND image_shop.`cover` = 1 LIMIT 1
0.418 ms 1 /classes/Product.php:3570
2337
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 9745 AND id_shop=1 LIMIT 1
0.418 ms 1 /classes/Product.php:6876
2174
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 6105) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.417 ms 1 /classes/stock/StockAvailable.php:453
2435
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 9771)
0.417 ms 1 /classes/Product.php:3860
2497
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 200 LIMIT 1
0.417 ms 1 /classes/Product.php:5659
2893
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3803
0.417 ms 1 /classes/Product.php:2902
289
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2889)
0.416 ms 1 /classes/Product.php:3860
556
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3258)
0.416 ms 1 /classes/Product.php:3860
1680
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4701
AND image_shop.`cover` = 1 LIMIT 1
0.416 ms 1 /classes/Product.php:3570
3549
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 260 AND `id_shop` = 1
0.416 ms 6 /src/Adapter/EntityMapper.php:79
476
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3200 LIMIT 1
0.415 ms 10 /classes/SpecificPrice.php:435
1603
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4541
AND image_shop.`cover` = 1 LIMIT 1
0.415 ms 1 /classes/Product.php:3570
2699
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 9852)
0.415 ms 1 /classes/Product.php:3860
3219
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3983
0.415 ms 1 /classes/Product.php:2902
3285
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 8947
0.415 ms 1 /classes/Product.php:2902
3561
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 266 AND `id_shop` = 1
0.415 ms 6 /src/Adapter/EntityMapper.php:79
2890
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3952
0.414 ms 1 /classes/Product.php:2902
2986
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3996
0.414 ms 1 /classes/Product.php:2902
287
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2889
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.414 ms 1 /classes/SpecificPrice.php:259
1315
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 10932
AND image_shop.`cover` = 1 LIMIT 1
0.414 ms 1 /classes/Product.php:3570
1906
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4488)
0.413 ms 1 /classes/Product.php:3860
2381
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 9751 AND id_shop=1 LIMIT 1
0.413 ms 1 /classes/Product.php:6876
1802
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 200 LIMIT 1
0.412 ms 1 /classes/Product.php:5659
2003
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2930 LIMIT 1
0.412 ms 10 /classes/SpecificPrice.php:435
2579
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 9830 AND id_shop=1 LIMIT 1
0.412 ms 1 /classes/Product.php:6876
3012
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 8357
ORDER BY `position`
0.412 ms 2 Yes /classes/Product.php:3545
695
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3947
AND image_shop.`cover` = 1 LIMIT 1
0.411 ms 1 /classes/Product.php:3570
1515
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4413
AND image_shop.`cover` = 1 LIMIT 1
0.411 ms 1 /classes/Product.php:3570
2377
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 9751 LIMIT 1
0.411 ms 11 /classes/SpecificPrice.php:435
1981
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3983
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.411 ms 0 /classes/SpecificPrice.php:259
2501
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 9790)
0.410 ms 1 /classes/Product.php:3860
3315
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 9745
0.410 ms 1 /classes/Product.php:2902
3445
SELECT SQL_NO_CACHE `id_module` FROM `hgt78_module` WHERE `name` = "iqitsearch" LIMIT 1
0.410 ms 1 /classes/module/Module.php:2664
3144
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4703
0.410 ms 1 /classes/Product.php:2902
2764
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2601
0.409 ms 1 /classes/Product.php:2902
3096
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4490
0.409 ms 1 /classes/Product.php:2902
1592
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4540
AND image_shop.`cover` = 1 LIMIT 1
0.408 ms 1 /classes/Product.php:3570
2860
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3943
0.408 ms 1 /classes/Product.php:2902
3040
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 10932
0.408 ms 1 /classes/Product.php:2902
629
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 44 LIMIT 1
0.407 ms 1 /classes/Product.php:5659
830
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 89 LIMIT 1
0.407 ms 1 /classes/Product.php:5659
2490
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 9789)
0.407 ms 1 /classes/Product.php:3860
950
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 5509
AND image_shop.`cover` = 1 LIMIT 1
0.406 ms 1 /classes/Product.php:3570
1228
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 78 LIMIT 1
0.406 ms 1 /classes/Product.php:5659
1413
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4030) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.406 ms 1 /classes/stock/StockAvailable.php:453
2358
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 9747)
0.406 ms 1 /classes/Product.php:3860
2235
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 8948
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.405 ms 0 /classes/SpecificPrice.php:259
2606
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 9844
AND image_shop.`cover` = 1 LIMIT 1
0.405 ms 1 /classes/Product.php:3570
3437
SELECT SQL_NO_CACHE `id_module` FROM `hgt78_module` WHERE `name` = "ps_languageselector" LIMIT 1
0.405 ms 1 /classes/module/Module.php:2664
2739
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2502
ORDER BY `position`
0.404 ms 1 Yes /classes/Product.php:3545
3055
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4021
0.404 ms 1 /classes/Product.php:2902
972
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3988
ORDER BY f.position ASC
0.403 ms 5 Yes /classes/Product.php:6021
2863
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3944
0.403 ms 1 /classes/Product.php:2902
1792
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 5103 LIMIT 1
0.403 ms 10 /classes/SpecificPrice.php:435
3242
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5328
ORDER BY `position`
0.402 ms 1 Yes /classes/Product.php:3545
3257
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 6018
ORDER BY `position`
0.402 ms 1 Yes /classes/Product.php:3545
641
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3942 LIMIT 1
0.401 ms 10 /classes/SpecificPrice.php:435
707
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 199 LIMIT 1
0.401 ms 1 /classes/Product.php:5659
1934
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3979
AND image_shop.`cover` = 1 LIMIT 1
0.401 ms 1 /classes/Product.php:3570
1970
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3982
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.401 ms 0 /classes/SpecificPrice.php:259
3604
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 42 AND `id_shop` = 1
0.401 ms 6 /src/Adapter/EntityMapper.php:79
941
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3987 LIMIT 1
0.401 ms 10 /classes/SpecificPrice.php:435
2402
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 9767)
0.401 ms 1 /classes/Product.php:3860
551
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3258
AND image_shop.`cover` = 1 LIMIT 1
0.400 ms 1 /classes/Product.php:3570
2237
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 8948)
0.400 ms 1 /classes/Product.php:3860
2962
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3992
0.400 ms 1 /classes/Product.php:2902
3383
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 9830
ORDER BY `position`
0.400 ms 1 Yes /classes/Product.php:3545
262
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `hgt78_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 70 LIMIT 1
0.400 ms 1 /classes/Category.php:1378
1047
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 6099) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.400 ms 1 /classes/stock/StockAvailable.php:453
2290
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 9723
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.400 ms 0 /classes/SpecificPrice.php:259
1156
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3998 AND `id_group` = 1 LIMIT 1
0.399 ms 0 /classes/GroupReduction.php:156
2901
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4299
ORDER BY `position`
0.399 ms 1 Yes /classes/Product.php:3545
3015
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4002
ORDER BY `position`
0.399 ms 1 Yes /classes/Product.php:3545
475
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 200 LIMIT 1
0.399 ms 1 /classes/Product.php:5659
3623
SELECT SQL_NO_CACHE `width`, `height`
FROM hgt78_image_type
WHERE `name` = 'home_default' LIMIT 1
0.398 ms 1 /classes/Image.php:563
1276
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4004)
0.398 ms 1 /classes/Product.php:3860
1878
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 5638
AND image_shop.`cover` = 1 LIMIT 1
0.398 ms 1 /classes/Product.php:3570
3879
SELECT SQL_NO_CACHE psgdpr.active FROM `hgt78_psgdpr_consent` psgdpr
WHERE psgdpr.id_module = 22 LIMIT 1
0.398 ms 12 /modules/psgdpr/classes/GDPRConsent.php:132
3018
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 8637
ORDER BY `position`
0.397 ms 1 Yes /classes/Product.php:3545
2815
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3028
0.397 ms 1 /classes/Product.php:2902
2923
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 5373
0.397 ms 1 /classes/Product.php:2902
3563
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 307 AND `id_shop` = 1
0.397 ms 6 /src/Adapter/EntityMapper.php:79
684
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3946
AND image_shop.`cover` = 1 LIMIT 1
0.396 ms 1 /classes/Product.php:3570
797
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4298
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.396 ms 0 /classes/SpecificPrice.php:259
1465
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4036)
0.396 ms 1 /classes/Product.php:3860
3066
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4032
0.396 ms 1 /classes/Product.php:2902
69
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a0
LEFT JOIN `hgt78_category_lang` `a1` ON (a0.`id_category` = a1.`id_category`)
WHERE (a0.`nleft` < 2) AND (a0.`nright` > 577) AND (a1.`id_lang` = 1) AND (a1.`id_shop` = 1)
ORDER BY a0.`nleft` asc
0.396 ms 1 /classes/PrestaShopCollection.php:383
2748
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2504
ORDER BY `position`
0.396 ms 1 Yes /classes/Product.php:3545
3260
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 6023
ORDER BY `position`
0.396 ms 1 Yes /classes/Product.php:3545
1306
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 10236 LIMIT 1
0.395 ms 10 /classes/SpecificPrice.php:435
2020
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4027) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.395 ms 1 /classes/stock/StockAvailable.php:453
2272
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 9264 AND `id_group` = 1 LIMIT 1
0.395 ms 0 /classes/GroupReduction.php:156
3254
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5642
ORDER BY `position`
0.395 ms 1 Yes /classes/Product.php:3545
3434
SELECT SQL_NO_CACHE `id_module` FROM `hgt78_module` WHERE `name` = "iqithtmlandbanners" LIMIT 1
0.395 ms 1 /classes/module/Module.php:2664
3438
SELECT SQL_NO_CACHE `id_module` FROM `hgt78_module_shop` WHERE `id_module` = 27 AND `id_shop` = 1 LIMIT 1
0.395 ms 1 /classes/module/Module.php:2137
184
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2475 LIMIT 1
0.394 ms 10 /classes/SpecificPrice.php:435
635
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3791 AND `id_group` = 1 LIMIT 1
0.394 ms 0 /classes/GroupReduction.php:156
1923
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3978
AND image_shop.`cover` = 1 LIMIT 1
0.394 ms 1 /classes/Product.php:3570
2265
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 9264
AND image_shop.`cover` = 1 LIMIT 1
0.394 ms 1 /classes/Product.php:3570
2688
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 9851)
0.392 ms 1 /classes/Product.php:3860
2758
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2600
0.392 ms 1 /classes/Product.php:2902
578
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3499)
0.392 ms 1 /classes/Product.php:3860
2226
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 8947)
0.392 ms 1 /classes/Product.php:3860
2938
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3987
0.392 ms 1 /classes/Product.php:2902
3880
SELECT SQL_NO_CACHE psgdprl.message FROM `hgt78_psgdpr_consent` psgdpr
LEFT JOIN hgt78_psgdpr_consent_lang psgdprl ON (psgdpr.id_gdpr_consent = psgdprl.id_gdpr_consent)
WHERE psgdpr.id_module = 22 AND psgdprl.id_lang =1 LIMIT 1
0.392 ms 12 /modules/psgdpr/classes/GDPRConsent.php:111
154
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3796 AND id_shop=1 LIMIT 1
0.391 ms 1 /classes/Product.php:6876
1911
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4488
ORDER BY f.position ASC
0.391 ms 5 Yes /classes/Product.php:6021
2299
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 54 LIMIT 1
0.391 ms 1 /classes/Product.php:5659
2585
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 200 LIMIT 1
0.391 ms 1 /classes/Product.php:5659
652
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3943 LIMIT 1
0.390 ms 10 /classes/SpecificPrice.php:435
762
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 199 LIMIT 1
0.390 ms 1 /classes/Product.php:5659
2383
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 9751) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.390 ms 1 /classes/stock/StockAvailable.php:453
1017
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 6054
AND image_shop.`cover` = 1 LIMIT 1
0.390 ms 1 /classes/Product.php:3570
2576
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 9830
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.390 ms 0 /classes/SpecificPrice.php:259
3049
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4018
0.390 ms 1 /classes/Product.php:2902
3207
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3979
0.390 ms 1 /classes/Product.php:2902
3601
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 36) LIMIT 1
0.390 ms 1 /src/Adapter/EntityMapper.php:71
161
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3795 LIMIT 1
0.389 ms 10 /classes/SpecificPrice.php:435
477
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3200
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.389 ms 0 /classes/SpecificPrice.php:259
730
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3801 LIMIT 1
0.389 ms 11 /classes/SpecificPrice.php:435
3234
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 5083
0.389 ms 1 /classes/Product.php:2902
219
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2448
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.389 ms 0 /classes/SpecificPrice.php:259
1986
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3983) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.389 ms 1 /classes/stock/StockAvailable.php:453
2327
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 9744 AND `id_group` = 1 LIMIT 1
0.389 ms 0 /classes/GroupReduction.php:156
2956
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 6053
0.389 ms 1 /classes/Product.php:2902
1589
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4508) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.388 ms 1 /classes/stock/StockAvailable.php:453
668
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3944 AND id_shop=1 LIMIT 1
0.387 ms 1 /classes/Product.php:6876
409
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 45 LIMIT 1
0.386 ms 1 /classes/Product.php:5659
1212
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4001 AND `id_group` = 1 LIMIT 1
0.386 ms 0 /classes/GroupReduction.php:156
2112
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 45 LIMIT 1
0.386 ms 1 /classes/Product.php:5659
3552
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 262) LIMIT 1
0.386 ms 1 /src/Adapter/EntityMapper.php:71
368
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2944)
0.385 ms 1 /classes/Product.php:3860
1991
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3984 LIMIT 1
0.385 ms 10 /classes/SpecificPrice.php:435
3111
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4508
0.385 ms 1 /classes/Product.php:2902
3282
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 8946
0.385 ms 1 /classes/Product.php:2902
790
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4297 AND `id_group` = 1 LIMIT 1
0.385 ms 0 /classes/GroupReduction.php:156
2161
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 6025 AND id_shop=1 LIMIT 1
0.385 ms 1 /classes/Product.php:6876
1355
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4018 AND `id_group` = 1 LIMIT 1
0.384 ms 0 /classes/GroupReduction.php:156
1850
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 5167)
0.384 ms 1 /classes/Product.php:3860
2953
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3990
0.384 ms 1 /classes/Product.php:2902
1063
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 6100 LIMIT 1
0.384 ms 10 /classes/SpecificPrice.php:435
253
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2514
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.383 ms 0 /classes/SpecificPrice.php:259
371
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2944) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.383 ms 1 /classes/stock/StockAvailable.php:453
1177
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3018 AND id_shop=1 LIMIT 1
0.383 ms 1 /classes/Product.php:6876
3060
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4029
0.383 ms 1 /classes/Product.php:2902
3323
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 9747
ORDER BY `position`
0.383 ms 1 Yes /classes/Product.php:3545
935
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 5418 AND `id_group` = 1 LIMIT 1
0.383 ms 0 /classes/GroupReduction.php:156
3043
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4016
0.383 ms 1 /classes/Product.php:2902
3213
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3981
0.382 ms 1 /classes/Product.php:2902
742
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3951
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.382 ms 0 /classes/SpecificPrice.php:259
1301
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4005) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.382 ms 1 /classes/stock/StockAvailable.php:453
520
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3242 LIMIT 1
0.381 ms 10 /classes/SpecificPrice.php:435
1091
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 6101) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.381 ms 1 /classes/stock/StockAvailable.php:453
1969
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3982 LIMIT 1
0.381 ms 10 /classes/SpecificPrice.php:435
2430
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 9771
AND image_shop.`cover` = 1 LIMIT 1
0.381 ms 1 /classes/Product.php:3570
2625
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 9845) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.381 ms 1 /classes/stock/StockAvailable.php:453
3356
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 9788
ORDER BY `position`
0.381 ms 1 Yes /classes/Product.php:3545
3527
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 192 AND `id_shop` = 1
0.381 ms 6 /src/Adapter/EntityMapper.php:79
813
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4299) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.380 ms 1 /classes/stock/StockAvailable.php:453
1780
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 200 LIMIT 1
0.380 ms 1 /classes/Product.php:5659
1975
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3982) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.380 ms 1 /classes/stock/StockAvailable.php:453
3470
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 50) LIMIT 1
0.380 ms 1 /src/Adapter/EntityMapper.php:71
1997
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3984) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.379 ms 1 /classes/stock/StockAvailable.php:453
2628
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 9846
AND image_shop.`cover` = 1 LIMIT 1
0.379 ms 1 /classes/Product.php:3570
2657
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 9848 AND `id_group` = 1 LIMIT 1
0.379 ms 0 /classes/GroupReduction.php:156
3410
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 9850
ORDER BY `position`
0.379 ms 1 Yes /classes/Product.php:3545
3442
SELECT SQL_NO_CACHE *
FROM `hgt78_currency` a
LEFT JOIN `hgt78_currency_shop` `c` ON a.`id_currency` = c.`id_currency` AND c.`id_shop` = 1
WHERE (a.`id_currency` = 2) LIMIT 1
0.379 ms 1 /src/Adapter/EntityMapper.php:71
1096
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3995 LIMIT 1
0.379 ms 10 /classes/SpecificPrice.php:435
1826
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 5165
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.379 ms 0 /classes/SpecificPrice.php:259
2322
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 9744 LIMIT 1
0.379 ms 11 /classes/SpecificPrice.php:435
172
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2415 LIMIT 1
0.378 ms 10 /classes/SpecificPrice.php:435
258
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2514) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.378 ms 1 /classes/stock/StockAvailable.php:453
2279
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 9721
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.378 ms 0 /classes/SpecificPrice.php:259
3573
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 81) LIMIT 1
0.378 ms 1 /src/Adapter/EntityMapper.php:71
1241
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 8637
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.377 ms 0 /classes/SpecificPrice.php:259
2124
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 6018 LIMIT 1
0.377 ms 10 /classes/SpecificPrice.php:435
2908
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4947
0.377 ms 1 /classes/Product.php:2902
563
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 44 LIMIT 1
0.377 ms 1 /classes/Product.php:5659
1636
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4583
AND image_shop.`cover` = 1 LIMIT 1
0.377 ms 2 /classes/Product.php:3570
1616
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4580 LIMIT 1
0.376 ms 10 /classes/SpecificPrice.php:435
2773
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2835
0.376 ms 1 /classes/Product.php:2902
661
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3944
AND image_shop.`cover` = 1 LIMIT 1
0.376 ms 1 /classes/Product.php:3570
1197
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 8356
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.376 ms 0 /classes/SpecificPrice.php:259
1995
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3984 AND id_shop=1 LIMIT 1
0.376 ms 1 /classes/Product.php:6876
2614
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 9844) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.376 ms 1 /classes/stock/StockAvailable.php:453
1820
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 5164) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.375 ms 1 /classes/stock/StockAvailable.php:453
2562
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 9821
AND image_shop.`cover` = 1 LIMIT 1
0.375 ms 1 /classes/Product.php:3570
2770
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2834
0.375 ms 1 /classes/Product.php:2902
2884
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3951
0.375 ms 1 /classes/Product.php:2902
747
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3951) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.375 ms 1 /classes/stock/StockAvailable.php:453
841
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 44 LIMIT 1
0.374 ms 1 /classes/Product.php:5659
2629
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 200 LIMIT 1
0.374 ms 1 /classes/Product.php:5659
3335
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 9767
ORDER BY `position`
0.374 ms 1 Yes /classes/Product.php:3545
640
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 70 LIMIT 1
0.374 ms 1 /classes/Product.php:5659
2540
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 9819
AND image_shop.`cover` = 1 LIMIT 1
0.374 ms 1 /classes/Product.php:3570
116
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 0 LIMIT 1
0.373 ms 1 /classes/SpecificPrice.php:426
250
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `hgt78_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 56 LIMIT 1
0.373 ms 1 /classes/Category.php:1378
1605
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4541 LIMIT 1
0.373 ms 10 /classes/SpecificPrice.php:435
526
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3242) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.373 ms 1 /classes/stock/StockAvailable.php:453
1108
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 6102
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.373 ms 0 /classes/SpecificPrice.php:259
1615
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 199 LIMIT 1
0.373 ms 1 /classes/Product.php:5659
3046
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4017
0.373 ms 1 /classes/Product.php:2902
2231
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 8947
ORDER BY f.position ASC
0.372 ms 5 Yes /classes/Product.php:6021
2619
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 9845 LIMIT 1
0.372 ms 11 /classes/SpecificPrice.php:435
1432
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4033)
0.372 ms 1 /classes/Product.php:3860
962
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `hgt78_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 78 LIMIT 1
0.371 ms 1 /classes/Category.php:1378
1053
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3993
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.371 ms 0 /classes/SpecificPrice.php:259
1138
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3997
AND image_shop.`cover` = 1 LIMIT 1
0.371 ms 1 /classes/Product.php:3570
1834
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 5166
AND image_shop.`cover` = 1 LIMIT 1
0.371 ms 1 /classes/Product.php:3570
1980
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3983 LIMIT 1
0.371 ms 10 /classes/SpecificPrice.php:435
2034
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 5083
AND image_shop.`cover` = 1 LIMIT 1
0.371 ms 1 /classes/Product.php:3570
767
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3952 AND id_shop=1 LIMIT 1
0.370 ms 1 /classes/Product.php:6876
952
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 5509 LIMIT 1
0.370 ms 11 /classes/SpecificPrice.php:435
1422
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4032 AND id_shop=1 LIMIT 1
0.370 ms 1 /classes/Product.php:6876
2009
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2930) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.370 ms 1 /classes/stock/StockAvailable.php:453
2459
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 9773 AND `id_group` = 1 LIMIT 1
0.370 ms 0 /classes/GroupReduction.php:156
108
SELECT SQL_NO_CACHE DISTINCT a.`id_attribute`, a.`color`, al.`name`, agl.`id_attribute_group`, IF(lialv.`url_name` IS NULL OR lialv.`url_name` = "", NULL, lialv.`url_name`) AS url_name, IF(lialv.`meta_title` IS NULL OR lialv.`meta_title` = "", NULL, lialv.`meta_title`) AS meta_title FROM `hgt78_attribute_group` ag INNER JOIN `hgt78_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1) INNER JOIN `hgt78_attribute` a ON a.`id_attribute_group` = ag.`id_attribute_group` INNER JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1) INNER JOIN hgt78_attribute_group_shop attribute_group_shop
ON (attribute_group_shop.id_attribute_group = ag.id_attribute_group AND attribute_group_shop.id_shop = 1)  INNER JOIN hgt78_attribute_shop attribute_shop
ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1) LEFT JOIN `hgt78_layered_indexable_attribute_lang_value` lialv ON (a.`id_attribute` = lialv.`id_attribute` AND lialv.`id_lang` = 1) WHERE ag.id_attribute_group = 4 ORDER BY agl.`name` ASC, a.`position` ASC
0.370 ms 0 /modules/ps_facetedsearch/src/Filters/DataAccessor.php:96
354
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2836 LIMIT 1
0.369 ms 10 /classes/SpecificPrice.php:435
1644
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4583) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.369 ms 1 /classes/stock/StockAvailable.php:453
3279
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 8429
0.369 ms 1 /classes/Product.php:2902
3450
SELECT SQL_NO_CACHE `id_module` FROM `hgt78_module_shop` WHERE `id_module` = 90 AND `id_shop` = 1 LIMIT 1
0.369 ms 1 /classes/module/Module.php:2137
1710
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4703) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.369 ms 1 /classes/stock/StockAvailable.php:453
1782
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 5102
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.369 ms 0 /classes/SpecificPrice.php:259
2103
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 5641
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.369 ms 0 /classes/SpecificPrice.php:259
2441
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 9772
AND image_shop.`cover` = 1 LIMIT 1
0.368 ms 1 /classes/Product.php:3570
2705
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 10738
AND image_shop.`cover` = 1 LIMIT 1
0.368 ms 1 /classes/Product.php:3570
842
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 5074 LIMIT 1
0.368 ms 10 /classes/SpecificPrice.php:435
1106
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 44 LIMIT 1
0.368 ms 1 /classes/Product.php:5659
1178
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3018 AND `id_group` = 1 LIMIT 1
0.368 ms 0 /classes/GroupReduction.php:156
1866
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 5336
ORDER BY f.position ASC
0.368 ms 5 Yes /classes/Product.php:6021
2779
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2836
0.368 ms 1 /classes/Product.php:2902
589
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3520)
0.367 ms 1 /classes/Product.php:3860
858
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 5075 AND `id_group` = 1 LIMIT 1
0.367 ms 0 /classes/GroupReduction.php:156
1318
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 10932
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.367 ms 1 /classes/SpecificPrice.php:259
1581
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4508
AND image_shop.`cover` = 1 LIMIT 1
0.367 ms 1 /classes/Product.php:3570
2355
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 9747 LIMIT 1
0.366 ms 11 /classes/SpecificPrice.php:435
349
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2918) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.366 ms 1 /classes/stock/StockAvailable.php:453
854
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 5075
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.366 ms 0 /classes/SpecificPrice.php:259
1003
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3990) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.366 ms 1 /classes/stock/StockAvailable.php:453
1525
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4413
ORDER BY f.position ASC
0.366 ms 5 Yes /classes/Product.php:6021
2603
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 9843) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.366 ms 1 /classes/stock/StockAvailable.php:453
3063
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4030
0.366 ms 1 /classes/Product.php:2902
3528
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 195) LIMIT 1
0.366 ms 1 /src/Adapter/EntityMapper.php:71
213
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2502) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.365 ms 1 /classes/stock/StockAvailable.php:453
256
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2514 AND id_shop=1 LIMIT 1
0.365 ms 1 /classes/Product.php:6876
900
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3985)
0.365 ms 1 /classes/Product.php:3860
1062
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 44 LIMIT 1
0.365 ms 1 /classes/Product.php:5659
2146
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 6024 LIMIT 1
0.365 ms 10 /classes/SpecificPrice.php:435
420
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 44 LIMIT 1
0.364 ms 1 /classes/Product.php:5659
1747
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 46 LIMIT 1
0.364 ms 1 /classes/Product.php:5659
2168
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 6105 LIMIT 1
0.364 ms 10 /classes/SpecificPrice.php:435
2881
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3801
0.364 ms 1 /classes/Product.php:2902
1558
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4492
ORDER BY f.position ASC
0.363 ms 5 Yes /classes/Product.php:6021
608
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3788 LIMIT 1
0.363 ms 10 /classes/SpecificPrice.php:435
1426
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4032
ORDER BY f.position ASC
0.363 ms 5 Yes /classes/Product.php:6021
681
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3945) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.362 ms 1 /classes/stock/StockAvailable.php:453
2529
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 9794
AND image_shop.`cover` = 1 LIMIT 1
0.362 ms 1 /classes/Product.php:3570
543
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3257
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.362 ms 0 /classes/SpecificPrice.php:259
631
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3791
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.362 ms 0 /classes/SpecificPrice.php:259
647
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3942) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.362 ms 1 /classes/stock/StockAvailable.php:453
869
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 5106 AND `id_group` = 1 LIMIT 1
0.362 ms 0 /classes/GroupReduction.php:156
1468
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4036) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.362 ms 1 /classes/stock/StockAvailable.php:453
1649
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4698 LIMIT 1
0.361 ms 10 /classes/SpecificPrice.php:435
2587
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 9842
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.361 ms 0 /classes/SpecificPrice.php:259
2652
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 9848 LIMIT 1
0.361 ms 11 /classes/SpecificPrice.php:435
3198
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4488
0.361 ms 1 /classes/Product.php:2902
3602
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 36 AND `id_shop` = 1
0.361 ms 6 /src/Adapter/EntityMapper.php:79
1267
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 9521 AND `id_group` = 1 LIMIT 1
0.360 ms 0 /classes/GroupReduction.php:156
2014
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4027 LIMIT 1
0.360 ms 10 /classes/SpecificPrice.php:435
2018
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4027 AND id_shop=1 LIMIT 1
0.360 ms 1 /classes/Product.php:6876
3534
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 48) LIMIT 1
0.360 ms 1 /src/Adapter/EntityMapper.php:71
3516
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 35) LIMIT 1
0.359 ms 1 /src/Adapter/EntityMapper.php:71
3553
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 262 AND `id_shop` = 1
0.359 ms 6 /src/Adapter/EntityMapper.php:79
22
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 2) AND (b.`id_shop` = 1) LIMIT 1
0.359 ms 1 /src/Adapter/EntityMapper.php:71
2091
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 5640 LIMIT 1
0.359 ms 10 /classes/SpecificPrice.php:435
2926
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3985
0.358 ms 1 /classes/Product.php:2902
3526
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 192) LIMIT 1
0.358 ms 1 /src/Adapter/EntityMapper.php:71
655
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3943)
0.357 ms 1 /classes/Product.php:3860
1720
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4704 AND `id_group` = 1 LIMIT 1
0.357 ms 0 /classes/GroupReduction.php:156
2179
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 6134 LIMIT 1
0.357 ms 10 /classes/SpecificPrice.php:435
2463
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 9774
AND image_shop.`cover` = 1 LIMIT 1
0.357 ms 1 /classes/Product.php:3570
382
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2898) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.356 ms 1 /classes/stock/StockAvailable.php:453
928
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 5418
AND image_shop.`cover` = 1 LIMIT 1
0.356 ms 1 /classes/Product.php:3570
1195
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 100 LIMIT 1
0.356 ms 1 /classes/Product.php:5659
3150
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4718
0.356 ms 1 /classes/Product.php:2902
1888
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 5638
ORDER BY f.position ASC
0.355 ms 5 Yes /classes/Product.php:6021
2084
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 5352 AND id_shop=1 LIMIT 1
0.355 ms 1 /classes/Product.php:6876
3004
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4000
0.355 ms 1 /classes/Product.php:2902
3117
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4541
0.355 ms 1 /classes/Product.php:2902
3231
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 5084
0.355 ms 1 /classes/Product.php:2902
624
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3790 AND `id_group` = 1 LIMIT 1
0.354 ms 0 /classes/GroupReduction.php:156
889
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 5373)
0.354 ms 1 /classes/Product.php:3860
3500
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 54) LIMIT 1
0.354 ms 1 /src/Adapter/EntityMapper.php:71
3147
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4704
0.353 ms 1 /classes/Product.php:2902
3297
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 9264
0.353 ms 1 /classes/Product.php:2902
3486
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 334) LIMIT 1
0.353 ms 1 /src/Adapter/EntityMapper.php:71
114
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 44 LIMIT 1
0.353 ms 1 /classes/Product.php:5659
1057
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3993 AND `id_group` = 1 LIMIT 1
0.353 ms 0 /classes/GroupReduction.php:156
2878
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3950
0.353 ms 1 /classes/Product.php:2902
2350
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 9746) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.352 ms 1 /classes/stock/StockAvailable.php:453
2636
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 9846) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.352 ms 1 /classes/stock/StockAvailable.php:453
2694
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 9852
AND image_shop.`cover` = 1 LIMIT 1
0.352 ms 1 /classes/Product.php:3570
263
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 70 LIMIT 1
0.352 ms 1 /classes/Product.php:5659
574
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 44 LIMIT 1
0.352 ms 1 /classes/Product.php:5659
912
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 5415 AND id_shop=1 LIMIT 1
0.352 ms 1 /classes/Product.php:6876
2068
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 46 LIMIT 1
0.352 ms 1 /classes/Product.php:5659
2485
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 9789
AND image_shop.`cover` = 1 LIMIT 1
0.351 ms 1 /classes/Product.php:3570
3556
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 264) LIMIT 1
0.351 ms 1 /src/Adapter/EntityMapper.php:71
59
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 20) AND (b.`id_shop` = 1) LIMIT 1
0.351 ms 1 /src/Adapter/EntityMapper.php:71
425
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2945 AND id_shop=1 LIMIT 1
0.351 ms 1 /classes/Product.php:6876
1553
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4492)
0.351 ms 1 /classes/Product.php:3860
2294
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 9723 AND `id_group` = 1 LIMIT 1
0.351 ms 0 /classes/GroupReduction.php:156
2785
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2898
0.350 ms 1 /classes/Product.php:2902
167
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3795) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.350 ms 1 /classes/stock/StockAvailable.php:453
2152
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 6024) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.350 ms 1 /classes/stock/StockAvailable.php:453
2233
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 200 LIMIT 1
0.350 ms 1 /classes/Product.php:5659
2752
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2514
0.350 ms 1 /classes/Product.php:2902
2947
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 5510
0.350 ms 1 /classes/Product.php:2902
3369
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 9792
0.350 ms 1 /classes/Product.php:2902
1117
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 78 LIMIT 1
0.349 ms 1 /classes/Product.php:5659
2079
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 45 LIMIT 1
0.349 ms 1 /classes/Product.php:5659
2243
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 8969
AND image_shop.`cover` = 1 LIMIT 1
0.349 ms 4 /classes/Product.php:3570
2474
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 9788
AND image_shop.`cover` = 1 LIMIT 1
0.349 ms 1 /classes/Product.php:3570
2507
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 9791
AND image_shop.`cover` = 1 LIMIT 1
0.349 ms 1 /classes/Product.php:3570
2580
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 9830 AND `id_group` = 1 LIMIT 1
0.349 ms 0 /classes/GroupReduction.php:156
2639
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 9847
AND image_shop.`cover` = 1 LIMIT 1
0.349 ms 1 /classes/Product.php:3570
3443
SELECT SQL_NO_CACHE *
FROM `hgt78_currency_lang`
WHERE `id_currency` = 2
0.349 ms 6 /src/Adapter/EntityMapper.php:79
211
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2502 AND id_shop=1 LIMIT 1
0.349 ms 1 /classes/Product.php:6876
331
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2835 LIMIT 1
0.348 ms 10 /classes/SpecificPrice.php:435
1014
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 6053) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.348 ms 1 /classes/stock/StockAvailable.php:453
1569
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4506
ORDER BY f.position ASC
0.348 ms 5 Yes /classes/Product.php:6021
3216
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3982
0.348 ms 1 /classes/Product.php:2902
1134
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 6120 AND `id_group` = 1 LIMIT 1
0.348 ms 0 /classes/GroupReduction.php:156
2196
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 6135) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.347 ms 1 /classes/stock/StockAvailable.php:453
1230
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4002
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.347 ms 0 /classes/SpecificPrice.php:259
1443
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4034)
0.347 ms 1 /classes/Product.php:3860
811
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4299 AND id_shop=1 LIMIT 1
0.346 ms 1 /classes/Product.php:6876
1075
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3994
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.346 ms 0 /classes/SpecificPrice.php:259
1135
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 6120) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.346 ms 1 /classes/stock/StockAvailable.php:453
1257
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4003) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.346 ms 1 /classes/stock/StockAvailable.php:453
2157
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 6025 LIMIT 1
0.346 ms 10 /classes/SpecificPrice.php:435
2419
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 9769
AND image_shop.`cover` = 1 LIMIT 1
0.346 ms 1 /classes/Product.php:3570
2618
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 200 LIMIT 1
0.346 ms 1 /classes/Product.php:5659
808
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4299
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.345 ms 0 /classes/SpecificPrice.php:259
1604
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 200 LIMIT 1
0.345 ms 1 /classes/Product.php:5659
2323
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 9744
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.345 ms 0 /classes/SpecificPrice.php:259
2959
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 6054
0.345 ms 1 /classes/Product.php:2902
3513
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 200) LIMIT 1
0.345 ms 1 /src/Adapter/EntityMapper.php:71
669
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3944 AND `id_group` = 1 LIMIT 1
0.344 ms 0 /classes/GroupReduction.php:156
1537
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4491
AND image_shop.`cover` = 1 LIMIT 1
0.344 ms 1 /classes/Product.php:3570
2042
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 5083) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.344 ms 1 /classes/stock/StockAvailable.php:453
2133
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 6023
AND image_shop.`cover` = 1 LIMIT 1
0.344 ms 1 /classes/Product.php:3570
2397
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 9767
AND image_shop.`cover` = 1 LIMIT 1
0.344 ms 1 /classes/Product.php:3570
3010
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4001
0.344 ms 1 /classes/Product.php:2902
3868
SELECT SQL_NO_CACHE `id_module` FROM `hgt78_module` WHERE `name` = "iqitcontactpage" LIMIT 1
0.344 ms 1 /classes/module/Module.php:2664
240
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2504 LIMIT 1
0.344 ms 10 /classes/SpecificPrice.php:435
601
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3500 AND id_shop=1 LIMIT 1
0.343 ms 1 /classes/Product.php:6876
1925
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3978 LIMIT 1
0.343 ms 10 /classes/SpecificPrice.php:435
1462
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4036 LIMIT 1
0.343 ms 10 /classes/SpecificPrice.php:435
1588
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4508 AND `id_group` = 1 LIMIT 1
0.343 ms 0 /classes/GroupReduction.php:156
2100
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 5641
AND image_shop.`cover` = 1 LIMIT 1
0.343 ms 1 /classes/Product.php:3570
2534
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 9794)
0.343 ms 1 /classes/Product.php:3860
2293
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 9723 AND id_shop=1 LIMIT 1
0.342 ms 1 /classes/Product.php:6876
2929
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 5415
0.342 ms 1 /classes/Product.php:2902
3294
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 8970
0.342 ms 1 /classes/Product.php:2902
3439
SELECT SQL_NO_CACHE `id_module` FROM `hgt78_module` WHERE `name` = "ps_currencyselector" LIMIT 1
0.342 ms 1 /classes/module/Module.php:2664
1683
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4701
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.342 ms 0 /classes/SpecificPrice.php:259
2119
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 5642) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.342 ms 1 /classes/stock/StockAvailable.php:453
2776
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2918
0.342 ms 1 /classes/Product.php:2902
719
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3950 LIMIT 1
0.341 ms 10 /classes/SpecificPrice.php:435
2185
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 6134) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.341 ms 1 /classes/stock/StockAvailable.php:453
2321
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 54 LIMIT 1
0.341 ms 1 /classes/Product.php:5659
3536
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 53) LIMIT 1
0.341 ms 1 /src/Adapter/EntityMapper.php:71
7
SELECT SQL_NO_CACHE *
FROM `hgt78_country` a
LEFT JOIN `hgt78_country_lang` `b` ON a.`id_country` = b.`id_country` AND b.`id_lang` = 1
LEFT JOIN `hgt78_country_shop` `c` ON a.`id_country` = c.`id_country` AND c.`id_shop` = 1
WHERE (a.`id_country` = 8) LIMIT 1
0.340 ms 1 /src/Adapter/EntityMapper.php:71
464
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 44 LIMIT 1
0.340 ms 1 /classes/Product.php:5659
1360
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 45 LIMIT 1
0.340 ms 1 /classes/Product.php:5659
1620
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4580 AND id_shop=1 LIMIT 1
0.340 ms 1 /classes/Product.php:6876
2064
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 5101) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.340 ms 1 /classes/stock/StockAvailable.php:453
2199
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 8429
AND image_shop.`cover` = 1 LIMIT 1
0.340 ms 1 /classes/Product.php:3570
1339
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4017 LIMIT 1
0.339 ms 10 /classes/SpecificPrice.php:435
1411
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4030 AND id_shop=1 LIMIT 1
0.339 ms 1 /classes/Product.php:6876
1655
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4698) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.339 ms 1 /classes/stock/StockAvailable.php:453
1824
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 200 LIMIT 1
0.339 ms 1 /classes/Product.php:5659
1407
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4030 LIMIT 1
0.339 ms 10 /classes/SpecificPrice.php:435
1305
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 44 LIMIT 1
0.338 ms 1 /classes/Product.php:5659
2911
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 5074
0.338 ms 1 /classes/Product.php:2902
3550
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 261) LIMIT 1
0.338 ms 1 /src/Adapter/EntityMapper.php:71
1900
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4488
AND image_shop.`cover` = 1 LIMIT 1
0.338 ms 1 /classes/Product.php:3570
2221
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 8947
AND image_shop.`cover` = 1 LIMIT 1
0.338 ms 1 /classes/Product.php:3570
414
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3197 AND id_shop=1 LIMIT 1
0.337 ms 1 /classes/Product.php:6876
1068
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 6100 AND `id_group` = 1 LIMIT 1
0.337 ms 0 /classes/GroupReduction.php:156
2013
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 34 LIMIT 1
0.337 ms 1 /classes/Product.php:5659
3363
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 9790
0.337 ms 1 /classes/Product.php:2902
183
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 200 LIMIT 1
0.337 ms 1 /classes/Product.php:5659
729
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 44 LIMIT 1
0.337 ms 1 /classes/Product.php:5659
1370
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4021
AND image_shop.`cover` = 1 LIMIT 1
0.337 ms 1 /classes/Product.php:3570
1506
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4241 LIMIT 1
0.337 ms 10 /classes/SpecificPrice.php:435
3276
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 6135
0.337 ms 1 /classes/Product.php:2902
320
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2834 LIMIT 1
0.336 ms 10 /classes/SpecificPrice.php:435
1459
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4035
ORDER BY f.position ASC
0.336 ms 5 Yes /classes/Product.php:6021
1501
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4239) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.336 ms 1 /classes/stock/StockAvailable.php:453
3007
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 8356
0.336 ms 1 /classes/Product.php:2902
602
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3500 AND `id_group` = 1 LIMIT 1
0.335 ms 0 /classes/GroupReduction.php:156
712
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3949 AND id_shop=1 LIMIT 1
0.335 ms 1 /classes/Product.php:6876
800
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4298 AND id_shop=1 LIMIT 1
0.335 ms 1 /classes/Product.php:6876
1218
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 8357 LIMIT 1
0.335 ms 10 /classes/SpecificPrice.php:435
1224
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 8357) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.335 ms 1 /classes/stock/StockAvailable.php:453
1825
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 5165 LIMIT 1
0.335 ms 10 /classes/SpecificPrice.php:435
2498
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 9790 LIMIT 1
0.335 ms 11 /classes/SpecificPrice.php:435
3195
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 5639
0.335 ms 1 /classes/Product.php:2902
3554
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 263) LIMIT 1
0.335 ms 1 /src/Adapter/EntityMapper.php:71
452
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3199
AND image_shop.`cover` = 1 LIMIT 1
0.334 ms 1 /classes/Product.php:3570
1671
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4700 LIMIT 1
0.334 ms 10 /classes/SpecificPrice.php:435
1042
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 6099
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.333 ms 0 /classes/SpecificPrice.php:259
2338
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 9745 AND `id_group` = 1 LIMIT 1
0.333 ms 0 /classes/GroupReduction.php:156
692
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3946) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.333 ms 1 /classes/stock/StockAvailable.php:453
1446
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4034) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.333 ms 1 /classes/stock/StockAvailable.php:453
2058
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 5101 LIMIT 1
0.333 ms 10 /classes/SpecificPrice.php:435
115
SELECT SQL_NO_CACHE `name`
FROM `hgt78_manufacturer`
WHERE `id_manufacturer` = 2
AND `active` = 1 LIMIT 1
0.332 ms 1 /classes/Manufacturer.php:316
1150
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 78 LIMIT 1
0.332 ms 1 /classes/Product.php:5659
2113
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 5642 LIMIT 1
0.332 ms 10 /classes/SpecificPrice.php:435
3366
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 9791
0.332 ms 1 /classes/Product.php:2902
2965
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 6099
0.331 ms 1 /classes/Product.php:2902
2570
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 9821) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.331 ms 1 /classes/stock/StockAvailable.php:453
2683
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 9851
AND image_shop.`cover` = 1 LIMIT 1
0.331 ms 1 /classes/Product.php:3570
3174
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 5164
0.331 ms 1 /classes/Product.php:2902
286
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2889 LIMIT 1
0.330 ms 10 /classes/SpecificPrice.php:435
953
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 5509
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.330 ms 0 /classes/SpecificPrice.php:259
3393
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 9844
0.330 ms 1 /classes/Product.php:2902
1036
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3992) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.330 ms 1 /classes/stock/StockAvailable.php:453
1172
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 89 LIMIT 1
0.330 ms 1 /classes/Product.php:5659
1435
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4033) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.330 ms 1 /classes/stock/StockAvailable.php:453
2008
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2930 AND `id_group` = 1 LIMIT 1
0.330 ms 0 /classes/GroupReduction.php:156
2551
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 9820
AND image_shop.`cover` = 1 LIMIT 1
0.330 ms 1 /classes/Product.php:3570
3469
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 38 AND `id_shop` = 1
0.330 ms 6 /src/Adapter/EntityMapper.php:79
576
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3499
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.329 ms 0 /classes/SpecificPrice.php:259
1056
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3993 AND id_shop=1 LIMIT 1
0.329 ms 1 /classes/Product.php:6876
1272
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 78 LIMIT 1
0.329 ms 1 /classes/Product.php:5659
2025
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 5084 LIMIT 1
0.329 ms 10 /classes/SpecificPrice.php:435
2047
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 5085 LIMIT 1
0.329 ms 10 /classes/SpecificPrice.php:435
2204
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 8429)
0.329 ms 1 /classes/Product.php:3860
212
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2502 AND `id_group` = 1 LIMIT 1
0.329 ms 0 /classes/GroupReduction.php:156
276
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2600
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.328 ms 0 /classes/SpecificPrice.php:259
343
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2918 LIMIT 1
0.328 ms 10 /classes/SpecificPrice.php:435
1219
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 8357
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.328 ms 0 /classes/SpecificPrice.php:259
1479
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4236) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.328 ms 1 /classes/stock/StockAvailable.php:453
2413
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 9768)
0.328 ms 1 /classes/Product.php:3860
2782
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2944
0.328 ms 1 /classes/Product.php:2902
1867
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 5337
AND image_shop.`cover` = 1 LIMIT 1
0.327 ms 4 /classes/Product.php:3570
3535
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 48 AND `id_shop` = 1
0.327 ms 6 /src/Adapter/EntityMapper.php:79
3605
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 47) LIMIT 1
0.327 ms 1 /src/Adapter/EntityMapper.php:71
268
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2808 AND id_shop=1 LIMIT 1
0.327 ms 1 /classes/Product.php:6876
734
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3801 AND id_shop=1 LIMIT 1
0.327 ms 1 /classes/Product.php:6876
1201
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 8356 AND `id_group` = 1 LIMIT 1
0.327 ms 0 /classes/GroupReduction.php:156
908
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 5415 LIMIT 1
0.326 ms 11 /classes/SpecificPrice.php:435
1151
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3998 LIMIT 1
0.326 ms 10 /classes/SpecificPrice.php:435
1484
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4238 LIMIT 1
0.326 ms 10 /classes/SpecificPrice.php:435
2125
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 6018
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.326 ms 0 /classes/SpecificPrice.php:259
2387
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 200 LIMIT 1
0.326 ms 1 /classes/Product.php:5659
679
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3945 AND id_shop=1 LIMIT 1
0.326 ms 1 /classes/Product.php:6876
1002
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3990 AND `id_group` = 1 LIMIT 1
0.326 ms 0 /classes/GroupReduction.php:156
1438
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4034
AND image_shop.`cover` = 1 LIMIT 1
0.326 ms 1 /classes/Product.php:3570
2845
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3500
0.325 ms 1 /classes/Product.php:2902
257
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2514 AND `id_group` = 1 LIMIT 1
0.325 ms 0 /classes/GroupReduction.php:156
929
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 89 LIMIT 1
0.325 ms 1 /classes/Product.php:5659
1255
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4003 AND id_shop=1 LIMIT 1
0.325 ms 1 /classes/Product.php:6876
2085
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 5352 AND `id_group` = 1 LIMIT 1
0.325 ms 0 /classes/GroupReduction.php:156
2163
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 6025) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.325 ms 1 /classes/stock/StockAvailable.php:453
2647
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 9847) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.325 ms 1 /classes/stock/StockAvailable.php:453
2851
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3790
0.325 ms 1 /classes/Product.php:2902
411
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3197
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.324 ms 0 /classes/SpecificPrice.php:259
874
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 44 LIMIT 1
0.324 ms 1 /classes/Product.php:5659
1090
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 6101 AND `id_group` = 1 LIMIT 1
0.324 ms 0 /classes/GroupReduction.php:156
1262
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 9521 LIMIT 1
0.324 ms 11 /classes/SpecificPrice.php:435
1460
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4036
AND image_shop.`cover` = 1 LIMIT 1
0.324 ms 1 /classes/Product.php:3570
1990
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 34 LIMIT 1
0.324 ms 1 /classes/Product.php:5659
2728
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3795
0.324 ms 1 /classes/Product.php:2902
764
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3952
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.323 ms 0 /classes/SpecificPrice.php:259
1677
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4700) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.323 ms 1 /classes/stock/StockAvailable.php:453
1984
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3983 AND id_shop=1 LIMIT 1
0.323 ms 1 /classes/Product.php:6876
2458
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 9773 AND id_shop=1 LIMIT 1
0.323 ms 1 /classes/Product.php:6876
3551
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 261 AND `id_shop` = 1
0.323 ms 6 /src/Adapter/EntityMapper.php:79
1354
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4018 AND id_shop=1 LIMIT 1
0.322 ms 1 /classes/Product.php:6876
2053
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 5085) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.322 ms 1 /classes/stock/StockAvailable.php:453
2140
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 6023 AND `id_group` = 1 LIMIT 1
0.322 ms 0 /classes/GroupReduction.php:156
3264
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 6024
0.322 ms 1 /classes/Product.php:2902
3001
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3018
0.322 ms 1 /classes/Product.php:2902
75
SELECT SQL_NO_CACHE *
FROM `hgt78_carrier` a
LEFT JOIN `hgt78_carrier_shop` `c` ON a.`id_carrier` = c.`id_carrier` AND c.`id_shop` = 1
WHERE (a.`id_carrier` = 282) LIMIT 1
0.321 ms 1 /src/Adapter/EntityMapper.php:71
3273
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 6134
0.321 ms 1 /classes/Product.php:2902
1284
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 10235 LIMIT 1
0.321 ms 10 /classes/SpecificPrice.php:435
2262
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 8970) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.321 ms 1 /classes/stock/StockAvailable.php:453
3353
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 9774
ORDER BY `position`
0.321 ms 1 Yes /classes/Product.php:3545
3381
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 9821
0.320 ms 1 /classes/Product.php:2902
697
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3947 LIMIT 1
0.320 ms 10 /classes/SpecificPrice.php:435
768
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3952 AND `id_group` = 1 LIMIT 1
0.320 ms 0 /classes/GroupReduction.php:156
1217
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 100 LIMIT 1
0.320 ms 1 /classes/Product.php:5659
1622
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4580) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.320 ms 1 /classes/stock/StockAvailable.php:453
1642
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4583 AND id_shop=1 LIMIT 1
0.320 ms 1 /classes/Product.php:6876
3114
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4540
0.320 ms 1 /classes/Product.php:2902
591
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3520 AND `id_group` = 1 LIMIT 1
0.319 ms 0 /classes/GroupReduction.php:156
2002
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 33 LIMIT 1
0.319 ms 1 /classes/Product.php:5659
2240
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 8948) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.319 ms 1 /classes/stock/StockAvailable.php:453
3870
SELECT SQL_NO_CACHE `name`
FROM `hgt78_hook`
WHERE `id_hook` = 912 LIMIT 1
0.319 ms 1 /classes/Hook.php:247
1517
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4413 LIMIT 1
0.318 ms 10 /classes/SpecificPrice.php:435
2024
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 78 LIMIT 1
0.318 ms 1 /classes/Product.php:5659
2791
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3196
0.318 ms 1 /classes/Product.php:2902
353
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 44 LIMIT 1
0.318 ms 1 /classes/Product.php:5659
709
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3949
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.318 ms 0 /classes/SpecificPrice.php:259
1399
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4029)
0.318 ms 1 /classes/Product.php:3860
2526
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 9792) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.318 ms 1 /classes/stock/StockAvailable.php:453
3120
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4580
0.318 ms 1 /classes/Product.php:2902
132
SELECT SQL_NO_CACHE tr.*
FROM `hgt78_tax_rule` tr
JOIN `hgt78_tax_rules_group` trg ON (tr.`id_tax_rules_group` = trg.`id_tax_rules_group`)
WHERE trg.`active` = 1
AND tr.`id_country` = 8
AND tr.`id_tax_rules_group` = 0
AND tr.`id_state` IN (0, 0)
AND ('04510' BETWEEN tr.`zipcode_from` AND tr.`zipcode_to`
OR (tr.`zipcode_to` = 0 AND tr.`zipcode_from` IN(0, '04510')))
ORDER BY tr.`zipcode_from` DESC, tr.`zipcode_to` DESC, tr.`id_state` DESC, tr.`id_country` DESC
0.317 ms 0 /classes/tax/TaxRulesTaxManager.php:109
143
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3797 AND id_shop=1 LIMIT 1
0.317 ms 1 /classes/Product.php:6876
2630
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 9846 LIMIT 1
0.317 ms 10 /classes/SpecificPrice.php:435
1842
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 5166) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.317 ms 1 /classes/stock/StockAvailable.php:453
3396
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 9845
0.317 ms 1 /classes/Product.php:2902
1580
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4507
ORDER BY f.position ASC
0.316 ms 5 Yes /classes/Product.php:6021
2190
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 6135 LIMIT 1
0.316 ms 10 /classes/SpecificPrice.php:435
2031
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 5084) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.316 ms 1 /classes/stock/StockAvailable.php:453
2101
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 45 LIMIT 1
0.316 ms 1 /classes/Product.php:5659
752
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3802 LIMIT 1
0.315 ms 11 /classes/SpecificPrice.php:435
1274
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4004
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.315 ms 0 /classes/SpecificPrice.php:259
1686
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4701 AND id_shop=1 LIMIT 1
0.315 ms 1 /classes/Product.php:6876
3435
SELECT SQL_NO_CACHE `id_module` FROM `hgt78_module_shop` WHERE `id_module` = 79 AND `id_shop` = 1 LIMIT 1
0.315 ms 1 /classes/module/Module.php:2137
58
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 19) AND (b.`id_shop` = 1) LIMIT 1
0.314 ms 1 /src/Adapter/EntityMapper.php:71
265
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2808
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.314 ms 1 /classes/SpecificPrice.php:259
375
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 44 LIMIT 1
0.314 ms 1 /classes/Product.php:5659
1278
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4004 AND `id_group` = 1 LIMIT 1
0.314 ms 0 /classes/GroupReduction.php:156
1606
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4541
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.314 ms 0 /classes/SpecificPrice.php:259
1648
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 200 LIMIT 1
0.314 ms 1 /classes/Product.php:5659
2399
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 9767 LIMIT 1
0.314 ms 11 /classes/SpecificPrice.php:435
2521
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 9792
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.314 ms 0 /classes/SpecificPrice.php:259
3052
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4019
0.314 ms 1 /classes/Product.php:2902
3537
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 53 AND `id_shop` = 1
0.314 ms 6 /src/Adapter/EntityMapper.php:79
292
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2889) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.313 ms 1 /classes/stock/StockAvailable.php:453
758
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3802) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.313 ms 1 /classes/stock/StockAvailable.php:453
1312
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 10236) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.313 ms 1 /classes/stock/StockAvailable.php:453
1836
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 5166 LIMIT 1
0.313 ms 10 /classes/SpecificPrice.php:435
2301
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 9742
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.313 ms 0 /classes/SpecificPrice.php:259
2623
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 9845 AND id_shop=1 LIMIT 1
0.313 ms 1 /classes/Product.php:6876
3192
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 5638
0.313 ms 1 /classes/Product.php:2902
1793
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 5103
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.312 ms 0 /classes/SpecificPrice.php:259
1894
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 5639)
0.312 ms 1 /classes/Product.php:3860
3449
SELECT SQL_NO_CACHE `id_module` FROM `hgt78_module` WHERE `name` = "iqitmegamenu" LIMIT 1
0.312 ms 1 /classes/module/Module.php:2664
319
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 44 LIMIT 1
0.311 ms 1 /classes/Product.php:5659
381
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2898 AND `id_group` = 1 LIMIT 1
0.311 ms 0 /classes/GroupReduction.php:156
645
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3942 AND id_shop=1 LIMIT 1
0.311 ms 1 /classes/Product.php:6876
2108
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 5641) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.311 ms 1 /classes/stock/StockAvailable.php:453
1611
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4541) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.310 ms 1 /classes/stock/StockAvailable.php:453
864
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 5106 LIMIT 1
0.310 ms 10 /classes/SpecificPrice.php:435
1495
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4239 LIMIT 1
0.310 ms 10 /classes/SpecificPrice.php:435
3165
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 5102
0.310 ms 1 /classes/Product.php:2902
1594
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4540 LIMIT 1
0.309 ms 10 /classes/SpecificPrice.php:435
235
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2513) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.309 ms 1 /classes/stock/StockAvailable.php:453
426
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2945 AND `id_group` = 1 LIMIT 1
0.309 ms 0 /classes/GroupReduction.php:156
884
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 5373
AND image_shop.`cover` = 1 LIMIT 1
0.309 ms 1 /classes/Product.php:3570
1362
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4019
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.309 ms 0 /classes/SpecificPrice.php:259
2857
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3942
0.309 ms 1 /classes/Product.php:2902
3057
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4022
0.309 ms 1 /classes/Product.php:2902
3408
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 9849
0.309 ms 1 /classes/Product.php:2902
497
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 200 LIMIT 1
0.308 ms 1 /classes/Product.php:5659
642
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3942
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.308 ms 0 /classes/SpecificPrice.php:259
1584
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4508
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.308 ms 0 /classes/SpecificPrice.php:259
229
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2513 LIMIT 1
0.307 ms 10 /classes/SpecificPrice.php:435
1035
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3992 AND `id_group` = 1 LIMIT 1
0.307 ms 0 /classes/GroupReduction.php:156
2102
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 5641 LIMIT 1
0.307 ms 10 /classes/SpecificPrice.php:435
2452
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 9773
AND image_shop.`cover` = 1 LIMIT 1
0.307 ms 1 /classes/Product.php:3570
2645
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 9847 AND id_shop=1 LIMIT 1
0.307 ms 1 /classes/Product.php:6876
2854
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3791
0.307 ms 1 /classes/Product.php:2902
1974
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3982 AND `id_group` = 1 LIMIT 1
0.307 ms 0 /classes/GroupReduction.php:156
1144
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3997 AND id_shop=1 LIMIT 1
0.306 ms 1 /classes/Product.php:6876
1918
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4489 AND id_shop=1 LIMIT 1
0.306 ms 1 /classes/Product.php:6876
2172
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 6105 AND id_shop=1 LIMIT 1
0.306 ms 1 /classes/Product.php:6876
2872
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3947
0.306 ms 1 /classes/Product.php:2902
190
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2475) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.306 ms 1 /classes/stock/StockAvailable.php:453
812
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4299 AND `id_group` = 1 LIMIT 1
0.306 ms 0 /classes/GroupReduction.php:156
1040
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 44 LIMIT 1
0.306 ms 1 /classes/Product.php:5659
1753
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 5076 AND `id_group` = 1 LIMIT 1
0.306 ms 0 /classes/GroupReduction.php:156
1770
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 5080 LIMIT 1
0.306 ms 10 /classes/SpecificPrice.php:435
1675
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4700 AND id_shop=1 LIMIT 1
0.305 ms 1 /classes/Product.php:6876
342
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 54 LIMIT 1
0.305 ms 1 /classes/Product.php:5659
376
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2898 LIMIT 1
0.305 ms 10 /classes/SpecificPrice.php:435
553
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3258 LIMIT 1
0.305 ms 10 /classes/SpecificPrice.php:435
1598
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4540 AND id_shop=1 LIMIT 1
0.305 ms 1 /classes/Product.php:6876
1633
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4582) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.305 ms 1 /classes/stock/StockAvailable.php:453
2460
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 9773) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.305 ms 1 /classes/stock/StockAvailable.php:453
2848
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3788
0.305 ms 1 /classes/Product.php:2902
436
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3198 AND id_shop=1 LIMIT 1
0.304 ms 1 /classes/Product.php:6876
207
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2502 LIMIT 1
0.304 ms 10 /classes/SpecificPrice.php:435
1946
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 34 LIMIT 1
0.304 ms 1 /classes/Product.php:5659
3129
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4698
0.304 ms 1 /classes/Product.php:2902
296
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `hgt78_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 88 LIMIT 1
0.303 ms 1 /classes/Category.php:1378
646
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3942 AND `id_group` = 1 LIMIT 1
0.303 ms 0 /classes/GroupReduction.php:156
907
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 89 LIMIT 1
0.303 ms 1 /classes/Product.php:5659
2019
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4027 AND `id_group` = 1 LIMIT 1
0.303 ms 0 /classes/GroupReduction.php:156
3446
SELECT SQL_NO_CACHE `id_module` FROM `hgt78_module_shop` WHERE `id_module` = 95 AND `id_shop` = 1 LIMIT 1
0.303 ms 1 /classes/module/Module.php:2137
1942
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3979) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.302 ms 1 /classes/stock/StockAvailable.php:453
2378
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 9751
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.302 ms 0 /classes/SpecificPrice.php:259
2405
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 9767) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.302 ms 1 /classes/stock/StockAvailable.php:453
2667
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 9849 AND id_shop=1 LIMIT 1
0.302 ms 1 /classes/Product.php:6876
1845
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 5167
AND image_shop.`cover` = 1 LIMIT 1
0.302 ms 1 /classes/Product.php:3570
2073
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 5328 AND id_shop=1 LIMIT 1
0.302 ms 1 /classes/Product.php:6876
2158
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 6025
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.302 ms 0 /classes/SpecificPrice.php:259
386
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 44 LIMIT 1
0.301 ms 1 /classes/Product.php:5659
597
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3500 LIMIT 1
0.301 ms 11 /classes/SpecificPrice.php:435
947
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3987) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.301 ms 1 /classes/stock/StockAvailable.php:453
2036
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 5083 LIMIT 1
0.301 ms 10 /classes/SpecificPrice.php:435
1361
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4019 LIMIT 1
0.301 ms 10 /classes/SpecificPrice.php:435
1752
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 5076 AND id_shop=1 LIMIT 1
0.301 ms 1 /classes/Product.php:6876
2624
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 9845 AND `id_group` = 1 LIMIT 1
0.301 ms 0 /classes/GroupReduction.php:156
2914
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 5075
0.301 ms 1 /classes/Product.php:2902
3869
SELECT SQL_NO_CACHE `id_module` FROM `hgt78_module_shop` WHERE `id_module` = 81 AND `id_shop` = 1 LIMIT 1
0.301 ms 1 /classes/module/Module.php:2137
3321
SELECT SQL_NO_CACHE `name`, `alias` FROM `hgt78_hook_alias`
0.300 ms 88 /classes/Hook.php:290
176
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2415 AND id_shop=1 LIMIT 1
0.300 ms 1 /classes/Product.php:6876
3495
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 45 AND `id_shop` = 1
0.300 ms 6 /src/Adapter/EntityMapper.php:79
548
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3257) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.299 ms 1 /classes/stock/StockAvailable.php:453
269
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2808 AND `id_group` = 1 LIMIT 1
0.299 ms 0 /classes/GroupReduction.php:156
1101
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3995 AND `id_group` = 1 LIMIT 1
0.299 ms 0 /classes/GroupReduction.php:156
1449
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4035
AND image_shop.`cover` = 1 LIMIT 1
0.299 ms 1 /classes/Product.php:3570
1534
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4490) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.299 ms 1 /classes/stock/StockAvailable.php:453
1548
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4492
AND image_shop.`cover` = 1 LIMIT 1
0.299 ms 1 /classes/Product.php:3570
1550
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4492 LIMIT 1
0.299 ms 10 /classes/SpecificPrice.php:435
2135
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 6023 LIMIT 1
0.299 ms 10 /classes/SpecificPrice.php:435
2382
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 9751 AND `id_group` = 1 LIMIT 1
0.299 ms 0 /classes/GroupReduction.php:156
2408
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 9768
AND image_shop.`cover` = 1 LIMIT 1
0.299 ms 1 /classes/Product.php:3570
3267
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 6025
0.299 ms 1 /classes/Product.php:2902
3517
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 35 AND `id_shop` = 1
0.299 ms 6 /src/Adapter/EntityMapper.php:79
144
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3797 AND `id_group` = 1 LIMIT 1
0.298 ms 0 /classes/GroupReduction.php:156
447
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3010 AND id_shop=1 LIMIT 1
0.298 ms 1 /classes/Product.php:6876
503
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3234 AND `id_group` = 1 LIMIT 1
0.298 ms 0 /classes/GroupReduction.php:156
846
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 5074 AND id_shop=1 LIMIT 1
0.298 ms 1 /classes/Product.php:6876
885
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 90 LIMIT 1
0.298 ms 1 /classes/Product.php:5659
984
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3989
AND image_shop.`cover` = 1 LIMIT 1
0.298 ms 1 /classes/Product.php:3570
1064
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 6100
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.298 ms 0 /classes/SpecificPrice.php:259
2069
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 5328 LIMIT 1
0.298 ms 10 /classes/SpecificPrice.php:435
2333
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 9745 LIMIT 1
0.298 ms 11 /classes/SpecificPrice.php:435
32
SELECT SQL_NO_CACHE *
FROM `hgt78_currency` a
LEFT JOIN `hgt78_currency_shop` `c` ON a.`id_currency` = c.`id_currency` AND c.`id_shop` = 1
WHERE (a.`id_currency` = 1) LIMIT 1
0.297 ms 1 /src/Adapter/EntityMapper.php:71
1953
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3980) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.297 ms 1 /classes/stock/StockAvailable.php:453
2090
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 45 LIMIT 1
0.297 ms 1 /classes/Product.php:5659
2905
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4856
0.297 ms 1 /classes/Product.php:2902
2944
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3988
0.297 ms 1 /classes/Product.php:2902
1418
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4032 LIMIT 1
0.296 ms 10 /classes/SpecificPrice.php:435
1473
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4236 LIMIT 1
0.296 ms 10 /classes/SpecificPrice.php:435
2057
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 34 LIMIT 1
0.296 ms 1 /classes/Product.php:5659
963
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 78 LIMIT 1
0.296 ms 1 /classes/Product.php:5659
2559
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 9820) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.296 ms 1 /classes/stock/StockAvailable.php:453
3555
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 263 AND `id_shop` = 1
0.296 ms 6 /src/Adapter/EntityMapper.php:79
620
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3790
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.295 ms 1 /classes/SpecificPrice.php:259
1937
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3979
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.295 ms 0 /classes/SpecificPrice.php:259
2332
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 54 LIMIT 1
0.295 ms 1 /classes/Product.php:5659
2001
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `hgt78_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 33 LIMIT 1
0.295 ms 1 /classes/Category.php:1378
2518
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 9792
AND image_shop.`cover` = 1 LIMIT 1
0.295 ms 1 /classes/Product.php:3570
3309
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 9743
0.294 ms 1 /classes/Product.php:2902
1279
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4004) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.294 ms 1 /classes/stock/StockAvailable.php:453
1412
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4030 AND `id_group` = 1 LIMIT 1
0.294 ms 0 /classes/GroupReduction.php:156
1660
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4699 LIMIT 1
0.294 ms 10 /classes/SpecificPrice.php:435
3372
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 9794
0.294 ms 1 /classes/Product.php:2902
940
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 199 LIMIT 1
0.293 ms 1 /classes/Product.php:5659
1097
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3995
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.293 ms 1 /classes/SpecificPrice.php:259
2180
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 6134
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.293 ms 0 /classes/SpecificPrice.php:259
2361
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 9747) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.293 ms 1 /classes/stock/StockAvailable.php:453
1140
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3997 LIMIT 1
0.292 ms 10 /classes/SpecificPrice.php:435
1539
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4491 LIMIT 1
0.292 ms 10 /classes/SpecificPrice.php:435
3514
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 200 AND `id_shop` = 1
0.292 ms 6 /src/Adapter/EntityMapper.php:79
1295
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4005 LIMIT 1
0.292 ms 10 /classes/SpecificPrice.php:435
2106
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 5641 AND id_shop=1 LIMIT 1
0.292 ms 1 /classes/Product.php:6876
2737
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2447
0.292 ms 1 /classes/Product.php:2902
745
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3951 AND id_shop=1 LIMIT 1
0.291 ms 1 /classes/Product.php:6876
1709
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4703 AND `id_group` = 1 LIMIT 1
0.291 ms 0 /classes/GroupReduction.php:156
2114
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 5642
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.291 ms 0 /classes/SpecificPrice.php:259
2608
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 9844 LIMIT 1
0.291 ms 10 /classes/SpecificPrice.php:435
3291
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 8969
0.291 ms 1 /classes/Product.php:2902
2239
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 8948 AND `id_group` = 1 LIMIT 1
0.291 ms 0 /classes/GroupReduction.php:156
2669
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 9849) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.291 ms 1 /classes/stock/StockAvailable.php:453
359
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2836 AND `id_group` = 1 LIMIT 1
0.290 ms 0 /classes/GroupReduction.php:156
1490
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4238) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.290 ms 1 /classes/stock/StockAvailable.php:453
2613
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 9844 AND `id_group` = 1 LIMIT 1
0.290 ms 0 /classes/GroupReduction.php:156
843
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 5074
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.290 ms 1 /classes/SpecificPrice.php:259
865
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 5106
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.290 ms 0 /classes/SpecificPrice.php:259
1385
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4022 LIMIT 1
0.290 ms 10 /classes/SpecificPrice.php:435
2232
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 8948
AND image_shop.`cover` = 1 LIMIT 1
0.290 ms 1 /classes/Product.php:3570
3440
SELECT SQL_NO_CACHE `id_module` FROM `hgt78_module_shop` WHERE `id_module` = 17 AND `id_shop` = 1 LIMIT 1
0.290 ms 1 /classes/module/Module.php:2137
3863
SELECT SQL_NO_CACHE c.`nleft`, c.`nright`  FROM `hgt78_category` c
LEFT JOIN `hgt78_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`id_category` = 2 LIMIT 1
0.290 ms 1 /classes/Category.php:1585
1100
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3995 AND id_shop=1 LIMIT 1
0.289 ms 1 /classes/Product.php:6876
1511
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4241 AND `id_group` = 1 LIMIT 1
0.289 ms 0 /classes/GroupReduction.php:156
1714
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 200 LIMIT 1
0.289 ms 1 /classes/Product.php:5659
2218
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 8946) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.289 ms 1 /classes/stock/StockAvailable.php:453
2438
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 9771) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.289 ms 1 /classes/stock/StockAvailable.php:453
2515
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 9791) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.289 ms 1 /classes/stock/StockAvailable.php:453
480
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3200 AND id_shop=1 LIMIT 1
0.288 ms 1 /classes/Product.php:6876
686
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3946 LIMIT 1
0.288 ms 10 /classes/SpecificPrice.php:435
913
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 5415 AND `id_group` = 1 LIMIT 1
0.288 ms 0 /classes/GroupReduction.php:156
976
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 5510
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.288 ms 0 /classes/SpecificPrice.php:259
1307
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 10236
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.288 ms 1 /classes/SpecificPrice.php:259
1427
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4033
AND image_shop.`cover` = 1 LIMIT 1
0.288 ms 1 /classes/Product.php:3570
1875
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 5337) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.288 ms 1 /classes/stock/StockAvailable.php:453
2026
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 5084
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.288 ms 0 /classes/SpecificPrice.php:259
2097
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 5640) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.288 ms 1 /classes/stock/StockAvailable.php:453
2620
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 9845
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.288 ms 0 /classes/SpecificPrice.php:259
3306
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 9742
0.288 ms 1 /classes/Product.php:2902
2015
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4027
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.288 ms 0 /classes/SpecificPrice.php:259
751
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 44 LIMIT 1
0.287 ms 1 /classes/Product.php:5659
801
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4298 AND `id_group` = 1 LIMIT 1
0.287 ms 0 /classes/GroupReduction.php:156
1813
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 200 LIMIT 1
0.287 ms 1 /classes/Product.php:5659
2569
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 9821 AND `id_group` = 1 LIMIT 1
0.287 ms 0 /classes/GroupReduction.php:156
1222
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 8357 AND id_shop=1 LIMIT 1
0.287 ms 1 /classes/Product.php:6876
1388
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4022)
0.287 ms 1 /classes/Product.php:3860
63
SELECT SQL_NO_CACHE * FROM `hgt78_image_type` WHERE 1 AND `products` = 1  ORDER BY `width` DESC, `height` DESC, `name`ASC
0.286 ms 8 Yes /classes/ImageType.php:109
1587
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4508 AND id_shop=1 LIMIT 1
0.286 ms 1 /classes/Product.php:6876
3423
SELECT SQL_NO_CACHE name, alias FROM `hgt78_hook_alias`
0.286 ms 88 /classes/Hook.php:342
1764
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 5077 AND `id_group` = 1 LIMIT 1
0.286 ms 0 /classes/GroupReduction.php:156
314
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2890 AND `id_group` = 1 LIMIT 1
0.285 ms 0 /classes/GroupReduction.php:156
958
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 5509) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.285 ms 1 /classes/stock/StockAvailable.php:453
1394
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4029
AND image_shop.`cover` = 1 LIMIT 1
0.285 ms 1 /classes/Product.php:3570
1494
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 78 LIMIT 1
0.285 ms 1 /classes/Product.php:5659
1973
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3982 AND id_shop=1 LIMIT 1
0.285 ms 1 /classes/Product.php:6876
3288
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 8948
0.285 ms 1 /classes/Product.php:2902
603
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3500) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.285 ms 1 /classes/stock/StockAvailable.php:453
1019
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 6054 LIMIT 1
0.285 ms 9 /classes/SpecificPrice.php:435
2731
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2415
0.285 ms 1 /classes/Product.php:2902
2899
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4298
0.285 ms 1 /classes/Product.php:2902
3300
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 9721
0.285 ms 1 /classes/Product.php:2902
56
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 13) AND (b.`id_shop` = 1) LIMIT 1
0.284 ms 1 /src/Adapter/EntityMapper.php:71
547
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3257 AND `id_group` = 1 LIMIT 1
0.284 ms 0 /classes/GroupReduction.php:156
1367
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4019) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.284 ms 1 /classes/stock/StockAvailable.php:453
1373
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4021 LIMIT 1
0.284 ms 10 /classes/SpecificPrice.php:435
2941
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 5509
0.284 ms 1 /classes/Product.php:2902
3
SELECT SQL_NO_CACHE value FROM `hgt78_configuration` WHERE `name` = "PS_MULTISHOP_FEATURE_ACTIVE" LIMIT 1
0.283 ms 1 /classes/shop/Shop.php:1183
324
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2834 AND id_shop=1 LIMIT 1
0.283 ms 1 /classes/Product.php:6876
2210
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 8946
AND image_shop.`cover` = 1 LIMIT 1
0.283 ms 1 /classes/Product.php:3570
2680
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 9850) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.283 ms 1 /classes/stock/StockAvailable.php:453
2708
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 10738 LIMIT 1
0.283 ms 10 /classes/SpecificPrice.php:435
3501
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 54 AND `id_shop` = 1
0.283 ms 6 /src/Adapter/EntityMapper.php:79
41
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 33) AND (b.`id_shop` = 1) LIMIT 1
0.282 ms 1 /src/Adapter/EntityMapper.php:71
945
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3987 AND id_shop=1 LIMIT 1
0.282 ms 1 /classes/Product.php:6876
1023
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 6054 AND id_shop=1 LIMIT 1
0.282 ms 1 /classes/Product.php:6876
1046
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 6099 AND `id_group` = 1 LIMIT 1
0.282 ms 0 /classes/GroupReduction.php:156
1575
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4507)
0.282 ms 1 /classes/Product.php:3860
2449
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 9772) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.282 ms 1 /classes/stock/StockAvailable.php:453
1676
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4700 AND `id_group` = 1 LIMIT 1
0.281 ms 0 /classes/GroupReduction.php:156
2344
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 9746 LIMIT 1
0.281 ms 11 /classes/SpecificPrice.php:435
3448
SELECT SQL_NO_CACHE `name`
FROM `hgt78_hook`
WHERE `id_hook` = 910 LIMIT 1
0.281 ms 1 /classes/Hook.php:247
598
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3500
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.281 ms 0 /classes/SpecificPrice.php:259
279
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2600 AND id_shop=1 LIMIT 1
0.280 ms 1 /classes/Product.php:6876
1152
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3998
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.280 ms 0 /classes/SpecificPrice.php:259
1814
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 5164 LIMIT 1
0.280 ms 10 /classes/SpecificPrice.php:435
2040
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 5083 AND id_shop=1 LIMIT 1
0.280 ms 1 /classes/Product.php:6876
2432
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 9771 LIMIT 1
0.280 ms 11 /classes/SpecificPrice.php:435
3123
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4582
0.280 ms 1 /classes/Product.php:2902
3477
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 172 AND `id_shop` = 1
0.280 ms 6 /src/Adapter/EntityMapper.php:79
2696
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 9852 LIMIT 1
0.279 ms 11 /classes/SpecificPrice.php:435
347
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2918 AND id_shop=1 LIMIT 1
0.279 ms 1 /classes/Product.php:6876
1018
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 44 LIMIT 1
0.279 ms 1 /classes/Product.php:5659
1617
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4580
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.279 ms 0 /classes/SpecificPrice.php:259
1883
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 5638)
0.279 ms 1 /classes/Product.php:3860
1912
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4489
AND image_shop.`cover` = 1 LIMIT 1
0.279 ms 1 /classes/Product.php:3570
2563
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 199 LIMIT 1
0.279 ms 1 /classes/Product.php:5659
2590
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 9842 AND id_shop=1 LIMIT 1
0.279 ms 1 /classes/Product.php:6876
1485
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4238
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.278 ms 0 /classes/SpecificPrice.php:259
1861
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 5336)
0.278 ms 1 /classes/Product.php:3860
234
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2513 AND `id_group` = 1 LIMIT 1
0.278 ms 0 /classes/GroupReduction.php:156
309
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2890 LIMIT 1
0.278 ms 10 /classes/SpecificPrice.php:435
448
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3010 AND `id_group` = 1 LIMIT 1
0.278 ms 0 /classes/GroupReduction.php:156
1290
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 10235) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.278 ms 1 /classes/stock/StockAvailable.php:453
1892
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 5639
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.278 ms 0 /classes/SpecificPrice.php:259
974
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 89 LIMIT 1
0.277 ms 1 /classes/Product.php:5659
1454
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4035)
0.277 ms 1 /classes/Product.php:3860
1874
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 5337 AND `id_group` = 1 LIMIT 1
0.277 ms 0 /classes/GroupReduction.php:156
2147
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 6024
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.277 ms 0 /classes/SpecificPrice.php:259
2162
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 6025 AND `id_group` = 1 LIMIT 1
0.277 ms 0 /classes/GroupReduction.php:156
2207
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 8429) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.277 ms 1 /classes/stock/StockAvailable.php:453
2249
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 8969 AND id_shop=1 LIMIT 1
0.277 ms 1 /classes/Product.php:6876
2394
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 9752) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.277 ms 1 /classes/stock/StockAvailable.php:453
2640
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 200 LIMIT 1
0.277 ms 1 /classes/Product.php:5659
3607
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 76) LIMIT 1
0.277 ms 1 /src/Adapter/EntityMapper.php:71
875
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 5113 LIMIT 1
0.276 ms 10 /classes/SpecificPrice.php:435
1472
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 200 LIMIT 1
0.276 ms 1 /classes/Product.php:5659
1920
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4489) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.276 ms 1 /classes/stock/StockAvailable.php:453
2178
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 54 LIMIT 1
0.276 ms 1 /classes/Product.php:5659
2343
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 54 LIMIT 1
0.276 ms 1 /classes/Product.php:5659
1769
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 199 LIMIT 1
0.276 ms 1 /classes/Product.php:5659
3417
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 9852
0.276 ms 1 /classes/Product.php:2902
194
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 44 LIMIT 1
0.275 ms 1 /classes/Product.php:5659
569
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3497 AND `id_group` = 1 LIMIT 1
0.275 ms 0 /classes/GroupReduction.php:156
3479
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 175 AND `id_shop` = 1
0.275 ms 6 /src/Adapter/EntityMapper.php:79
1483
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 78 LIMIT 1
0.275 ms 1 /classes/Product.php:5659
1738
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4989
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.275 ms 0 /classes/SpecificPrice.php:259
1609
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4541 AND id_shop=1 LIMIT 1
0.274 ms 1 /classes/Product.php:6876
2702
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 9852) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.274 ms 1 /classes/stock/StockAvailable.php:453
3414
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 9851
0.274 ms 1 /classes/Product.php:2902
2398
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 54 LIMIT 1
0.274 ms 1 /classes/Product.php:5659
3168
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 5103
0.274 ms 1 /classes/Product.php:2902
3508
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 78 AND `id_shop` = 1
0.274 ms 6 /src/Adapter/EntityMapper.php:79
1391
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4022) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.273 ms 1 /classes/stock/StockAvailable.php:453
12
SELECT SQL_NO_CACHE COUNT(DISTINCT l.id_lang) FROM `hgt78_lang` l
JOIN hgt78_lang_shop lang_shop ON (lang_shop.id_lang = l.id_lang AND lang_shop.id_shop = 1)
WHERE l.`active` = 1 LIMIT 1
0.273 ms 6 /classes/Language.php:1216
66
SELECT SQL_NO_CACHE *
FROM `hgt78_country` a
LEFT JOIN `hgt78_country_shop` `c` ON a.`id_country` = c.`id_country` AND c.`id_shop` = 1
WHERE (a.`id_country` = 8) LIMIT 1
0.273 ms 1 /src/Adapter/EntityMapper.php:71
607
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 44 LIMIT 1
0.273 ms 1 /classes/Product.php:5659
1008
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 6053 LIMIT 1
0.273 ms 10 /classes/SpecificPrice.php:435
1429
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4033 LIMIT 1
0.273 ms 10 /classes/SpecificPrice.php:435
1505
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 78 LIMIT 1
0.273 ms 1 /classes/Product.php:5659
1627
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4582 LIMIT 1
0.273 ms 10 /classes/SpecificPrice.php:435
1643
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4583 AND `id_group` = 1 LIMIT 1
0.273 ms 0 /classes/GroupReduction.php:156
2714
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 10738) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.273 ms 1 /classes/stock/StockAvailable.php:453
239
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 200 LIMIT 1
0.272 ms 1 /classes/Product.php:5659
881
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 5113) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.272 ms 1 /classes/stock/StockAvailable.php:453
1496
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4239
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.272 ms 0 /classes/SpecificPrice.php:259
1545
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4491) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.272 ms 1 /classes/stock/StockAvailable.php:453
1935
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 34 LIMIT 1
0.272 ms 1 /classes/Product.php:5659
1992
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3984
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.272 ms 0 /classes/SpecificPrice.php:259
2118
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 5642 AND `id_group` = 1 LIMIT 1
0.272 ms 0 /classes/GroupReduction.php:156
3610
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 77 AND `id_shop` = 1
0.272 ms 6 /src/Adapter/EntityMapper.php:79
205
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `hgt78_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 41 LIMIT 1
0.272 ms 1 /classes/Category.php:1378
308
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 70 LIMIT 1
0.272 ms 1 /classes/Product.php:5659
1288
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 10235 AND id_shop=1 LIMIT 1
0.272 ms 1 /classes/Product.php:6876
1564
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4506)
0.271 ms 1 /classes/Product.php:3860
1672
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4700
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.271 ms 0 /classes/SpecificPrice.php:259
2902
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4299
0.271 ms 1 /classes/Product.php:2902
1947
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3980 LIMIT 1
0.271 ms 10 /classes/SpecificPrice.php:435
2493
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 9789) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.271 ms 1 /classes/stock/StockAvailable.php:453
200
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2447 AND `id_group` = 1 LIMIT 1
0.270 ms 0 /classes/GroupReduction.php:156
442
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 44 LIMIT 1
0.270 ms 1 /classes/Product.php:5659
991
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3989 AND `id_group` = 1 LIMIT 1
0.270 ms 0 /classes/GroupReduction.php:156
2454
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 9773 LIMIT 1
0.270 ms 11 /classes/SpecificPrice.php:435
1266
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 9521 AND id_shop=1 LIMIT 1
0.270 ms 1 /classes/Product.php:6876
1639
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4583
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.270 ms 0 /classes/SpecificPrice.php:259
1670
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 200 LIMIT 1
0.270 ms 1 /classes/Product.php:5659
3877
SELECT SQL_NO_CACHE `id_module` FROM `hgt78_module` WHERE `name` = "ps_emailsubscription" LIMIT 1
0.270 ms 1 /classes/module/Module.php:2664
2542
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 9819 LIMIT 1
0.269 ms 10 /classes/SpecificPrice.php:435
499
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3234
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.269 ms 0 /classes/SpecificPrice.php:259
1463
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4036
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.269 ms 1 /classes/SpecificPrice.php:259
2070
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 5328
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.269 ms 0 /classes/SpecificPrice.php:259
2356
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 9747
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.269 ms 0 /classes/SpecificPrice.php:259
2471
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 9774) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.269 ms 1 /classes/stock/StockAvailable.php:453
2504
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 9790) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.269 ms 1 /classes/stock/StockAvailable.php:453
2553
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 9820 LIMIT 1
0.268 ms 10 /classes/SpecificPrice.php:435
51
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 40) AND (b.`id_shop` = 1) LIMIT 1
0.268 ms 1 /src/Adapter/EntityMapper.php:71
1146
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3997) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.268 ms 1 /classes/stock/StockAvailable.php:453
1261
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 44 LIMIT 1
0.268 ms 1 /classes/Product.php:5659
1661
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4699
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.268 ms 0 /classes/SpecificPrice.php:259
2096
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 5640 AND `id_group` = 1 LIMIT 1
0.268 ms 0 /classes/GroupReduction.php:156
2256
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 8970 LIMIT 1
0.268 ms 17 /classes/SpecificPrice.php:435
2607
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 200 LIMIT 1
0.268 ms 1 /classes/Product.php:5659
3240
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 5101
0.268 ms 1 /classes/Product.php:2902
15
SELECT SQL_NO_CACHE `name`, `alias` FROM `hgt78_hook_alias`
0.267 ms 88 /classes/Hook.php:290
280
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2600 AND `id_group` = 1 LIMIT 1
0.267 ms 0 /classes/GroupReduction.php:156
415
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3197 AND `id_group` = 1 LIMIT 1
0.267 ms 0 /classes/GroupReduction.php:156
504
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3234) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.267 ms 1 /classes/stock/StockAvailable.php:453
552
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 44 LIMIT 1
0.267 ms 1 /classes/Product.php:5659
568
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3497 AND id_shop=1 LIMIT 1
0.267 ms 1 /classes/Product.php:6876
1417
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 46 LIMIT 1
0.267 ms 1 /classes/Product.php:5659
1510
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4241 AND id_shop=1 LIMIT 1
0.267 ms 1 /classes/Product.php:6876
1532
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4490 AND id_shop=1 LIMIT 1
0.267 ms 1 /classes/Product.php:6876
1659
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 200 LIMIT 1
0.267 ms 1 /classes/Product.php:5659
2255
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 70 LIMIT 1
0.267 ms 1 /classes/Product.php:5659
2520
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 9792 LIMIT 1
0.267 ms 11 /classes/SpecificPrice.php:435
3249
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 5640
0.267 ms 1 /classes/Product.php:2902
1638
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4583 LIMIT 1
0.267 ms 10 /classes/SpecificPrice.php:435
2169
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 6105
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.267 ms 0 /classes/SpecificPrice.php:259
2794
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3197
0.267 ms 1 /classes/Product.php:2902
438
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3198) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.266 ms 1 /classes/stock/StockAvailable.php:453
1829
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 5165 AND id_shop=1 LIMIT 1
0.266 ms 1 /classes/Product.php:6876
1909
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4488) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.266 ms 1 /classes/stock/StockAvailable.php:453
2107
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 5641 AND `id_group` = 1 LIMIT 1
0.266 ms 0 /classes/GroupReduction.php:156
2216
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 8946 AND id_shop=1 LIMIT 1
0.266 ms 1 /classes/Product.php:6876
2833
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3258
0.266 ms 1 /classes/Product.php:2902
3472
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 62) LIMIT 1
0.266 ms 1 /src/Adapter/EntityMapper.php:71
3507
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 78) LIMIT 1
0.266 ms 1 /src/Adapter/EntityMapper.php:71
3871
SELECT SQL_NO_CACHE content FROM hgt78_lgcookieslaw_lang WHERE id_lang = 1 LIMIT 1
0.266 ms 1 /modules/lgcookieslaw/lgcookieslaw.php:161
1145
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3997 AND `id_group` = 1 LIMIT 1
0.266 ms 0 /classes/GroupReduction.php:156
2482
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 9788) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.266 ms 1 /classes/stock/StockAvailable.php:453
50
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 39) AND (b.`id_shop` = 1) LIMIT 1
0.265 ms 1 /src/Adapter/EntityMapper.php:71
3511
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 199 AND `id_shop` = 1
0.265 ms 6 /src/Adapter/EntityMapper.php:79
585
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 200 LIMIT 1
0.265 ms 1 /classes/Product.php:5659
1742
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4989 AND `id_group` = 1 LIMIT 1
0.265 ms 0 /classes/GroupReduction.php:156
2597
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 9843 LIMIT 1
0.265 ms 11 /classes/SpecificPrice.php:435
196
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2447
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.264 ms 0 /classes/SpecificPrice.php:259
1889
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 5639
AND image_shop.`cover` = 1 LIMIT 1
0.264 ms 1 /classes/Product.php:3570
285
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 70 LIMIT 1
0.264 ms 1 /classes/Product.php:5659
2487
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 9789 LIMIT 1
0.264 ms 11 /classes/SpecificPrice.php:435
3228
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4027
0.263 ms 1 /classes/Product.php:2902
189
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2475 AND `id_group` = 1 LIMIT 1
0.263 ms 0 /classes/GroupReduction.php:156
2117
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 5642 AND id_shop=1 LIMIT 1
0.263 ms 1 /classes/Product.php:6876
2662
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 200 LIMIT 1
0.263 ms 1 /classes/Product.php:5659
2839
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3499
0.263 ms 1 /classes/Product.php:2902
2968
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3993
0.263 ms 1 /classes/Product.php:2902
3270
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 6105
0.263 ms 1 /classes/Product.php:2902
3422
SELECT SQL_NO_CACHE * FROM `hgt78_hook_module_exceptions`
WHERE `id_shop` IN (1)
0.263 ms 1 /classes/module/Module.php:2046
3510
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 199) LIMIT 1
0.263 ms 1 /src/Adapter/EntityMapper.php:71
128
SELECT SQL_NO_CACHE *
FROM `hgt78_tax` a
WHERE (a.`id_tax` = 1) LIMIT 1
0.262 ms 1 /src/Adapter/EntityMapper.php:71
2123
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 200 LIMIT 1
0.262 ms 1 /classes/Product.php:5659
2806
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3199
0.262 ms 1 /classes/Product.php:2902
2896
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4297
0.262 ms 1 /classes/Product.php:2902
653
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3943
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.262 ms 0 /classes/SpecificPrice.php:259
680
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3945 AND `id_group` = 1 LIMIT 1
0.261 ms 0 /classes/GroupReduction.php:156
1024
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 6054 AND `id_group` = 1 LIMIT 1
0.261 ms 0 /classes/GroupReduction.php:156
1968
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 34 LIMIT 1
0.261 ms 1 /classes/Product.php:5659
2035
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 78 LIMIT 1
0.261 ms 1 /classes/Product.php:5659
2245
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 8969 LIMIT 1
0.261 ms 17 /classes/SpecificPrice.php:435
2250
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 8969 AND `id_group` = 1 LIMIT 1
0.261 ms 0 /classes/GroupReduction.php:156
2788
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2899
0.261 ms 1 /classes/Product.php:2902
2030
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 5084 AND `id_group` = 1 LIMIT 1
0.261 ms 0 /classes/GroupReduction.php:156
70
SELECT SQL_NO_CACHE * FROM hgt78_revslider_sliders
0.260 ms 2 /modules/revsliderprestashop/includes/revslider_db.class.php:214
713
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3949 AND `id_group` = 1 LIMIT 1
0.260 ms 0 /classes/GroupReduction.php:156
1650
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4698
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.260 ms 0 /classes/SpecificPrice.php:259
3171
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 5104
0.260 ms 1 /classes/Product.php:2902
1500
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4239 AND `id_group` = 1 LIMIT 1
0.260 ms 0 /classes/GroupReduction.php:156
2145
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 200 LIMIT 1
0.260 ms 1 /classes/Product.php:5659
2509
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 9791 LIMIT 1
0.260 ms 11 /classes/SpecificPrice.php:435
2513
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 9791 AND id_shop=1 LIMIT 1
0.259 ms 1 /classes/Product.php:6876
2719
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3799
0.259 ms 1 /classes/Product.php:2902
3426
SELECT SQL_NO_CACHE c.id_elementor FROM hgt78_iqit_elementor_category c WHERE c.id_category = 2 LIMIT 1
0.259 ms 1 /modules/iqitelementor/src/IqitElementorCategory.php:87
206
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 41 LIMIT 1
0.258 ms 1 /classes/Product.php:5659
3222
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3984
0.258 ms 1 /classes/Product.php:2902
3384
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 9830
0.258 ms 1 /classes/Product.php:2902
3484
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 190) LIMIT 1
0.258 ms 1 /src/Adapter/EntityMapper.php:71
1283
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 44 LIMIT 1
0.257 ms 1 /classes/Product.php:5659
1296
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4005
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.257 ms 0 /classes/SpecificPrice.php:259
1664
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4699 AND id_shop=1 LIMIT 1
0.257 ms 1 /classes/Product.php:6876
2063
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 5101 AND `id_group` = 1 LIMIT 1
0.257 ms 0 /classes/GroupReduction.php:156
2427
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 9769) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.257 ms 1 /classes/stock/StockAvailable.php:453
2651
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 200 LIMIT 1
0.257 ms 1 /classes/Product.php:5659
2691
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 9851) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.257 ms 1 /classes/stock/StockAvailable.php:453
3351
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 9773
0.257 ms 1 /classes/Product.php:2902
2156
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 200 LIMIT 1
0.257 ms 1 /classes/Product.php:5659
433
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3198
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.256 ms 0 /classes/SpecificPrice.php:259
509
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3235 LIMIT 1
0.256 ms 10 /classes/SpecificPrice.php:435
847
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 5074 AND `id_group` = 1 LIMIT 1
0.256 ms 0 /classes/GroupReduction.php:156
2095
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 5640 AND id_shop=1 LIMIT 1
0.256 ms 1 /classes/Product.php:6876
1940
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3979 AND id_shop=1 LIMIT 1
0.256 ms 1 /classes/Product.php:6876
2081
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 5352
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.256 ms 0 /classes/SpecificPrice.php:259
756
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3802 AND id_shop=1 LIMIT 1
0.255 ms 1 /classes/Product.php:6876
2062
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 5101 AND id_shop=1 LIMIT 1
0.255 ms 1 /classes/Product.php:6876
3303
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 9723
0.255 ms 1 /classes/Product.php:2902
3504
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 70) LIMIT 1
0.255 ms 1 /src/Adapter/EntityMapper.php:71
3491
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 344) LIMIT 1
0.255 ms 1 /src/Adapter/EntityMapper.php:71
245
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2504 AND `id_group` = 1 LIMIT 1
0.254 ms 0 /classes/GroupReduction.php:156
691
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3946 AND `id_group` = 1 LIMIT 1
0.254 ms 0 /classes/GroupReduction.php:156
1316
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 44 LIMIT 1
0.254 ms 1 /classes/Product.php:5659
1406
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 46 LIMIT 1
0.254 ms 1 /classes/Product.php:5659
2653
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 9848
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.254 ms 0 /classes/SpecificPrice.php:259
325
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2834 AND `id_group` = 1 LIMIT 1
0.253 ms 0 /classes/GroupReduction.php:156
2051
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 5085 AND id_shop=1 LIMIT 1
0.253 ms 1 /classes/Product.php:6876
2842
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3520
0.253 ms 1 /classes/Product.php:2902
3210
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3980
0.253 ms 1 /classes/Product.php:2902
160
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 44 LIMIT 1
0.252 ms 1 /classes/Product.php:5659
2167
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 70 LIMIT 1
0.252 ms 1 /classes/Product.php:5659
2251
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 8969) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.252 ms 1 /classes/stock/StockAvailable.php:453
2734
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2475
0.252 ms 1 /classes/Product.php:2902
42
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 34) AND (b.`id_shop` = 1) LIMIT 1
0.251 ms 1 /src/Adapter/EntityMapper.php:71
852
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 44 LIMIT 1
0.251 ms 1 /classes/Product.php:5659
1285
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 10235
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.251 ms 1 /classes/SpecificPrice.php:259
3606
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 47 AND `id_shop` = 1
0.251 ms 6 /src/Adapter/EntityMapper.php:79
487
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3028 LIMIT 1
0.250 ms 11 /classes/SpecificPrice.php:435
968
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3988 AND id_shop=1 LIMIT 1
0.250 ms 1 /classes/Product.php:6876
2229
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 8947) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.250 ms 1 /classes/stock/StockAvailable.php:453
3013
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 8357
0.250 ms 1 /classes/Product.php:2902
1516
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 199 LIMIT 1
0.250 ms 1 /classes/Product.php:5659
1903
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4488 LIMIT 1
0.250 ms 10 /classes/SpecificPrice.php:435
1985
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3983 AND `id_group` = 1 LIMIT 1
0.250 ms 0 /classes/GroupReduction.php:156
2641
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 9847 LIMIT 1
0.250 ms 11 /classes/SpecificPrice.php:435
746
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3951 AND `id_group` = 1 LIMIT 1
0.249 ms 0 /classes/GroupReduction.php:156
52
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 44) AND (b.`id_shop` = 1) LIMIT 1
0.249 ms 1 /src/Adapter/EntityMapper.php:71
391
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2899 AND id_shop=1 LIMIT 1
0.249 ms 1 /classes/Product.php:6876
664
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3944 LIMIT 1
0.249 ms 10 /classes/SpecificPrice.php:435
1383
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 46 LIMIT 1
0.249 ms 1 /classes/Product.php:5659
1499
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4239 AND id_shop=1 LIMIT 1
0.249 ms 1 /classes/Product.php:6876
2797
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2945
0.249 ms 1 /classes/Product.php:2902
2443
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 9772 LIMIT 1
0.248 ms 11 /classes/SpecificPrice.php:435
437
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3198 AND `id_group` = 1 LIMIT 1
0.248 ms 0 /classes/GroupReduction.php:156
1621
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4580 AND `id_group` = 1 LIMIT 1
0.248 ms 0 /classes/GroupReduction.php:156
1804
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 5104
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.248 ms 0 /classes/SpecificPrice.php:259
2201
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 8429 LIMIT 1
0.248 ms 10 /classes/SpecificPrice.php:435
3025
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 9521
0.248 ms 1 /classes/Product.php:2902
3237
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 5085
0.248 ms 1 /classes/Product.php:2902
3246
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 5352
0.248 ms 1 /classes/Product.php:2902
5
SELECT SQL_NO_CACHE su.physical_uri, su.virtual_uri, su.domain, su.domain_ssl
FROM hgt78_shop s
LEFT JOIN hgt78_shop_url su ON (s.id_shop = su.id_shop)
WHERE s.id_shop = 1
AND s.active = 1 AND s.deleted = 0 AND su.main = 1 LIMIT 1
0.247 ms 1 /classes/shop/Shop.php:218
162
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3795
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.247 ms 0 /classes/SpecificPrice.php:259
241
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2504
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.247 ms 0 /classes/SpecificPrice.php:259
2304
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 9742 AND id_shop=1 LIMIT 1
0.247 ms 1 /classes/Product.php:6876
2465
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 9774 LIMIT 1
0.247 ms 11 /classes/SpecificPrice.php:435
3132
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4699
0.247 ms 1 /classes/Product.php:2902
665
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3944
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.246 ms 0 /classes/SpecificPrice.php:259
1600
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4540) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.246 ms 1 /classes/stock/StockAvailable.php:453
2537
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 9794) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.246 ms 1 /classes/stock/StockAvailable.php:453
2548
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 9819) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.246 ms 1 /classes/stock/StockAvailable.php:453
1139
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 78 LIMIT 1
0.246 ms 1 /classes/Product.php:5659
44
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 36) AND (b.`id_shop` = 1) LIMIT 1
0.245 ms 1 /src/Adapter/EntityMapper.php:71
3016
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4002
0.245 ms 1 /classes/Product.php:2902
332
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2835
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.245 ms 0 /classes/SpecificPrice.php:259
1908
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4488 AND `id_group` = 1 LIMIT 1
0.244 ms 0 /classes/GroupReduction.php:156
488
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3028
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.244 ms 0 /classes/SpecificPrice.php:259
1020
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 6054
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.244 ms 0 /classes/SpecificPrice.php:259
1311
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 10236 AND `id_group` = 1 LIMIT 1
0.244 ms 0 /classes/GroupReduction.php:156
1340
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4017
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.244 ms 0 /classes/SpecificPrice.php:259
1523
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4413) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.244 ms 1 /classes/stock/StockAvailable.php:453
3126
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4583
0.244 ms 1 /classes/Product.php:2902
3225
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2930
0.244 ms 1 /classes/Product.php:2902
2416
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 9768) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.243 ms 1 /classes/stock/StockAvailable.php:453
6
SELECT SQL_NO_CACHE l.*, ls.`id_shop`
FROM `hgt78_lang` l
LEFT JOIN `hgt78_lang_shop` ls ON (l.id_lang = ls.id_lang)
0.243 ms 6 /classes/Language.php:1080
986
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3989 LIMIT 1
0.243 ms 10 /classes/SpecificPrice.php:435
1610
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4541 AND `id_group` = 1 LIMIT 1
0.243 ms 0 /classes/GroupReduction.php:156
2453
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 200 LIMIT 1
0.243 ms 1 /classes/Product.php:5659
2591
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 9842 AND `id_group` = 1 LIMIT 1
0.243 ms 0 /classes/GroupReduction.php:156
3878
SELECT SQL_NO_CACHE `id_module` FROM `hgt78_module_shop` WHERE `id_module` = 22 AND `id_shop` = 1 LIMIT 1
0.242 ms 1 /classes/module/Module.php:2137
1294
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 78 LIMIT 1
0.242 ms 1 /classes/Product.php:5659
1521
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4413 AND id_shop=1 LIMIT 1
0.242 ms 1 /classes/Product.php:6876
2191
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 6135
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.242 ms 0 /classes/SpecificPrice.php:259
3474
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 72) LIMIT 1
0.242 ms 1 /src/Adapter/EntityMapper.php:71
45
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 37) AND (b.`id_shop` = 1) LIMIT 1
0.241 ms 1 /src/Adapter/EntityMapper.php:71
230
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2513
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.241 ms 0 /classes/SpecificPrice.php:259
718
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 199 LIMIT 1
0.241 ms 1 /classes/Product.php:5659
2646
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 9847 AND `id_group` = 1 LIMIT 1
0.241 ms 0 /classes/GroupReduction.php:156
3348
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 9772
0.241 ms 1 /classes/Product.php:2902
177
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2415 AND `id_group` = 1 LIMIT 1
0.241 ms 0 /classes/GroupReduction.php:156
558
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3258 AND `id_group` = 1 LIMIT 1
0.240 ms 0 /classes/GroupReduction.php:156
651
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 70 LIMIT 1
0.240 ms 1 /classes/Product.php:5659
696
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 199 LIMIT 1
0.240 ms 1 /classes/Product.php:5659
1570
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4507
AND image_shop.`cover` = 1 LIMIT 1
0.240 ms 1 /classes/Product.php:3570
1637
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 199 LIMIT 1
0.240 ms 1 /classes/Product.php:5659
2568
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 9821 AND id_shop=1 LIMIT 1
0.240 ms 1 /classes/Product.php:6876
2656
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 9848 AND id_shop=1 LIMIT 1
0.240 ms 1 /classes/Product.php:6876
1007
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 44 LIMIT 1
0.240 ms 1 /classes/Product.php:5659
1665
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4699 AND `id_group` = 1 LIMIT 1
0.240 ms 0 /classes/GroupReduction.php:156
3494
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 45) LIMIT 1
0.240 ms 1 /src/Adapter/EntityMapper.php:71
3859
SELECT SQL_NO_CACHE `id_module` FROM `hgt78_module` WHERE `name` = "ps_categorytree" LIMIT 1
0.240 ms 1 /classes/module/Module.php:2664
185
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2475
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.239 ms 0 /classes/SpecificPrice.php:259
454
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3199 LIMIT 1
0.239 ms 10 /classes/SpecificPrice.php:435
997
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3990 LIMIT 1
0.239 ms 10 /classes/SpecificPrice.php:435
1488
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4238 AND id_shop=1 LIMIT 1
0.239 ms 1 /classes/Product.php:6876
2244
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 70 LIMIT 1
0.239 ms 1 /classes/Product.php:5659
3243
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 5328
0.239 ms 1 /classes/Product.php:2902
690
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3946 AND id_shop=1 LIMIT 1
0.239 ms 1 /classes/Product.php:6876
1559
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4506
AND image_shop.`cover` = 1 LIMIT 1
0.239 ms 1 /classes/Product.php:3570
2257
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 8970
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.239 ms 0 /classes/SpecificPrice.php:259
1365
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4019 AND id_shop=1 LIMIT 1
0.238 ms 1 /classes/Product.php:6876
1957
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 34 LIMIT 1
0.238 ms 1 /classes/Product.php:5659
2305
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 9742 AND `id_group` = 1 LIMIT 1
0.238 ms 0 /classes/GroupReduction.php:156
303
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2601 AND `id_group` = 1 LIMIT 1
0.238 ms 0 /classes/GroupReduction.php:156
886
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 5373 LIMIT 1
0.238 ms 10 /classes/SpecificPrice.php:435
1858
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 5336 LIMIT 1
0.238 ms 10 /classes/SpecificPrice.php:435
1914
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4489 LIMIT 1
0.238 ms 10 /classes/SpecificPrice.php:435
2234
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 8948 LIMIT 1
0.238 ms 9 /classes/SpecificPrice.php:435
2830
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3257
0.238 ms 1 /classes/Product.php:2902
3471
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 50 AND `id_shop` = 1
0.238 ms 6 /src/Adapter/EntityMapper.php:79
165
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3795 AND id_shop=1 LIMIT 1
0.237 ms 1 /classes/Product.php:6876
1626
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 199 LIMIT 1
0.237 ms 1 /classes/Product.php:5659
1631
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4582 AND id_shop=1 LIMIT 1
0.237 ms 1 /classes/Product.php:6876
1856
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 5336
AND image_shop.`cover` = 1 LIMIT 1
0.237 ms 2 /classes/Product.php:3570
1952
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3980 AND `id_group` = 1 LIMIT 1
0.237 ms 0 /classes/GroupReduction.php:156
2421
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 9769 LIMIT 1
0.237 ms 11 /classes/SpecificPrice.php:435
2557
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 9820 AND id_shop=1 LIMIT 1
0.237 ms 1 /classes/Product.php:6876
3505
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 70 AND `id_shop` = 1
0.237 ms 6 /src/Adapter/EntityMapper.php:79
508
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 200 LIMIT 1
0.236 ms 1 /classes/Product.php:5659
897
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3985 LIMIT 1
0.236 ms 10 /classes/SpecificPrice.php:435
996
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 78 LIMIT 1
0.236 ms 1 /classes/Product.php:5659
1263
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 9521
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.236 ms 0 /classes/SpecificPrice.php:259
1424
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4032) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.236 ms 1 /classes/stock/StockAvailable.php:453
1526
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4490
AND image_shop.`cover` = 1 LIMIT 1
0.236 ms 1 /classes/Product.php:3570
2476
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 9788 LIMIT 1
0.236 ms 11 /classes/SpecificPrice.php:435
2524
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 9792 AND id_shop=1 LIMIT 1
0.236 ms 1 /classes/Product.php:6876
2596
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 200 LIMIT 1
0.236 ms 1 /classes/Product.php:5659
2635
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 9846 AND `id_group` = 1 LIMIT 1
0.236 ms 0 /classes/GroupReduction.php:156
2675
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 9850
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.236 ms 0 /classes/SpecificPrice.php:259
2836
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3497
0.236 ms 1 /classes/Product.php:2902
2130
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 6018) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.236 ms 1 /classes/stock/StockAvailable.php:453
431
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 45 LIMIT 1
0.235 ms 1 /classes/Product.php:5659
835
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4947 AND id_shop=1 LIMIT 1
0.235 ms 1 /classes/Product.php:6876
1551
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4492
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.235 ms 0 /classes/SpecificPrice.php:259
1653
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4698 AND id_shop=1 LIMIT 1
0.235 ms 1 /classes/Product.php:6876
3485
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 190 AND `id_shop` = 1
0.235 ms 6 /src/Adapter/EntityMapper.php:79
731
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3801
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.235 ms 0 /classes/SpecificPrice.php:259
53
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 319) AND (b.`id_shop` = 1) LIMIT 1
0.234 ms 1 /src/Adapter/EntityMapper.php:71
1451
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4035 LIMIT 1
0.234 ms 10 /classes/SpecificPrice.php:435
3324
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 9747
0.234 ms 1 /classes/Product.php:2902
3497
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 46) LIMIT 1
0.234 ms 1 /src/Adapter/EntityMapper.php:71
298
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2601 LIMIT 1
0.234 ms 10 /classes/SpecificPrice.php:435
951
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 89 LIMIT 1
0.234 ms 1 /classes/Product.php:5659
2706
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 200 LIMIT 1
0.234 ms 1 /classes/Product.php:5659
1277
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4004 AND id_shop=1 LIMIT 1
0.233 ms 1 /classes/Product.php:6876
1299
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4005 AND id_shop=1 LIMIT 1
0.233 ms 1 /classes/Product.php:6876
2609
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 9844
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.233 ms 0 /classes/SpecificPrice.php:259
2631
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 9846
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.233 ms 0 /classes/SpecificPrice.php:259
2722
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3797
0.233 ms 1 /classes/Product.php:2902
685
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 199 LIMIT 1
0.232 ms 1 /classes/Product.php:5659
970
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3988) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.232 ms 1 /classes/stock/StockAvailable.php:453
2359
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 9747 AND id_shop=1 LIMIT 1
0.232 ms 1 /classes/Product.php:6876
2552
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 199 LIMIT 1
0.232 ms 1 /classes/Product.php:5659
3874
SELECT SQL_NO_CACHE button1 FROM hgt78_lgcookieslaw_lang WHERE id_lang = 1 LIMIT 1
0.232 ms 1 /modules/lgcookieslaw/lgcookieslaw.php:161
129
SELECT SQL_NO_CACHE *
FROM `hgt78_tax_lang`
WHERE `id_tax` = 1
0.231 ms 6 /src/Adapter/EntityMapper.php:79
171
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 44 LIMIT 1
0.231 ms 1 /classes/Product.php:5659
2184
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 6134 AND `id_group` = 1 LIMIT 1
0.231 ms 0 /classes/GroupReduction.php:156
2392
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 9752 AND id_shop=1 LIMIT 1
0.231 ms 1 /classes/Product.php:6876
2447
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 9772 AND id_shop=1 LIMIT 1
0.231 ms 1 /classes/Product.php:6876
3327
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 9749
0.231 ms 1 /classes/Product.php:2902
3482
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 186) LIMIT 1
0.231 ms 1 /src/Adapter/EntityMapper.php:71
3475
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 72 AND `id_shop` = 1
0.231 ms 6 /src/Adapter/EntityMapper.php:79
590
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3520 AND id_shop=1 LIMIT 1
0.230 ms 1 /classes/Product.php:6876
658
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3943) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.230 ms 1 /classes/stock/StockAvailable.php:453
1001
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3990 AND id_shop=1 LIMIT 1
0.230 ms 1 /classes/Product.php:6876
1681
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 200 LIMIT 1
0.230 ms 1 /classes/Product.php:5659
3022
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4003
0.230 ms 1 /classes/Product.php:2902
3433
SELECT SQL_NO_CACHE id_group FROM hgt78_cart_rule_group WHERE id_cart_rule = 0
0.230 ms 1 /classes/CartRule.php:438
1419
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4032
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.230 ms 0 /classes/SpecificPrice.php:259
1507
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4241
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.229 ms 0 /classes/SpecificPrice.php:259
1518
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4413
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.229 ms 0 /classes/SpecificPrice.php:259
2410
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 9768 LIMIT 1
0.229 ms 11 /classes/SpecificPrice.php:435
2601
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 9843 AND id_shop=1 LIMIT 1
0.229 ms 1 /classes/Product.php:6876
2658
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 9848) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.229 ms 1 /classes/stock/StockAvailable.php:453
2695
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 200 LIMIT 1
0.229 ms 1 /classes/Product.php:5659
3034
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4005
0.229 ms 1 /classes/Product.php:2902
3478
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 175) LIMIT 1
0.228 ms 1 /src/Adapter/EntityMapper.php:71
43
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 35) AND (b.`id_shop` = 1) LIMIT 1
0.228 ms 1 /src/Adapter/EntityMapper.php:71
76
SELECT SQL_NO_CACHE *
FROM `hgt78_carrier_lang`
WHERE `id_carrier` = 282 AND `id_shop` = 1
0.228 ms 198 /src/Adapter/EntityMapper.php:79
1310
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 10236 AND id_shop=1 LIMIT 1
0.228 ms 1 /classes/Product.php:6876
2041
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 5083 AND `id_group` = 1 LIMIT 1
0.228 ms 0 /classes/GroupReduction.php:156
3476
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 172) LIMIT 1
0.227 ms 1 /src/Adapter/EntityMapper.php:71
11
SELECT SQL_NO_CACHE domain, domain_ssl
FROM hgt78_shop_url
WHERE main = 1
AND id_shop = 1 LIMIT 1
0.227 ms 1 /classes/shop/ShopUrl.php:182
1632
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4582 AND `id_group` = 1 LIMIT 1
0.227 ms 0 /classes/GroupReduction.php:156
2238
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 8948 AND id_shop=1 LIMIT 1
0.227 ms 1 /classes/Product.php:6876
2565
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 9821
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.227 ms 0 /classes/SpecificPrice.php:259
2740
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2502
0.227 ms 1 /classes/Product.php:2902
9
SELECT SQL_NO_CACHE *
FROM `hgt78_lang` a
LEFT JOIN `hgt78_lang_shop` `c` ON a.`id_lang` = c.`id_lang` AND c.`id_shop` = 1
WHERE (a.`id_lang` = 1) LIMIT 1
0.226 ms 1 /src/Adapter/EntityMapper.php:71
735
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3801 AND `id_group` = 1 LIMIT 1
0.226 ms 0 /classes/GroupReduction.php:156
979
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 5510 AND id_shop=1 LIMIT 1
0.226 ms 1 /classes/Product.php:6876
1880
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 5638 LIMIT 1
0.226 ms 10 /classes/SpecificPrice.php:435
2029
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 5084 AND id_shop=1 LIMIT 1
0.226 ms 1 /classes/Product.php:6876
2194
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 6135 AND id_shop=1 LIMIT 1
0.226 ms 1 /classes/Product.php:6876
2354
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 54 LIMIT 1
0.226 ms 1 /classes/Product.php:5659
2541
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 199 LIMIT 1
0.226 ms 1 /classes/Product.php:5659
753
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3802
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.225 ms 0 /classes/SpecificPrice.php:259
1141
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3997
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.225 ms 0 /classes/SpecificPrice.php:259
1873
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 5337 AND id_shop=1 LIMIT 1
0.225 ms 1 /classes/Product.php:6876
1924
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 34 LIMIT 1
0.225 ms 1 /classes/Product.php:5659
2360
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 9747 AND `id_group` = 1 LIMIT 1
0.225 ms 0 /classes/GroupReduction.php:156
2393
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 9752 AND `id_group` = 1 LIMIT 1
0.225 ms 0 /classes/GroupReduction.php:156
2464
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 200 LIMIT 1
0.225 ms 1 /classes/Product.php:5659
3375
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 9819
0.225 ms 1 /classes/Product.php:2902
3339
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 9768
0.225 ms 1 /classes/Product.php:2902
757
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3802 AND `id_group` = 1 LIMIT 1
0.224 ms 0 /classes/GroupReduction.php:156
1223
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 8357 AND `id_group` = 1 LIMIT 1
0.224 ms 0 /classes/GroupReduction.php:156
1466
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4036 AND id_shop=1 LIMIT 1
0.224 ms 1 /classes/Product.php:6876
2092
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 5640
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.224 ms 0 /classes/SpecificPrice.php:259
2246
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 8969
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.224 ms 0 /classes/SpecificPrice.php:259
1890
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 45 LIMIT 1
0.224 ms 1 /classes/Product.php:5659
2668
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 9849 AND `id_group` = 1 LIMIT 1
0.224 ms 0 /classes/GroupReduction.php:156
3019
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 8637
0.224 ms 1 /classes/Product.php:2902
26
SELECT SQL_NO_CACHE *
FROM `hgt78_currency` a
LEFT JOIN `hgt78_currency_lang` `b` ON a.`id_currency` = b.`id_currency` AND b.`id_lang` = 1
LEFT JOIN `hgt78_currency_shop` `c` ON a.`id_currency` = c.`id_currency` AND c.`id_shop` = 1
WHERE (a.`id_currency` = 1) LIMIT 1
0.223 ms 1 /src/Adapter/EntityMapper.php:71
1440
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4034 LIMIT 1
0.223 ms 10 /classes/SpecificPrice.php:435
1628
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4582
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.223 ms 0 /classes/SpecificPrice.php:259
1853
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 5167) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.223 ms 1 /classes/stock/StockAvailable.php:453
1919
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4489 AND `id_group` = 1 LIMIT 1
0.223 ms 0 /classes/GroupReduction.php:156
2400
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 9767
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.223 ms 0 /classes/SpecificPrice.php:259
2531
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 9794 LIMIT 1
0.223 ms 11 /classes/SpecificPrice.php:435
3333
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 9752
0.223 ms 1 /classes/Product.php:2902
244
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2504 AND id_shop=1 LIMIT 1
0.222 ms 1 /classes/Product.php:6876
2403
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 9767 AND id_shop=1 LIMIT 1
0.222 ms 1 /classes/Product.php:6876
3342
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 9769
0.222 ms 1 /classes/Product.php:2902
3480
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 185) LIMIT 1
0.222 ms 1 /src/Adapter/EntityMapper.php:71
3498
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 46 AND `id_shop` = 1
0.222 ms 6 /src/Adapter/EntityMapper.php:79
23
SELECT SQL_NO_CACHE * FROM `hgt78_currency` c ORDER BY `iso_code` ASC
0.221 ms 2 Yes /classes/Currency.php:709
290
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2889 AND id_shop=1 LIMIT 1
0.221 ms 1 /classes/Product.php:6876
3378
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 9820
0.221 ms 1 /classes/Product.php:2902
1477
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4236 AND id_shop=1 LIMIT 1
0.221 ms 1 /classes/Product.php:6876
1256
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4003 AND `id_group` = 1 LIMIT 1
0.220 ms 0 /classes/GroupReduction.php:156
1593
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 200 LIMIT 1
0.220 ms 1 /classes/Product.php:5659
1809
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 5104) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.220 ms 1 /classes/stock/StockAvailable.php:453
1831
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 5165) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.220 ms 1 /classes/stock/StockAvailable.php:453
2535
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 9794 AND id_shop=1 LIMIT 1
0.220 ms 1 /classes/Product.php:6876
2598
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 9843
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.220 ms 0 /classes/SpecificPrice.php:259
2700
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 9852 AND id_shop=1 LIMIT 1
0.220 ms 1 /classes/Product.php:6876
3345
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 9771
0.220 ms 1 /classes/Product.php:2902
3492
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 344 AND `id_shop` = 1
0.220 ms 6 /src/Adapter/EntityMapper.php:79
199
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2447 AND id_shop=1 LIMIT 1
0.219 ms 1 /classes/Product.php:6876
302
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2601 AND id_shop=1 LIMIT 1
0.219 ms 1 /classes/Product.php:6876
2046
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 78 LIMIT 1
0.219 ms 1 /classes/Product.php:5659
2151
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 6024 AND `id_group` = 1 LIMIT 1
0.219 ms 0 /classes/GroupReduction.php:156
355
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2836
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.219 ms 0 /classes/SpecificPrice.php:259
1964
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3981) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.219 ms 1 /classes/stock/StockAvailable.php:453
2348
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 9746 AND id_shop=1 LIMIT 1
0.219 ms 1 /classes/Product.php:6876
2431
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 54 LIMIT 1
0.219 ms 1 /classes/Product.php:5659
3336
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 9767
0.219 ms 1 /classes/Product.php:2902
57
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 18) AND (b.`id_shop` = 1) LIMIT 1
0.218 ms 1 /src/Adapter/EntityMapper.php:71
586
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3520 LIMIT 1
0.218 ms 10 /classes/SpecificPrice.php:435
879
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 5113 AND id_shop=1 LIMIT 1
0.218 ms 1 /classes/Product.php:6876
662
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `hgt78_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 199 LIMIT 1
0.218 ms 1 /classes/Category.php:1378
2508
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 200 LIMIT 1
0.218 ms 1 /classes/Product.php:5659
2558
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 9820 AND `id_group` = 1 LIMIT 1
0.218 ms 0 /classes/GroupReduction.php:156
2746
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2513
0.218 ms 1 /classes/Product.php:2902
3252
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 5641
0.218 ms 1 /classes/Product.php:2902
969
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3988 AND `id_group` = 1 LIMIT 1
0.217 ms 0 /classes/GroupReduction.php:156
3387
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 9842
0.217 ms 1 /classes/Product.php:2902
459
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3199 AND `id_group` = 1 LIMIT 1
0.217 ms 0 /classes/GroupReduction.php:156
1474
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4236
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.217 ms 0 /classes/SpecificPrice.php:259
2150
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 6024 AND id_shop=1 LIMIT 1
0.217 ms 1 /classes/Product.php:6876
46
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 38) AND (b.`id_shop` = 1) LIMIT 1
0.216 ms 1 /src/Adapter/EntityMapper.php:71
54
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 11) AND (b.`id_shop` = 1) LIMIT 1
0.216 ms 1 /src/Adapter/EntityMapper.php:71
119
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE `from` BETWEEN '2025-05-01 00:00:00' AND '2025-05-01 23:59:59' LIMIT 1
0.216 ms 1 /classes/SpecificPrice.php:377
173
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2415
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.216 ms 0 /classes/SpecificPrice.php:259
310
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2890
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.216 ms 0 /classes/SpecificPrice.php:259
1654
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4698 AND `id_group` = 1 LIMIT 1
0.216 ms 0 /classes/GroupReduction.php:156
60
SELECT SQL_NO_CACHE `id_module` FROM `hgt78_module` WHERE `name` = "ps_accounts" LIMIT 1
0.215 ms 1 /src/Adapter/Module/ModuleDataProvider.php:257
369
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2944 AND id_shop=1 LIMIT 1
0.215 ms 1 /classes/Product.php:6876
486
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 44 LIMIT 1
0.215 ms 1 /classes/Product.php:5659
510
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3235
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.215 ms 0 /classes/SpecificPrice.php:259
946
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3987 AND `id_group` = 1 LIMIT 1
0.215 ms 0 /classes/GroupReduction.php:156
1300
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4005 AND `id_group` = 1 LIMIT 1
0.215 ms 0 /classes/GroupReduction.php:156
1540
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4491
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.215 ms 0 /classes/SpecificPrice.php:259
1915
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4489
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.215 ms 0 /classes/SpecificPrice.php:259
2420
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 54 LIMIT 1
0.215 ms 1 /classes/Product.php:5659
2475
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 200 LIMIT 1
0.215 ms 1 /classes/Product.php:5659
2749
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2504
0.215 ms 1 /classes/Product.php:2902
3483
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 186 AND `id_shop` = 1
0.215 ms 6 /src/Adapter/EntityMapper.php:79
2189
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 200 LIMIT 1
0.215 ms 1 /classes/Product.php:5659
2486
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 200 LIMIT 1
0.215 ms 1 /classes/Product.php:5659
80
SELECT SQL_NO_CACHE * FROM hgt78_delivery WHERE id_carrier = 282 LIMIT 1
0.214 ms 8 /modules/colissimo_simplicite/colissimo_simplicite.php:1420
81
SELECT SQL_NO_CACHE `id_category`
FROM `hgt78_category_shop`
WHERE `id_category` = 2
AND `id_shop` = 1 LIMIT 1
0.214 ms 1 /classes/Category.php:2450
491
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3028 AND id_shop=1 LIMIT 1
0.214 ms 1 /classes/Product.php:6876
898
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3985
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.214 ms 0 /classes/SpecificPrice.php:259
909
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 5415
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.214 ms 0 /classes/SpecificPrice.php:259
1009
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 6053
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.214 ms 0 /classes/SpecificPrice.php:259
1408
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4030
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.214 ms 0 /classes/SpecificPrice.php:259
2546
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 9819 AND id_shop=1 LIMIT 1
0.214 ms 1 /classes/Product.php:6876
2634
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 9846 AND id_shop=1 LIMIT 1
0.214 ms 1 /classes/Product.php:6876
4
SELECT SQL_NO_CACHE *
FROM `hgt78_shop` a
WHERE (a.`id_shop` = 1) LIMIT 1
0.214 ms 1 /src/Adapter/EntityMapper.php:71
1522
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4413 AND `id_group` = 1 LIMIT 1
0.214 ms 0 /classes/GroupReduction.php:156
67
SELECT SQL_NO_CACHE *
FROM `hgt78_country_lang`
WHERE `id_country` = 8
0.213 ms 6 /src/Adapter/EntityMapper.php:79
228
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 44 LIMIT 1
0.213 ms 1 /classes/Product.php:5659
720
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3950
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.213 ms 0 /classes/SpecificPrice.php:259
2059
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 5101
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.213 ms 0 /classes/SpecificPrice.php:259
892
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 5373) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.213 ms 1 /classes/stock/StockAvailable.php:453
1428
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 54 LIMIT 1
0.213 ms 1 /classes/Product.php:5659
1907
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4488 AND id_shop=1 LIMIT 1
0.213 ms 1 /classes/Product.php:6876
1996
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3984 AND `id_group` = 1 LIMIT 1
0.213 ms 0 /classes/GroupReduction.php:156
687
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3946
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.212 ms 0 /classes/SpecificPrice.php:259
1402
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4029) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.212 ms 1 /classes/stock/StockAvailable.php:453
2213
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 8946
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.212 ms 0 /classes/SpecificPrice.php:259
2530
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 200 LIMIT 1
0.212 ms 1 /classes/Product.php:5659
2547
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 9819 AND `id_group` = 1 LIMIT 1
0.212 ms 0 /classes/GroupReduction.php:156
55
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 12) AND (b.`id_shop` = 1) LIMIT 1
0.212 ms 1 /src/Adapter/EntityMapper.php:71
444
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3010
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.212 ms 0 /classes/SpecificPrice.php:259
723
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3950 AND id_shop=1 LIMIT 1
0.212 ms 1 /classes/Product.php:6876
942
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3987
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.212 ms 0 /classes/SpecificPrice.php:259
990
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3989 AND id_shop=1 LIMIT 1
0.212 ms 1 /classes/Product.php:6876
1595
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4540
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.212 ms 0 /classes/SpecificPrice.php:259
2442
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 199 LIMIT 1
0.212 ms 1 /classes/Product.php:5659
2444
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 9772
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.212 ms 0 /classes/SpecificPrice.php:259
2466
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 9774
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.212 ms 0 /classes/SpecificPrice.php:259
2686
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 9851
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.212 ms 1 /classes/SpecificPrice.php:259
1835
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 200 LIMIT 1
0.211 ms 1 /classes/Product.php:5659
1859
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 5336
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.211 ms 0 /classes/SpecificPrice.php:259
3330
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 9751
0.210 ms 1 /classes/Product.php:2902
956
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 5509 AND id_shop=1 LIMIT 1
0.210 ms 1 /classes/Product.php:6876
2037
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 5083
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.210 ms 0 /classes/SpecificPrice.php:259
18
SELECT SQL_NO_CACHE name, alias FROM `hgt78_hook_alias`
0.209 ms 88 /classes/Hook.php:342
2334
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 9745
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.209 ms 0 /classes/SpecificPrice.php:259
2642
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 9847
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.209 ms 0 /classes/SpecificPrice.php:259
987
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3989
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.208 ms 0 /classes/SpecificPrice.php:259
896
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 199 LIMIT 1
0.208 ms 1 /classes/Product.php:5659
2173
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 6105 AND `id_group` = 1 LIMIT 1
0.208 ms 0 /classes/GroupReduction.php:156
2183
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 6134 AND id_shop=1 LIMIT 1
0.208 ms 1 /classes/Product.php:6876
2477
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 9788
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.208 ms 0 /classes/SpecificPrice.php:259
3872
SELECT SQL_NO_CACHE required FROM hgt78_lgcookieslaw_lang WHERE id_lang = 1 LIMIT 1
0.208 ms 1 /modules/lgcookieslaw/lgcookieslaw.php:161
1289
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 10235 AND `id_group` = 1 LIMIT 1
0.207 ms 0 /classes/GroupReduction.php:156
2004
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2930
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.207 ms 0 /classes/SpecificPrice.php:259
1785
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 5102 AND id_shop=1 LIMIT 1
0.207 ms 1 /classes/Product.php:6876
2260
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 8970 AND id_shop=1 LIMIT 1
0.207 ms 1 /classes/Product.php:6876
2689
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 9851 AND id_shop=1 LIMIT 1
0.207 ms 1 /classes/Product.php:6876
79
SELECT SQL_NO_CACHE * FROM hgt78_range_price WHERE id_carrier = 282 LIMIT 1
0.206 ms 2 /modules/colissimo_simplicite/colissimo_simplicite.php:1415
724
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3950 AND `id_group` = 1 LIMIT 1
0.206 ms 0 /classes/GroupReduction.php:156
980
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 5510 AND `id_group` = 1 LIMIT 1
0.206 ms 0 /classes/GroupReduction.php:156
1012
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 6053 AND id_shop=1 LIMIT 1
0.206 ms 1 /classes/Product.php:6876
2425
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 9769 AND id_shop=1 LIMIT 1
0.206 ms 1 /classes/Product.php:6876
3473
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 62 AND `id_shop` = 1
0.206 ms 6 /src/Adapter/EntityMapper.php:79
48
SELECT SQL_NO_CACHE * FROM `hgt78_image_type` WHERE 1 AND `categories` = 1  ORDER BY `width` DESC, `height` DESC, `name`ASC
0.205 ms 8 Yes /classes/ImageType.php:109
1434
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4033 AND `id_group` = 1 LIMIT 1
0.205 ms 0 /classes/GroupReduction.php:156
1819
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 5164 AND `id_group` = 1 LIMIT 1
0.205 ms 0 /classes/GroupReduction.php:156
2414
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 9768 AND id_shop=1 LIMIT 1
0.205 ms 1 /classes/Product.php:6876
2554
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 9820
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.205 ms 0 /classes/SpecificPrice.php:259
1533
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4490 AND `id_group` = 1 LIMIT 1
0.205 ms 0 /classes/GroupReduction.php:156
2217
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 8946 AND `id_group` = 1 LIMIT 1
0.205 ms 0 /classes/GroupReduction.php:156
2532
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 9794
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.205 ms 0 /classes/SpecificPrice.php:259
455
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3199
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.204 ms 0 /classes/SpecificPrice.php:259
1423
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4032 AND `id_group` = 1 LIMIT 1
0.204 ms 0 /classes/GroupReduction.php:156
2052
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 5085 AND `id_group` = 1 LIMIT 1
0.204 ms 0 /classes/GroupReduction.php:156
2223
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 8947 LIMIT 1
0.204 ms 10 /classes/SpecificPrice.php:435
1847
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 5167 LIMIT 1
0.203 ms 10 /classes/SpecificPrice.php:435
2404
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 9767 AND `id_group` = 1 LIMIT 1
0.203 ms 0 /classes/GroupReduction.php:156
1913
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 34 LIMIT 1
0.203 ms 1 /classes/Product.php:5659
2469
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 9774 AND id_shop=1 LIMIT 1
0.203 ms 1 /classes/Product.php:6876
3028
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4004
0.203 ms 1 /classes/Product.php:2902
1389
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4022 AND id_shop=1 LIMIT 1
0.202 ms 1 /classes/Product.php:6876
2502
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 9790 AND id_shop=1 LIMIT 1
0.202 ms 1 /classes/Product.php:6876
71
SELECT SQL_NO_CACHE *
FROM `hgt78_shop_url` a0
0.202 ms 1 /classes/PrestaShopCollection.php:383
188
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2475 AND id_shop=1 LIMIT 1
0.202 ms 1 /classes/Product.php:6876
1489
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4238 AND `id_group` = 1 LIMIT 1
0.202 ms 0 /classes/GroupReduction.php:156
1808
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 5104 AND `id_group` = 1 LIMIT 1
0.202 ms 0 /classes/GroupReduction.php:156
1837
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 5166
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.202 ms 0 /classes/SpecificPrice.php:259
1840
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 5166 AND id_shop=1 LIMIT 1
0.202 ms 1 /classes/Product.php:6876
2048
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 5085
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.202 ms 0 /classes/SpecificPrice.php:259
3390
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 9843
0.202 ms 1 /classes/Product.php:2902
30
SELECT SQL_NO_CACHE *
FROM `hgt78_currency` a
LEFT JOIN `hgt78_currency_lang` `b` ON a.`id_currency` = b.`id_currency` AND b.`id_lang` = 1
LEFT JOIN `hgt78_currency_shop` `c` ON a.`id_currency` = c.`id_currency` AND c.`id_shop` = 1
WHERE (a.`id_currency` = 2) LIMIT 1
0.201 ms 1 /src/Adapter/EntityMapper.php:71
579
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3499 AND id_shop=1 LIMIT 1
0.201 ms 1 /classes/Product.php:6876
1478
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4236 AND `id_group` = 1 LIMIT 1
0.201 ms 0 /classes/GroupReduction.php:156
2519
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 200 LIMIT 1
0.201 ms 1 /classes/Product.php:5659
2712
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 10738 AND id_shop=1 LIMIT 1
0.201 ms 1 /classes/Product.php:6876
3031
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 10235
0.201 ms 1 /classes/Product.php:2902
657
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3943 AND `id_group` = 1 LIMIT 1
0.200 ms 0 /classes/GroupReduction.php:156
1963
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3981 AND `id_group` = 1 LIMIT 1
0.200 ms 0 /classes/GroupReduction.php:156
2480
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 9788 AND id_shop=1 LIMIT 1
0.199 ms 1 /classes/Product.php:6876
2510
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 9791
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.199 ms 0 /classes/SpecificPrice.php:259
2713
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 10738 AND `id_group` = 1 LIMIT 1
0.199 ms 0 /classes/GroupReduction.php:156
299
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2601
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.199 ms 0 /classes/SpecificPrice.php:259
836
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4947 AND `id_group` = 1 LIMIT 1
0.199 ms 0 /classes/GroupReduction.php:156
1578
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4507) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.199 ms 1 /classes/stock/StockAvailable.php:453
35
SELECT SQL_NO_CACHE *
FROM `hgt78_group` a
LEFT JOIN `hgt78_group_shop` `c` ON a.`id_group` = c.`id_group` AND c.`id_shop` = 1
WHERE (a.`id_group` = 1) LIMIT 1
0.198 ms 1 /src/Adapter/EntityMapper.php:71
481
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3200 AND `id_group` = 1 LIMIT 1
0.198 ms 0 /classes/GroupReduction.php:156
1371
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `hgt78_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 46 LIMIT 1
0.198 ms 1 /classes/Category.php:1378
2499
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 9790
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.198 ms 0 /classes/SpecificPrice.php:259
3354
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 9774
0.198 ms 1 /classes/Product.php:2902
3873
SELECT SQL_NO_CACHE additional FROM hgt78_lgcookieslaw_lang WHERE id_lang = 1 LIMIT 1
0.198 ms 1 /modules/lgcookieslaw/lgcookieslaw.php:161
3875
SELECT SQL_NO_CACHE button2 FROM hgt78_lgcookieslaw_lang WHERE id_lang = 1 LIMIT 1
0.198 ms 1 /modules/lgcookieslaw/lgcookieslaw.php:161
453
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 45 LIMIT 1
0.197 ms 1 /classes/Product.php:5659
2409
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 54 LIMIT 1
0.197 ms 1 /classes/Product.php:5659
2543
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 9819
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.197 ms 0 /classes/SpecificPrice.php:259
2678
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 9850 AND id_shop=1 LIMIT 1
0.197 ms 1 /classes/Product.php:6876
2673
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 200 LIMIT 1
0.196 ms 1 /classes/Product.php:5659
47
SELECT SQL_NO_CACHE state FROM hgt78_feature_flag WHERE name = 'multiple_image_format' LIMIT 1
0.196 ms 1 /classes/FeatureFlag.php:105
130
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3799 AND `id_group` = 1 LIMIT 1
0.196 ms 0 /classes/GroupReduction.php:156
1572
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4507 LIMIT 1
0.196 ms 10 /classes/SpecificPrice.php:435
1959
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3981
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.196 ms 0 /classes/SpecificPrice.php:259
2345
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 9746
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.196 ms 0 /classes/SpecificPrice.php:259
2436
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 9771 AND id_shop=1 LIMIT 1
0.196 ms 1 /classes/Product.php:6876
2685
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 9851 LIMIT 1
0.196 ms 11 /classes/SpecificPrice.php:435
3864
SELECT SQL_NO_CACHE c.`nleft`, c.`nright` FROM `hgt78_category` c
WHERE c.`id_category` = 1 LIMIT 1
0.196 ms 1 /classes/Category.php:1591
68
SELECT SQL_NO_CACHE id_required_field, object_name, field_name
FROM hgt78_required_field
0.195 ms 2 /classes/ObjectModel.php:1592
903
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3985) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.195 ms 1 /classes/stock/StockAvailable.php:453
1386
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4022
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.195 ms 0 /classes/SpecificPrice.php:259
1556
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4492) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.195 ms 1 /classes/stock/StockAvailable.php:453
2679
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 9850 AND `id_group` = 1 LIMIT 1
0.195 ms 0 /classes/GroupReduction.php:156
1444
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4034 AND id_shop=1 LIMIT 1
0.195 ms 1 /classes/Product.php:6876
2433
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 9771
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.194 ms 0 /classes/SpecificPrice.php:259
2455
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 9773
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.194 ms 0 /classes/SpecificPrice.php:259
2743
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2448
0.194 ms 1 /classes/Product.php:2902
2422
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 9769
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.194 ms 0 /classes/SpecificPrice.php:259
3424
SELECT SQL_NO_CACHE id_shop
FROM `hgt78_group_shop`
WHERE `id_group` = 1
AND id_shop = 1 LIMIT 1
0.194 ms 1 /classes/ObjectModel.php:1729
297
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 88 LIMIT 1
0.193 ms 1 /classes/Product.php:5659
580
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3499 AND `id_group` = 1 LIMIT 1
0.193 ms 0 /classes/GroupReduction.php:156
1467
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4036 AND `id_group` = 1 LIMIT 1
0.193 ms 0 /classes/GroupReduction.php:156
1851
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 5167 AND id_shop=1 LIMIT 1
0.193 ms 1 /classes/Product.php:6876
1948
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3980
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.193 ms 0 /classes/SpecificPrice.php:259
2202
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 8429
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.193 ms 0 /classes/SpecificPrice.php:259
2470
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 9774 AND `id_group` = 1 LIMIT 1
0.193 ms 0 /classes/GroupReduction.php:156
1582
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 200 LIMIT 1
0.192 ms 1 /classes/Product.php:5659
2448
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 9772 AND `id_group` = 1 LIMIT 1
0.192 ms 0 /classes/GroupReduction.php:156
2701
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 9852 AND `id_group` = 1 LIMIT 1
0.192 ms 0 /classes/GroupReduction.php:156
2488
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 9789
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.192 ms 0 /classes/SpecificPrice.php:259
3420
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 10738
0.192 ms 1 /classes/Product.php:2902
120
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE `to` BETWEEN '2025-05-01 00:00:00' AND '2025-05-01 23:59:59' LIMIT 1
0.191 ms 1 /classes/SpecificPrice.php:381
166
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3795 AND `id_group` = 1 LIMIT 1
0.191 ms 0 /classes/GroupReduction.php:156
2134
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 200 LIMIT 1
0.191 ms 1 /classes/Product.php:5659
1528
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4490 LIMIT 1
0.190 ms 10 /classes/SpecificPrice.php:435
1815
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 5164
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.190 ms 0 /classes/SpecificPrice.php:259
2491
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 9789 AND id_shop=1 LIMIT 1
0.190 ms 1 /classes/Product.php:6876
3255
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 5642
0.190 ms 1 /classes/Product.php:2902
1439
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 54 LIMIT 1
0.190 ms 1 /classes/Product.php:5659
1864
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 5336) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.189 ms 1 /classes/stock/StockAvailable.php:453
1941
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3979 AND `id_group` = 1 LIMIT 1
0.189 ms 0 /classes/GroupReduction.php:156
2602
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 9843 AND `id_group` = 1 LIMIT 1
0.189 ms 0 /classes/GroupReduction.php:156
3481
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 185 AND `id_shop` = 1
0.189 ms 6 /src/Adapter/EntityMapper.php:79
656
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3943 AND id_shop=1 LIMIT 1
0.188 ms 1 /classes/Product.php:6876
1786
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 5102 AND `id_group` = 1 LIMIT 1
0.188 ms 0 /classes/GroupReduction.php:156
3261
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 6023
0.188 ms 1 /classes/Product.php:2902
2212
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 8946 LIMIT 1
0.188 ms 16 /classes/SpecificPrice.php:435
74
SELECT SQL_NO_CACHE `id_module` FROM `hgt78_module` WHERE `name` = "colissimo_simplicite" LIMIT 1
0.187 ms 1 /classes/module/Module.php:2664
1807
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 5104 AND id_shop=1 LIMIT 1
0.187 ms 1 /classes/Product.php:6876
2195
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 6135 AND `id_group` = 1 LIMIT 1
0.187 ms 0 /classes/GroupReduction.php:156
998
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3990
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.186 ms 0 /classes/SpecificPrice.php:259
61
SELECT SQL_NO_CACHE `id_module` FROM `hgt78_module` WHERE `name` = "ps_legalcompliance" LIMIT 1
0.186 ms 0 /classes/module/Module.php:2664
876
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 5113
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.186 ms 0 /classes/SpecificPrice.php:259
985
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 78 LIMIT 1
0.186 ms 1 /classes/Product.php:5659
1818
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 5164 AND id_shop=1 LIMIT 1
0.186 ms 1 /classes/Product.php:6876
1886
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 5638) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.186 ms 1 /classes/stock/StockAvailable.php:453
2411
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 9768
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.186 ms 0 /classes/SpecificPrice.php:259
2415
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 9768 AND `id_group` = 1 LIMIT 1
0.186 ms 0 /classes/GroupReduction.php:156
2426
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 9769 AND `id_group` = 1 LIMIT 1
0.186 ms 0 /classes/GroupReduction.php:156
2684
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 200 LIMIT 1
0.186 ms 1 /classes/Product.php:5659
1567
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4506) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.185 ms 1 /classes/stock/StockAvailable.php:453
1857
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 70 LIMIT 1
0.185 ms 1 /classes/Product.php:5659
2200
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 78 LIMIT 1
0.185 ms 1 /classes/Product.php:5659
2492
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 9789 AND `id_group` = 1 LIMIT 1
0.185 ms 0 /classes/GroupReduction.php:156
2525
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 9792 AND `id_group` = 1 LIMIT 1
0.185 ms 0 /classes/GroupReduction.php:156
3318
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 9746
0.184 ms 1 /classes/Product.php:2902
3425
SELECT SQL_NO_CACHE ctg.`id_group`
FROM hgt78_category_group ctg
WHERE ctg.`id_category` = 2 AND ctg.`id_group` = 1 LIMIT 1
0.184 ms 1 /classes/Category.php:1754
1891
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 5639 LIMIT 1
0.183 ms 10 /classes/SpecificPrice.php:435
2514
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 9791 AND `id_group` = 1 LIMIT 1
0.182 ms 0 /classes/GroupReduction.php:156
3258
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 6018
0.182 ms 1 /classes/Product.php:2902
8
SELECT SQL_NO_CACHE *
FROM `hgt78_shop_group` a
WHERE (a.`id_shop_group` = 1) LIMIT 1
0.182 ms 1 /src/Adapter/EntityMapper.php:71
880
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 5113 AND `id_group` = 1 LIMIT 1
0.182 ms 0 /classes/GroupReduction.php:156
2349
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 9746 AND `id_group` = 1 LIMIT 1
0.182 ms 0 /classes/GroupReduction.php:156
2709
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 10738
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.182 ms 0 /classes/SpecificPrice.php:259
73
SELECT SQL_NO_CACHE `name`
FROM `hgt78_hook`
WHERE `id_hook` = 746 LIMIT 1
0.181 ms 1 /classes/Hook.php:247
1374
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4021
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.181 ms 0 /classes/SpecificPrice.php:259
1377
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4021 AND id_shop=1 LIMIT 1
0.181 ms 1 /classes/Product.php:6876
458
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3199 AND id_shop=1 LIMIT 1
0.180 ms 1 /classes/Product.php:6876
1455
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4035 AND id_shop=1 LIMIT 1
0.180 ms 1 /classes/Product.php:6876
2503
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 9790 AND `id_group` = 1 LIMIT 1
0.180 ms 0 /classes/GroupReduction.php:156
957
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 5509 AND `id_group` = 1 LIMIT 1
0.179 ms 0 /classes/GroupReduction.php:156
1869
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 5337 LIMIT 1
0.179 ms 10 /classes/SpecificPrice.php:435
2536
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 9794 AND `id_group` = 1 LIMIT 1
0.179 ms 0 /classes/GroupReduction.php:156
1897
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 5639) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.179 ms 1 /classes/stock/StockAvailable.php:453
20
SELECT SQL_NO_CACHE * FROM `hgt78_hook_module_exceptions`
WHERE `id_shop` IN (1)
0.178 ms 1 /classes/module/Module.php:2046
663
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 199 LIMIT 1
0.178 ms 1 /classes/Product.php:5659
1544
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4491 AND `id_group` = 1 LIMIT 1
0.178 ms 0 /classes/GroupReduction.php:156
1599
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4540 AND `id_group` = 1 LIMIT 1
0.178 ms 0 /classes/GroupReduction.php:156
1879
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 45 LIMIT 1
0.177 ms 1 /classes/Product.php:5659
2222
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 200 LIMIT 1
0.177 ms 1 /classes/Product.php:5659
1561
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4506 LIMIT 1
0.177 ms 10 /classes/SpecificPrice.php:435
2697
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 9852
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.177 ms 0 /classes/SpecificPrice.php:259
1366
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4019 AND `id_group` = 1 LIMIT 1
0.176 ms 0 /classes/GroupReduction.php:156
2128
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 6018 AND id_shop=1 LIMIT 1
0.176 ms 1 /classes/Product.php:6876
2481
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 9788 AND `id_group` = 1 LIMIT 1
0.176 ms 0 /classes/GroupReduction.php:156
24
SELECT SQL_NO_CACHE `id_lang` FROM `hgt78_lang`
WHERE `locale` = 'fr-fr'
OR `language_code` = 'fr-fr' LIMIT 1
0.175 ms 6 /classes/Language.php:883
1013
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 6053 AND `id_group` = 1 LIMIT 1
0.175 ms 0 /classes/GroupReduction.php:156
1430
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4033
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.175 ms 0 /classes/SpecificPrice.php:259
1904
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4488
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.175 ms 0 /classes/SpecificPrice.php:259
1396
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4029 LIMIT 1
0.174 ms 10 /classes/SpecificPrice.php:435
1450
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 54 LIMIT 1
0.174 ms 1 /classes/Product.php:5659
1901
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `hgt78_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 34 LIMIT 1
0.174 ms 1 /classes/Category.php:1378
887
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 5373
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.174 ms 0 /classes/SpecificPrice.php:259
72
SELECT SQL_NO_CACHE *
FROM `hgt78_shop_url` a0
0.173 ms 1 /classes/PrestaShopCollection.php:383
1549
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 200 LIMIT 1
0.172 ms 1 /classes/Product.php:5659
1852
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 5167 AND `id_group` = 1 LIMIT 1
0.172 ms 0 /classes/GroupReduction.php:156
1962
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3981 AND id_shop=1 LIMIT 1
0.172 ms 1 /classes/Product.php:6876
3860
SELECT SQL_NO_CACHE `id_module` FROM `hgt78_module_shop` WHERE `id_module` = 13 AND `id_shop` = 1 LIMIT 1
0.172 ms 1 /classes/module/Module.php:2137
64
SELECT SQL_NO_CACHE format
FROM `hgt78_address_format`
WHERE `id_country` = 8 LIMIT 1
0.172 ms 1 /classes/AddressFormat.php:656
291
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2889 AND `id_group` = 1 LIMIT 1
0.172 ms 0 /classes/GroupReduction.php:156
2205
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 8429 AND id_shop=1 LIMIT 1
0.171 ms 1 /classes/Product.php:6876
1457
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4035) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.170 ms 1 /classes/stock/StockAvailable.php:453
1461
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 54 LIMIT 1
0.170 ms 1 /classes/Product.php:5659
1538
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 200 LIMIT 1
0.170 ms 1 /classes/Product.php:5659
2437
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 9771 AND `id_group` = 1 LIMIT 1
0.170 ms 0 /classes/GroupReduction.php:156
38
SELECT SQL_NO_CACHE `id_category`
FROM `hgt78_category_shop`
WHERE `id_category` = 2
AND `id_shop` = 1 LIMIT 1
0.168 ms 1 /classes/Category.php:2450
78
SELECT SQL_NO_CACHE * FROM hgt78_carrier_group WHERE id_carrier = 282 LIMIT 1
0.167 ms 8 /modules/colissimo_simplicite/colissimo_simplicite.php:1388
1441
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4034
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.167 ms 0 /classes/SpecificPrice.php:259
2224
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 8947
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.167 ms 1 /classes/SpecificPrice.php:259
3411
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 9850
0.167 ms 1 /classes/Product.php:2902
2136
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 6023
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.166 ms 0 /classes/SpecificPrice.php:259
890
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 5373 AND id_shop=1 LIMIT 1
0.164 ms 1 /classes/Product.php:6876
1433
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4033 AND id_shop=1 LIMIT 1
0.164 ms 1 /classes/Product.php:6876
2211
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 200 LIMIT 1
0.164 ms 1 /classes/Product.php:5659
2664
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 9849
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.164 ms 0 /classes/SpecificPrice.php:259
1372
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 46 LIMIT 1
0.163 ms 1 /classes/Product.php:5659
901
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3985 AND id_shop=1 LIMIT 1
0.163 ms 1 /classes/Product.php:6876
1378
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4021 AND `id_group` = 1 LIMIT 1
0.161 ms 0 /classes/GroupReduction.php:156
2129
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 6018 AND `id_group` = 1 LIMIT 1
0.161 ms 0 /classes/GroupReduction.php:156
1868
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 70 LIMIT 1
0.159 ms 1 /classes/Product.php:5659
3357
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 9788
0.159 ms 1 /classes/Product.php:2902
1401
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4029 AND `id_group` = 1 LIMIT 1
0.159 ms 0 /classes/GroupReduction.php:156
1397
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4029
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.158 ms 0 /classes/SpecificPrice.php:259
1554
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4492 AND id_shop=1 LIMIT 1
0.158 ms 1 /classes/Product.php:6876
2261
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 8970 AND `id_group` = 1 LIMIT 1
0.158 ms 0 /classes/GroupReduction.php:156
1395
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 46 LIMIT 1
0.157 ms 1 /classes/Product.php:5659
2206
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 8429 AND `id_group` = 1 LIMIT 1
0.157 ms 0 /classes/GroupReduction.php:156
33
SELECT SQL_NO_CACHE *
FROM `hgt78_currency_lang`
WHERE `id_currency` = 1
0.156 ms 6 /src/Adapter/EntityMapper.php:79
1881
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 5638
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.156 ms 0 /classes/SpecificPrice.php:259
1895
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 5639 AND id_shop=1 LIMIT 1
0.155 ms 1 /classes/Product.php:6876
34
SELECT SQL_NO_CACHE id_shop
FROM `hgt78_currency_shop`
WHERE `id_currency` = 1
AND id_shop = 1 LIMIT 1
0.153 ms 1 /classes/ObjectModel.php:1729
121
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3799
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.152 ms 0 /classes/SpecificPrice.php:259
2228
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 8947 AND `id_group` = 1 LIMIT 1
0.152 ms 0 /classes/GroupReduction.php:156
1456
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4035 AND `id_group` = 1 LIMIT 1
0.152 ms 0 /classes/GroupReduction.php:156
1390
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4022 AND `id_group` = 1 LIMIT 1
0.151 ms 0 /classes/GroupReduction.php:156
1452
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4035
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.151 ms 0 /classes/SpecificPrice.php:259
25
SELECT SQL_NO_CACHE c.id_currency
FROM `hgt78_currency` c
WHERE (iso_code = 'EUR') LIMIT 1
0.150 ms 1 /classes/Currency.php:893
1902
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 34 LIMIT 1
0.149 ms 1 /classes/Product.php:5659
1400
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4029 AND id_shop=1 LIMIT 1
0.146 ms 1 /classes/Product.php:6876
902
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3985 AND `id_group` = 1 LIMIT 1
0.146 ms 0 /classes/GroupReduction.php:156
77
SELECT SQL_NO_CACHE * FROM hgt78_carrier_zone WHERE id_carrier = 282 LIMIT 1
0.145 ms 4 /modules/colissimo_simplicite/colissimo_simplicite.php:1383
1870
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 5337
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.145 ms 0 /classes/SpecificPrice.php:259
2227
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 8947 AND id_shop=1 LIMIT 1
0.144 ms 1 /classes/Product.php:6876
2690
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 9851 AND `id_group` = 1 LIMIT 1
0.143 ms 0 /classes/GroupReduction.php:156
1445
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4034 AND `id_group` = 1 LIMIT 1
0.143 ms 0 /classes/GroupReduction.php:156
27
SELECT SQL_NO_CACHE `id_lang` FROM `hgt78_lang`
WHERE `locale` = 'fr-fr'
OR `language_code` = 'fr-fr' LIMIT 1
0.142 ms 6 /classes/Language.php:883
1576
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4507 AND id_shop=1 LIMIT 1
0.142 ms 1 /classes/Product.php:6876
1848
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 5167
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.141 ms 0 /classes/SpecificPrice.php:259
36
SELECT SQL_NO_CACHE *
FROM `hgt78_group_lang`
WHERE `id_group` = 1
0.138 ms 6 /src/Adapter/EntityMapper.php:79
39
SELECT SQL_NO_CACHE ctg.`id_group`
FROM hgt78_category_group ctg
WHERE ctg.`id_category` = 2 AND ctg.`id_group` = 1 LIMIT 1
0.138 ms 1 /classes/Category.php:1754
1896
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 5639 AND `id_group` = 1 LIMIT 1
0.138 ms 0 /classes/GroupReduction.php:156
891
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 5373 AND `id_group` = 1 LIMIT 1
0.137 ms 0 /classes/GroupReduction.php:156
1571
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 200 LIMIT 1
0.135 ms 1 /classes/Product.php:5659
1846
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 200 LIMIT 1
0.135 ms 1 /classes/Product.php:5659
29
SELECT SQL_NO_CACHE c.id_currency
FROM `hgt78_currency` c
WHERE (iso_code = 'GBP') LIMIT 1
0.134 ms 1 /classes/Currency.php:893
28
SELECT SQL_NO_CACHE `id_lang` FROM `hgt78_lang`
WHERE `locale` = 'fr-fr'
OR `language_code` = 'fr-fr' LIMIT 1
0.133 ms 6 /classes/Language.php:883
1862
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 5336 AND id_shop=1 LIMIT 1
0.133 ms 1 /classes/Product.php:6876
1527
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 200 LIMIT 1
0.131 ms 1 /classes/Product.php:5659
1560
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 200 LIMIT 1
0.131 ms 1 /classes/Product.php:5659
1884
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 5638 AND id_shop=1 LIMIT 1
0.131 ms 1 /classes/Product.php:6876
1863
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 5336 AND `id_group` = 1 LIMIT 1
0.131 ms 0 /classes/GroupReduction.php:156
1565
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4506 AND id_shop=1 LIMIT 1
0.128 ms 1 /classes/Product.php:6876
1555
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4492 AND `id_group` = 1 LIMIT 1
0.126 ms 0 /classes/GroupReduction.php:156
1830
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 5165 AND `id_group` = 1 LIMIT 1
0.126 ms 0 /classes/GroupReduction.php:156
31
SELECT SQL_NO_CACHE `id_lang` FROM `hgt78_lang`
WHERE `locale` = 'fr-fr'
OR `language_code` = 'fr-fr' LIMIT 1
0.125 ms 6 /classes/Language.php:883
1529
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4490
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.123 ms 0 /classes/SpecificPrice.php:259
65
SELECT SQL_NO_CACHE `need_identification_number`
FROM `hgt78_country`
WHERE `id_country` = 8 LIMIT 1
0.122 ms 1 /classes/Country.php:405
1562
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4506
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.122 ms 0 /classes/SpecificPrice.php:259
10
SELECT SQL_NO_CACHE id_shop
FROM `hgt78_lang_shop`
WHERE `id_lang` = 1
AND id_shop = 1 LIMIT 1
0.121 ms 1 /classes/ObjectModel.php:1729
49
SELECT SQL_NO_CACHE * FROM `hgt78_image_type`
0.117 ms 8 /classes/ImageType.php:161
1573
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4507
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.115 ms 0 /classes/SpecificPrice.php:259
62
SELECT SQL_NO_CACHE `id_module` FROM `hgt78_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
0.114 ms 0 /classes/module/Module.php:2137
37
SELECT SQL_NO_CACHE id_shop
FROM `hgt78_group_shop`
WHERE `id_group` = 1
AND id_shop = 1 LIMIT 1
0.112 ms 1 /classes/ObjectModel.php:1729
1885
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 5638 AND `id_group` = 1 LIMIT 1
0.107 ms 0 /classes/GroupReduction.php:156
1566
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4506 AND `id_group` = 1 LIMIT 1
0.107 ms 0 /classes/GroupReduction.php:156
1577
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4507 AND `id_group` = 1 LIMIT 1
0.104 ms 0 /classes/GroupReduction.php:156

Doubles

236 queries
SELECT *
FROM `hgtXX_product` a
LEFT JOIN `hgtXX_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = XX
LEFT JOIN `hgtXX_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = XX
WHERE (a.`id_product` = XX) AND (b.`id_shop` = XX) LIMIT XX
235 queries
SELECT XX FROM `hgtXX_specific_price` WHERE id_product = XX LIMIT XX
234 queries
SELECT image_shop.`id_image`
                    FROM `hgtXX_image` i
                     INNER JOIN hgtXX_image_shop image_shop
        ON (image_shop.id_image = i.id_image AND image_shop.id_shop = XX)
                    WHERE i.`id_product` = XX
                    AND image_shop.`cover` = XX LIMIT XX
234 queries
SELECT name FROM hgtXX_category_lang WHERE id_shop = XX AND id_lang = XX AND id_category = XX LIMIT XX
234 queries
				SELECT `priority`, `id_specific_price_priority`
				FROM `hgtXX_specific_price_priority`
				WHERE `id_product` = XX
				ORDER BY `id_specific_price_priority` DESC LIMIT XX
234 queries
			SELECT *, ( IF (`id_group` = XX, XX, XX) +  IF (`id_country` = XX, XX, XX) +  IF (`id_currency` = XX, XX, XX) +  IF (`id_shop` = XX, XX, XX) +  IF (`id_customer` = XX, XX, XX)) AS `score`
				FROM `hgtXX_specific_price`
				WHERE
                `id_shop` IN (XX, XX) AND
                `id_currency` IN (XX, XX) AND
                `id_country` IN (XX, XX) AND
                `id_group` IN (XX, XX) AND `id_product` = XX AND `id_customer` = XX AND `id_product_attribute` = XX AND `id_cart` = XX  AND (`from` = 'XX-XX-XX XX:XX:XX' OR 'XX-XX-XX XX:XX:XX' >= `from`) AND (`to` = 'XX-XX-XX XX:XX:XX' OR 'XX-XX-XX XX:XX:XX' <= `to`)
				AND IF(`from_quantity` > XX, `from_quantity`, XX) <= XX ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT XX
234 queries
SELECT product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,XX) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgtXX_product` p
INNER JOIN `hgtXX_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = XX)
LEFT JOIN `hgtXX_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = XX)
WHERE (p.`id_product` = XX)
234 queries
                            SELECT `id_tax_rules_group`
                            FROM `hgtXX_product_shop`
                            WHERE `id_product` = XX AND id_shop=XX LIMIT XX
234 queries
			SELECT `reduction`
			FROM `hgtXX_product_group_reduction_cache`
			WHERE `id_product` = XX AND `id_group` = XX LIMIT XX
234 queries
SELECT SUM(quantity)
FROM `hgtXX_stock_available`
WHERE (id_product = XX) AND (id_product_attribute = XX) AND (id_shop = XX) AND (id_shop_group = XX) LIMIT XX
234 queries
SELECT
            COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), XX) as deep_quantity,
            COALESCE(SUM(first_level_quantity), XX) as quantity
          FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, XX as pack_quantity
          FROM `hgtXX_cart_product` cp
            WHERE cp.`id_product_attribute` = XX
            
            AND cp.`id_cart` = XX AND cp.`id_product` = XX UNION SELECT XX as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
          FROM `hgtXX_cart_product` cp JOIN `hgtXX_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgtXX_product` pr ON p.`id_product_pack` = pr.`id_product`
            WHERE cp.`id_product_attribute` = XX
            
            AND cp.`id_cart` = XX AND p.`id_product_item` = XX AND (pr.`pack_stock_type` IN (XX,XX) OR (
            pr.`pack_stock_type` = XX
            AND XX = XX
        ))) as q LIMIT XX
234 queries
                SELECT name, value, pf.id_feature, f.position, fvl.id_feature_value
                FROM hgtXX_feature_product pf
                LEFT JOIN hgtXX_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = XX)
                LEFT JOIN hgtXX_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = XX)
                LEFT JOIN hgtXX_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = XX)
                 INNER JOIN hgtXX_feature_shop feature_shop
        ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = XX)
                WHERE pf.id_product = XX
                ORDER BY f.position ASC
234 queries
            SELECT image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
            FROM `hgtXX_image` i
             INNER JOIN hgtXX_image_shop image_shop
        ON (image_shop.id_image = i.id_image AND image_shop.id_shop = XX)
            LEFT JOIN `hgtXX_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = XX)
            WHERE i.`id_product` = XX
            ORDER BY `position`
234 queries
SELECT `id_product_attribute`
            FROM `hgtXX_product_attribute`
            WHERE `id_product` = XX
234 queries
SELECT pa.`id_product`, a.`color`, pac.`id_product_attribute`, XX qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
            FROM `hgtXX_product_attribute` pa
             INNER JOIN hgtXX_product_attribute_shop product_attribute_shop
        ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = XX)
            JOIN `hgtXX_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
            JOIN `hgtXX_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
            JOIN `hgtXX_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = XX)
            JOIN `hgtXX_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
            WHERE pa.`id_product` IN (XX) AND ag.`is_color_group` = XX
            GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
            
            ORDER BY a.`position` ASC;
71 queries
SELECT *
FROM `hgtXX_category` a
LEFT JOIN `hgtXX_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = XX
WHERE (a.`id_category` = XX) LIMIT XX
71 queries
SELECT *
							FROM `hgtXX_category_lang`
							WHERE `id_category` = XX AND `id_shop` = XX
27 queries
SELECT *
FROM `hgtXX_category` a
LEFT JOIN `hgtXX_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = XX
LEFT JOIN `hgtXX_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = XX
WHERE (a.`id_category` = XX) AND (b.`id_shop` = XX) LIMIT XX
18 queries
				SELECT c.*, cl.*
				FROM `hgtXX_category` c
				 INNER JOIN hgtXX_category_shop category_shop
        ON (category_shop.id_category = c.id_category AND category_shop.id_shop = XX)
				LEFT JOIN `hgtXX_category_lang` cl ON c.`id_category` = cl.`id_category` AND cl.id_shop = XX 
				LEFT JOIN `hgtXX_category_group` cg ON c.`id_category` = cg.`id_category`
				RIGHT JOIN `hgtXX_category` cXX ON cXX.`id_category` = XX AND c.`nleft` >= cXX.`nleft` AND c.`nright` <= cXX.`nright`
				WHERE XX  AND `id_lang` = XX
				 AND c.`active` = XX
				 AND cg.`id_group` IN (XX)
				 GROUP BY c.`id_category`
				 ORDER BY c.`level_depth` ASC
				, category_shop.`position` ASC
				
16 queries
			SELECT cl.`link_rewrite`
			FROM `hgtXX_category_lang` cl
			WHERE `id_lang` = XX
			 AND cl.id_shop = XX 
			AND cl.`id_category` = XX LIMIT XX
10 queries
SELECT `id_module` FROM `hgtXX_module_shop` WHERE `id_module` = XX AND `id_shop` = XX LIMIT XX
4 queries
SELECT `id_lang` FROM `hgtXX_lang`
                    WHERE `locale` = 'fr-fr'
                    OR `language_code` = 'fr-fr' LIMIT XX
4 queries
SELECT DISTINCT a.`id_attribute`, a.`color`, al.`name`, agl.`id_attribute_group`, IF(lialv.`url_name` IS NULL OR lialv.`url_name` = "", NULL, lialv.`url_name`) AS url_name, IF(lialv.`meta_title` IS NULL OR lialv.`meta_title` = "", NULL, lialv.`meta_title`) AS meta_title FROM `hgtXX_attribute_group` ag INNER JOIN `hgtXX_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = XX) INNER JOIN `hgtXX_attribute` a ON a.`id_attribute_group` = ag.`id_attribute_group` INNER JOIN `hgtXX_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = XX) INNER JOIN hgtXX_attribute_group_shop attribute_group_shop
        ON (attribute_group_shop.id_attribute_group = ag.id_attribute_group AND attribute_group_shop.id_shop = XX)  INNER JOIN hgtXX_attribute_shop attribute_shop
        ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = XX) LEFT JOIN `hgtXX_layered_indexable_attribute_lang_value` lialv ON (a.`id_attribute` = lialv.`id_attribute` AND lialv.`id_lang` = XX) WHERE ag.id_attribute_group = XX ORDER BY agl.`name` ASC, a.`position` ASC
4 queries
SELECT pac.id_attribute, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM hgtXX_product p LEFT JOIN hgtXX_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN hgtXX_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN hgtXX_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, XX) = sa.id_product_attribute AND sa.id_shop = XX  AND sa.id_shop_group = XX ) LEFT JOIN hgtXX_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN hgtXX_category_product cp ON (p.id_product = cp.id_product) INNER JOIN hgtXX_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = XX AND ps.active = TRUE) INNER JOIN hgtXX_category c ON (cp.id_category = c.id_category AND c.active=XX) LEFT JOIN hgtXX_category_group cg ON (cg.id_category = c.id_category) WHERE ps.id_shop='XX' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='XX' AND cp.id_category IN (XX, XX) AND p.id_manufacturer='XX' GROUP BY p.id_product) p LEFT JOIN hgtXX_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN hgtXX_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) INNER JOIN hgtXX_attribute a ON (a.id_attribute = pac.id_attribute) WHERE ((a.id_attribute_group=XX)) GROUP BY pac.id_attribute
3 queries
							SELECT `name`
							FROM `hgtXX_hook`
							WHERE `id_hook` = XX LIMIT XX
3 queries
				SELECT tr.*
				FROM `hgtXX_tax_rule` tr
				JOIN `hgtXX_tax_rules_group` trg ON (tr.`id_tax_rules_group` = trg.`id_tax_rules_group`)
				WHERE trg.`active` = XX
				AND tr.`id_country` = XX
				AND tr.`id_tax_rules_group` = XX
				AND tr.`id_state` IN (XX, XX)
				AND ('XX' BETWEEN tr.`zipcode_from` AND tr.`zipcode_to`
					OR (tr.`zipcode_to` = XX AND tr.`zipcode_from` IN(XX, 'XX')))
				ORDER BY tr.`zipcode_from` DESC, tr.`zipcode_to` DESC, tr.`id_state` DESC, tr.`id_country` DESC
2 queries
SELECT lower(name) as name
FROM `hgtXX_hook` h
WHERE (h.active = XX)
2 queries
SELECT h.`name` as hook, m.`id_module`, h.`id_hook`, m.`name` as module
FROM `hgtXX_module` m
 INNER JOIN hgtXX_module_shop module_shop
        ON (module_shop.id_module = m.id_module AND module_shop.id_shop = XX AND module_shop.enable_device & XX)
INNER JOIN `hgtXX_hook_module` `hm` ON hm.`id_module` = m.`id_module`
INNER JOIN `hgtXX_hook` `h` ON hm.`id_hook` = h.`id_hook`
LEFT JOIN `hgtXX_module_group` `mg` ON mg.`id_module` = m.`id_module`
WHERE (h.`name` != "paymentOptions") AND (hm.`id_shop` = XX) AND (mg.id_shop = XX AND  mg.`id_group` IN (XX))
GROUP BY hm.id_hook, hm.id_module
ORDER BY hm.`position`
2 queries
SELECT `name`, `alias` FROM `hgtXX_hook_alias`
2 queries
SELECT `id_hook`, `name` FROM `hgtXX_hook`
2 queries
                SELECT m.`id_module`, m.`name`, ms.`id_module`as `mshop`
                FROM `hgtXX_module` m
                LEFT JOIN `hgtXX_module_shop` ms
                ON m.`id_module` = ms.`id_module`
                AND ms.`id_shop` = XX
2 queries
SELECT name, alias FROM `hgtXX_hook_alias`
2 queries
SELECT * FROM `hgtXX_hook_module_exceptions`
                WHERE `id_shop` IN (XX)
2 queries
SELECT *
FROM `hgtXX_currency` a
LEFT JOIN `hgtXX_currency_lang` `b` ON a.`id_currency` = b.`id_currency` AND b.`id_lang` = XX
LEFT JOIN `hgtXX_currency_shop` `c` ON a.`id_currency` = c.`id_currency` AND c.`id_shop` = XX
WHERE (a.`id_currency` = XX) LIMIT XX
2 queries
SELECT *
FROM `hgtXX_currency` a
LEFT JOIN `hgtXX_currency_shop` `c` ON a.`id_currency` = c.`id_currency` AND c.`id_shop` = XX
WHERE (a.`id_currency` = XX) LIMIT XX
2 queries
SELECT *
							FROM `hgtXX_currency_lang`
							WHERE `id_currency` = XX
2 queries
				SELECT id_shop
				FROM `hgtXX_group_shop`
				WHERE `id_group` = XX
				AND id_shop = XX LIMIT XX
2 queries
		SELECT `id_category`
		FROM `hgtXX_category_shop`
		WHERE `id_category` = XX
		AND `id_shop` = XX LIMIT XX
2 queries
				SELECT ctg.`id_group`
				FROM hgtXX_category_group ctg
				WHERE ctg.`id_category` = XX AND ctg.`id_group` = XX LIMIT XX
2 queries
SELECT *
FROM `hgtXX_shop_url` aXX
2 queries
		SELECT m.*, ml.`description`, ml.`short_description`
		FROM `hgtXX_manufacturer` m INNER JOIN hgtXX_manufacturer_shop manufacturer_shop
        ON (manufacturer_shop.id_manufacturer = m.id_manufacturer AND manufacturer_shop.id_shop = XX)INNER JOIN `hgtXX_manufacturer_lang` ml ON (m.`id_manufacturer` = ml.`id_manufacturer` AND ml.`id_lang` = XX)WHERE XX AND m.`active` = XX ORDER BY m.`name` ASC
		
2 queries
SELECT fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM hgtXX_product p LEFT JOIN hgtXX_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN hgtXX_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN hgtXX_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, XX) = sa.id_product_attribute AND sa.id_shop = XX  AND sa.id_shop_group = XX ) LEFT JOIN hgtXX_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN hgtXX_category_product cp ON (p.id_product = cp.id_product) INNER JOIN hgtXX_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = XX AND ps.active = TRUE) INNER JOIN hgtXX_category c ON (cp.id_category = c.id_category AND c.active=XX) LEFT JOIN hgtXX_category_group cg ON (cg.id_category = c.id_category) WHERE ps.id_shop='XX' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='XX' AND cp.id_category IN (XX, XX) AND p.id_manufacturer='XX' GROUP BY p.id_product) p INNER JOIN hgtXX_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature=XX)) GROUP BY fp.id_feature_value
2 queries
SELECT XX FROM `hgtXX_cart_rule` WHERE ((date_to >= "XX-XX-XX XX:XX:XX" AND date_to <= "XX-XX-XX XX:XX:XX") OR (date_from >= "XX-XX-XX XX:XX:XX" AND date_from <= "XX-XX-XX XX:XX:XX") OR (date_from < "XX-XX-XX XX:XX:XX" AND date_to > "XX-XX-XX XX:XX:XX")) AND `id_customer` IN (XX,XX) LIMIT XX
2 queries
            SELECT *
            FROM `hgtXX_currency` c
             INNER JOIN hgtXX_currency_shop currency_shop
        ON (currency_shop.id_currency = c.id_currency AND currency_shop.id_shop = XX)
                WHERE c.`deleted` = XX AND c.`active` = XX ORDER BY `iso_code` ASC
2 queries
SELECT buttonXX FROM hgtXX_lgcookieslaw_lang WHERE id_lang = XX LIMIT XX

Tables stress

721 product
721 product_shop
488 product_attribute
472 specific_price
470 cart_product
468 image
468 image_shop
468 product_attribute_shop
375 category_lang
254 product_attribute_combination
252 stock_available
242 attribute
239 attribute_group
238 attribute_lang
237 product_lang
236 feature_product
235 feature
235 feature_shop
235 feature_lang
234 specific_price_priority
234 product_group_reduction_cache
234 pack
234 feature_value_lang
234 image_lang
161 category
121 category_shop
38 category_group
17 module
17 category_product
14 module_shop
13 product_sale
12 hook
10 currency
8 currency_shop
7 lang
6 shop_url
5 hook_alias
5 image_type
5 attribute_group_shop
5 attribute_group_lang
5 lgcookieslaw_lang
4 shop
4 lang_shop
4 currency_lang
4 attribute_shop
4 layered_indexable_attribute_lang_value
4 cart_rule
3 country
3 hook_module
3 group_shop
3 manufacturer
3 tax_rule
3 tax_rules_group
2 shop_group
2 configuration
2 country_lang
2 country_shop
2 module_group
2 hook_module_exceptions
2 group
2 manufacturer_shop
2 manufacturer_lang
2 cart_rule_lang
2 cms
2 cms_lang
2 cms_shop
2 psgdpr_consent
1 configuration_lang
1 meta
1 meta_lang
1 group_lang
1 feature_flag
1 address_format
1 required_field
1 revslider_sliders
1 carrier
1 carrier_shop
1 carrier_lang
1 carrier_zone
1 carrier_group
1 range_price
1 delivery
1 layered_category
1 layered_indexable_attribute_group
1 layered_indexable_attribute_group_lang_value
1 layered_indexable_feature
1 layered_indexable_feature_lang_value
1 layered_filter_block
1 layered_price_index
1 tax
1 tax_lang
1 iqit_elementor_category
1 cart_rule_group
1 iqitmegamenu_tabs_shop
1 iqitmegamenu_tabs
1 iqitmegamenu_tabs_lang
1 psgdpr_consent_lang
1 connections

ObjectModel instances

Name Instances Source
Product 238 /classes/Link.php:113 (__construct) [id: 4022]
/classes/Link.php:113 (__construct) [id: 10738]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3799]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3797]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3796]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3795]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2415]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2475]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2447]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2502]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2448]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2513]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2504]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2514]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2808]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2600]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2889]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2601]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2890]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2834]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2835]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2918]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2836]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2944]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2898]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2899]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3196]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3197]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2945]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3198]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3010]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3199]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3011]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3200]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3028]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3234]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3235]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3242]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3236]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3257]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3258]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3497]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3499]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3520]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3500]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3788]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3790]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3791]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3942]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3943]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3944]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3945]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3946]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3947]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3949]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3950]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3801]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3951]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3802]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3952]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3803]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4297]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4298]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4299]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4856]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4947]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 5074]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 5075]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 5106]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 5113]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 5373]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3985]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 5415]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3986]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 5418]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3987]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 5509]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3988]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 5510]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3989]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3990]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 6053]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 6054]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3992]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 6099]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3993]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 6100]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3994]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 6101]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3995]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 6102]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3996]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 6120]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3997]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3998]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3999]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3018]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4000]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 8356]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4001]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 8357]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4002]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 8637]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4003]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 9521]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4004]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 10235]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4005]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 10236]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 10932]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4016]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4017]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4018]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4019]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4021]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4022]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4029]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4030]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4032]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4033]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4034]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4035]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4036]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4236]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4238]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4239]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4241]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4413]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4490]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4491]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4492]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4506]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4507]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4508]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4540]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4541]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4580]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4582]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4583]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4698]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4699]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4700]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4701]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4702]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4703]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4704]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4718]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4989]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 5076]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 5077]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 5080]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 5102]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 5103]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 5104]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 5164]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 5165]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 5166]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 5167]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 5336]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 5337]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 5638]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 5639]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4488]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4489]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3978]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3979]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3980]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3981]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3982]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3983]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3984]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2930]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4027]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 5084]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 5083]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 5085]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 5101]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 5328]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 5352]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 5640]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 5641]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 5642]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 6018]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 6023]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 6024]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 6025]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 6105]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 6134]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 6135]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 8429]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 8946]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 8947]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 8948]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 8969]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 8970]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 9264]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 9721]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 9723]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 9742]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 9743]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 9744]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 9745]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 9746]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 9747]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 9749]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 9751]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 9752]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 9767]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 9768]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 9769]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 9771]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 9772]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 9773]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 9774]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 9788]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 9789]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 9790]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 9791]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 9792]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 9794]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 9819]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 9820]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 9821]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 9830]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 9842]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 9843]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 9844]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 9845]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 9846]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 9847]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 9848]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 9849]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 9850]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 9851]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 9852]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 10738]
/classes/Link.php:113 (__construct) [id: 4022]
/classes/Link.php:113 (__construct) [id: 10738]
Category 106 /controllers/front/listing/CategoryController.php:78 (__construct) [id: 2]
/controllers/front/listing/CategoryController.php:216 (__construct) [id: 33]
/controllers/front/listing/CategoryController.php:216 (__construct) [id: 34]
/controllers/front/listing/CategoryController.php:216 (__construct) [id: 35]
/controllers/front/listing/CategoryController.php:216 (__construct) [id: 36]
/controllers/front/listing/CategoryController.php:216 (__construct) [id: 37]
/controllers/front/listing/CategoryController.php:216 (__construct) [id: 38]
/controllers/front/listing/CategoryController.php:216 (__construct) [id: 39]
/controllers/front/listing/CategoryController.php:216 (__construct) [id: 40]
/controllers/front/listing/CategoryController.php:216 (__construct) [id: 44]
/controllers/front/listing/CategoryController.php:216 (__construct) [id: 319]
/controllers/front/listing/CategoryController.php:216 (__construct) [id: 11]
/controllers/front/listing/CategoryController.php:216 (__construct) [id: 12]
/controllers/front/listing/CategoryController.php:216 (__construct) [id: 13]
/controllers/front/listing/CategoryController.php:216 (__construct) [id: 18]
/controllers/front/listing/CategoryController.php:216 (__construct) [id: 19]
/controllers/front/listing/CategoryController.php:216 (__construct) [id: 20]
/classes/Meta.php:380 (__construct) [id: 2]
/classes/PrestaShopCollection.php:385 (hydrateCollection) [id: ]
/modules/ps_facetedsearch/src/Filters/Block.php:157 (__construct) [id: 2]
/classes/Link.php:402 (__construct) [id: 2]
/classes/Link.php:402 (__construct) [id: 2]
/modules/iqitmegamenu/iqitmegamenu.php:3282 (__construct) [id: 40]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 40]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 55]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 71]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 165]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 169]
/modules/iqitmegamenu/iqitmegamenu.php:3282 (__construct) [id: 38]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 38]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 50]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 62]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 72]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 172]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 175]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 185]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 186]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 190]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 334]
/modules/iqitmegamenu/iqitmegamenu.php:3282 (__construct) [id: 34]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 344]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 45]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 46]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 54]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 70]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 78]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 199]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 200]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 35]
/modules/iqitmegamenu/iqitmegamenu.php:3282 (__construct) [id: 216]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 44]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 51]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 56]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 192]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 195]
/modules/iqitmegamenu/iqitmegamenu.php:3282 (__construct) [id: 37]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 37]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 48]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 53]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 73]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 74]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 161]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 162]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 163]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 260]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 261]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 262]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 263]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 264]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 265]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 266]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 307]
/modules/iqitmegamenu/iqitmegamenu.php:3282 (__construct) [id: 35]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 35]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 49]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 59]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 60]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 65]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 81]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 82]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 96]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 145]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 196]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 197]
/modules/iqitmegamenu/iqitmegamenu.php:3282 (__construct) [id: 33]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 33]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 61]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 66]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 79]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 80]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 191]
/modules/iqitmegamenu/iqitmegamenu.php:3282 (__construct) [id: 36]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 36]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 42]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 47]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 76]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 77]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 217]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 221]
/modules/iqitmegamenu/iqitmegamenu.php:3282 (__construct) [id: 39]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 39]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 83]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 84]
/classes/Link.php:402 (__construct) [id: 2]
/classes/Link.php:402 (__construct) [id: 2]
/modules/ps_categorytree/ps_categorytree.php:364 (getParentsCategories) [id: 2]
Currency 4 /src/Adapter/Currency/CurrencyDataProvider.php:101 (__construct) [id: 1]
/src/Adapter/Currency/CurrencyDataProvider.php:101 (__construct) [id: 2]
/classes/Tools.php:690 (getCurrencyInstance) [id: 1]
/modules/ps_currencyselector/ps_currencyselector.php:112 (getCurrencies) [id: 2]
Address 4 /classes/shop/Shop.php:486 (__construct) [id: ]
/classes/Product.php:3694 (initialize) [id: ]
/classes/Product.php:3804 (__construct) [id: ]
/classes/Product.php:5964 (__construct) [id: ]
Country 3 /config/config.inc.php:146 (__construct) [id: 8]
/classes/AddressFormat.php:404 (__construct) [id: 8]
/classes/controller/FrontController.php:1779 (__construct) [id: 8]
ShopUrl 2 /classes/PrestaShopCollection.php:385 (hydrateCollection) [id: ]
/classes/PrestaShopCollection.php:385 (hydrateCollection) [id: ]
Language 2 /config/config.inc.php:211 (__construct) [id: 1]
/classes/Tools.php:560 (__construct) [id: 1]
Cart 2 /classes/controller/FrontController.php:467 (__construct) [id: ]
/classes/controller/FrontController.php:541 (__construct) [id: ]
Tax 2 /classes/tax/TaxRulesTaxManager.php:116 (__construct) [id: 1]
/classes/tax/TaxRulesTaxManager.php:116 (__construct) [id: 1]
Carrier 2 /modules/colissimo_simplicite/colissimo_simplicite.php:84 (__construct) [id: 282]
/modules/colissimo_simplicite/colissimo_simplicite.php:1394 (__construct) [id: 282]
Shop 1 /config/config.inc.php:117 (initialize) [id: 1]
CMS 1 /classes/Link.php:555 (__construct) [id: 2]
IqitElementorCategory 1 /modules/iqitelementor/iqitelementor.php:853 (isJustElementor) [id: ]
Risk 1 /classes/controller/FrontController.php:1705 (__construct) [id: ]
State 1 /classes/controller/FrontController.php:1778 (__construct) [id: 0]
AddressFormat 1 /classes/controller/FrontController.php:1773 (generateAddress) [id: ]
Gender 1 /classes/controller/FrontController.php:1702 (__construct) [id: 0]
Group 1 /classes/Cart.php:249 (getCurrent) [id: 1]
Customer 1 /config/config.inc.php:264 (__construct) [id: ]
ShopGroup 1 /classes/shop/Shop.php:561 (__construct) [id: 1]
ConnectionsSource 1 /modules/statsdata/statsdata.php:119 (logHttpReferer) [id: ]

Included Files

# Filename
0 /index.php
1 /config/config.inc.php
2 /config/defines.inc.php
3 /config/autoload.php
4 /vendor/autoload.php
5 /vendor/composer/autoload_real.php
6 /vendor/composer/platform_check.php
7 /vendor/composer/ClassLoader.php
8 /vendor/composer/include_paths.php
9 /vendor/composer/autoload_static.php
10 /vendor/symfony/polyfill-php72/bootstrap.php
11 /vendor/symfony/polyfill-mbstring/bootstrap.php
12 /vendor/symfony/polyfill-mbstring/bootstrap80.php
13 /vendor/symfony/polyfill-intl-normalizer/bootstrap.php
14 /vendor/symfony/polyfill-intl-normalizer/bootstrap80.php
15 /vendor/symfony/polyfill-intl-idn/bootstrap.php
16 /vendor/symfony/deprecation-contracts/function.php
17 /vendor/ralouphie/getallheaders/src/getallheaders.php
18 /vendor/symfony/polyfill-ctype/bootstrap.php
19 /vendor/symfony/polyfill-ctype/bootstrap80.php
20 /vendor/symfony/polyfill-php80/bootstrap.php
21 /vendor/guzzlehttp/promises/src/functions_include.php
22 /vendor/guzzlehttp/promises/src/functions.php
23 /vendor/guzzlehttp/guzzle/src/functions_include.php
24 /vendor/guzzlehttp/guzzle/src/functions.php
25 /vendor/symfony/polyfill-iconv/bootstrap.php
26 /vendor/ezyang/htmlpurifier/library/HTMLPurifier.composer.php
27 /vendor/jakeasmith/http_build_url/src/http_build_url.php
28 /vendor/lcobucci/jwt/compat/class-aliases.php
29 /vendor/lcobucci/jwt/src/Token.php
30 /vendor/lcobucci/jwt/src/Signature.php
31 /vendor/lcobucci/jwt/compat/json-exception-polyfill.php
32 /vendor/lcobucci/jwt/compat/lcobucci-clock-polyfill.php
33 /vendor/swiftmailer/swiftmailer/lib/swift_required.php
34 /vendor/swiftmailer/swiftmailer/lib/classes/Swift.php
35 /vendor/symfony/polyfill-intl-icu/bootstrap.php
36 /vendor/symfony/polyfill-php73/bootstrap.php
37 /vendor/symfony/polyfill-php81/bootstrap.php
38 /vendor/api-platform/core/src/deprecation.php
39 /vendor/api-platform/core/src/Api/FilterInterface.php
40 /vendor/api-platform/core/src/Api/ResourceClassResolverInterface.php
41 /vendor/api-platform/core/src/deprecated_interfaces.php
42 /vendor/api-platform/core/src/Metadata/Property/Factory/PropertyNameCollectionFactoryInterface.php
43 /vendor/api-platform/core/src/Metadata/Resource/Factory/ResourceNameCollectionFactoryInterface.php
44 /vendor/api-platform/core/src/Metadata/Extractor/ResourceExtractorInterface.php
45 /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/DateFilterInterface.php
46 /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/ExistsFilterInterface.php
47 /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/OrderFilterInterface.php
48 /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/RangeFilterInterface.php
49 /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/SearchFilterInterface.php
50 /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Extension/AggregationCollectionExtensionInterface.php
51 /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Extension/AggregationItemExtensionInterface.php
52 /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Extension/AggregationResultCollectionExtensionInterface.php
53 /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Extension/AggregationResultItemExtensionInterface.php
54 /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Filter/FilterInterface.php
55 /vendor/api-platform/core/src/Doctrine/Orm/QueryAwareInterface.php
56 /vendor/api-platform/core/src/Doctrine/Orm/Util/QueryNameGeneratorInterface.php
57 /vendor/api-platform/core/src/Elasticsearch/Metadata/Document/Factory/DocumentMetadataFactoryInterface.php
58 /vendor/api-platform/core/src/Symfony/Validator/ValidationGroupsGeneratorInterface.php
59 /vendor/api-platform/core/src/Symfony/Validator/Exception/ConstraintViolationListAwareExceptionInterface.php
60 /vendor/api-platform/core/src/Exception/ExceptionInterface.php
61 /vendor/api-platform/core/src/Core/Bridge/Symfony/Validator/Metadata/Property/Restriction/PropertySchemaRestrictionMetadataInterface.php
62 /vendor/api-platform/core/src/State/Pagination/PaginatorInterface.php
63 /vendor/api-platform/core/src/State/Pagination/PartialPaginatorInterface.php
64 /vendor/api-platform/core/src/Documentation/DocumentationInterface.php
65 /vendor/api-platform/core/src/JsonLd/AnonymousContextBuilderInterface.php
66 /vendor/api-platform/core/src/JsonLd/ContextBuilderInterface.php
67 /vendor/api-platform/core/src/Core/JsonSchema/SchemaFactoryInterface.php
68 /vendor/api-platform/core/src/JsonSchema/TypeFactoryInterface.php
69 /vendor/api-platform/core/src/OpenApi/Factory/OpenApiFactoryInterface.php
70 /vendor/api-platform/core/src/PathResolver/OperationPathResolverInterface.php
71 /vendor/api-platform/core/src/Symfony/Security/ResourceAccessCheckerInterface.php
72 /vendor/api-platform/core/src/Serializer/Filter/FilterInterface.php
73 /vendor/api-platform/core/src/Serializer/SerializerContextBuilderInterface.php
74 /vendor/api-platform/core/src/Validator/ValidatorInterface.php
75 /vendor/api-platform/core/src/Api/UrlGeneratorInterface.php
76 /vendor/api-platform/core/src/GraphQl/ExecutorInterface.php
77 /vendor/api-platform/core/src/GraphQl/Error/ErrorHandlerInterface.php
78 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/ValidateStageInterface.php
79 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/ReadStageInterface.php
80 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/SecurityPostDenormalizeStageInterface.php
81 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/SecurityStageInterface.php
82 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/WriteStageInterface.php
83 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/SerializeStageInterface.php
84 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/DeserializeStageInterface.php
85 /vendor/api-platform/core/src/GraphQl/Resolver/QueryItemResolverInterface.php
86 /vendor/api-platform/core/src/GraphQl/Resolver/QueryCollectionResolverInterface.php
87 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Factory/ResolverFactoryInterface.php
88 /vendor/api-platform/core/src/GraphQl/Resolver/MutationResolverInterface.php
89 /vendor/api-platform/core/src/Core/GraphQl/Subscription/MercureSubscriptionIriGeneratorInterface.php
90 /vendor/api-platform/core/src/Core/GraphQl/Subscription/SubscriptionIdentifierGeneratorInterface.php
91 /vendor/api-platform/core/src/Core/GraphQl/Subscription/SubscriptionManagerInterface.php
92 /vendor/api-platform/core/src/Core/GraphQl/Serializer/SerializerContextBuilderInterface.php
93 /vendor/api-platform/core/src/GraphQl/Type/TypesFactoryInterface.php
94 /vendor/api-platform/core/src/GraphQl/Type/Definition/TypeInterface.php
95 /vendor/api-platform/core/src/GraphQl/Type/TypesContainerInterface.php
96 /vendor/psr/container/src/ContainerInterface.php
97 /vendor/api-platform/core/src/Operation/PathSegmentNameGeneratorInterface.php
98 /vendor/ircmaxell/password-compat/lib/password.php
99 /vendor/martinlindhe/php-mb-helpers/src/mb_helpers.php
100 /vendor/prestashop/laminas-code-lts/polyfill/ReflectionEnumPolyfill.php
101 /src/Core/Version.php
102 /config/alias.php
103 /vendor/prestashop/autoload/src/PrestashopAutoload.php
104 /vendor/prestashop/autoload/src/LegacyClassLoader.php
105 /vendor/symfony/symfony/src/Symfony/Component/Filesystem/Filesystem.php
106 /vendor/prestashop/autoload/src/Autoloader.php
107 /config/bootstrap.php
108 /src/Core/ContainerBuilder.php
109 /src/Core/Foundation/IoC/Container.php
110 /src/Adapter/ServiceLocator.php
111 /var/cache/prod/appParameters.php
114 /var/cache/prod/class_index.php
115 /classes/controller/Controller.php
117 /classes/ObjectModel.php
118 /src/Core/Foundation/Database/EntityInterface.php
120 /classes/db/Db.php
122 /classes/Hook.php
124 /classes/module/Module.php
125 /src/Core/Module/Legacy/ModuleInterface.php
127 /classes/Tools.php
128 /classes/Context.php
129 /classes/shop/Shop.php
130 /src/Core/Security/PasswordGenerator.php
131 /classes/db/DbPDO.php
132 /classes/AddressFormat.php
133 /classes/Configuration.php
134 /classes/Validate.php
135 /classes/cache/Cache.php
136 /src/Adapter/EntityMapper.php
137 /classes/db/DbQuery.php
138 /src/Core/Addon/Theme/ThemeManagerBuilder.php
139 /vendor/psr/log/Psr/Log/NullLogger.php
140 /vendor/psr/log/Psr/Log/AbstractLogger.php
141 /vendor/psr/log/Psr/Log/LoggerInterface.php
142 /src/Adapter/Configuration.php
143 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/ParameterBag.php
144 /src/Core/Domain/Configuration/ShopConfigurationInterface.php
145 /src/Core/ConfigurationInterface.php
146 /src/Core/Addon/Theme/ThemeRepository.php
147 /src/Core/Addon/AddonRepositoryInterface.php
148 /src/Core/Domain/Shop/ValueObject/ShopConstraint.php
149 /src/Core/Addon/Theme/Theme.php
150 /src/Core/Addon/AddonInterface.php
151 /src/Core/Util/ArrayFinder.php
152 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyAccess.php
153 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyAccessorBuilder.php
154 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyAccessor.php
155 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyAccessorInterface.php
156 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyPath.php
157 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyPathInterface.php
158 /config/defines_uri.inc.php
159 /classes/Language.php
160 /src/Core/Language/LanguageInterface.php
161 /classes/Country.php
162 /classes/PrestaShopCollection.php
163 /classes/shop/ShopGroup.php
164 /classes/Cookie.php
165 /classes/PhpEncryption.php
166 /classes/PhpEncryptionEngine.php
167 /vendor/defuse/php-encryption/src/Key.php
168 /vendor/defuse/php-encryption/src/Encoding.php
169 /vendor/defuse/php-encryption/src/Core.php
170 /vendor/defuse/php-encryption/src/Crypto.php
171 /vendor/defuse/php-encryption/src/KeyOrPassword.php
172 /vendor/defuse/php-encryption/src/RuntimeTests.php
173 /vendor/defuse/php-encryption/src/DerivedKeys.php
174 /vendor/defuse/php-encryption/src/Exception/WrongKeyOrModifiedCiphertextException.php
175 /vendor/defuse/php-encryption/src/Exception/CryptoException.php
176 /src/Core/Session/SessionHandler.php
177 /src/Core/Session/SessionHandlerInterface.php
178 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Session.php
179 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Attribute/AttributeBag.php
180 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Attribute/AttributeBagInterface.php
181 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/SessionBagInterface.php
182 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Flash/FlashBag.php
183 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Flash/FlashBagInterface.php
184 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/SessionBagProxy.php
185 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/SessionInterface.php
186 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/PhpBridgeSessionStorage.php
187 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/NativeSessionStorage.php
188 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/MetadataBag.php
189 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/Handler/StrictSessionHandler.php
190 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/Handler/AbstractSessionHandler.php
191 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/Proxy/SessionHandlerProxy.php
192 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/Proxy/AbstractProxy.php
193 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/SessionStorageInterface.php
194 /config/smarty.config.inc.php
195 /vendor/smarty/smarty/libs/Smarty.class.php
196 /vendor/smarty/smarty/libs/functions.php
197 /vendor/smarty/smarty/libs/Autoloader.php
198 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_data.php
199 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_extension_handler.php
200 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php
201 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php
202 /vendor/smarty/smarty/libs/sysplugins/smarty_resource.php
203 /vendor/smarty/smarty/libs/sysplugins/smarty_variable.php
204 /vendor/smarty/smarty/libs/sysplugins/smarty_template_source.php
205 /vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php
206 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_resource_file.php
207 /config/smartyfront.config.inc.php
208 /classes/Smarty/SmartyResourceModule.php
209 /vendor/smarty/smarty/libs/sysplugins/smarty_resource_custom.php
210 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_method_registerresource.php
211 /classes/Smarty/SmartyResourceParent.php
212 /classes/Smarty/SmartyLazyRegister.php
213 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_method_registerplugin.php
214 /vendor/smarty/smarty/libs/plugins/modifier.truncate.php
215 /classes/Customer.php
216 /classes/Group.php
217 /classes/Link.php
218 /classes/shop/ShopUrl.php
219 /classes/Dispatcher.php
220 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Request.php
221 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/AcceptHeader.php
222 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/AcceptHeaderItem.php
223 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/FileBag.php
224 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/HeaderBag.php
225 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/HeaderUtils.php
226 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/ServerBag.php
227 /src/Adapter/SymfonyContainer.php
228 /vendor/mobiledetect/mobiledetectlib/Mobile_Detect.php
229 /config/db_slave_server.inc.php
230 /src/Adapter/ContainerBuilder.php
231 /src/Adapter/Environment.php
232 /src/Core/EnvironmentInterface.php
233 /vendor/symfony/symfony/src/Symfony/Component/Config/ConfigCache.php
234 /vendor/symfony/symfony/src/Symfony/Component/Config/ResourceCheckerConfigCache.php
235 /vendor/symfony/symfony/src/Symfony/Component/Config/ConfigCacheInterface.php
236 /vendor/symfony/symfony/src/Symfony/Component/Cache/DoctrineProvider.php
237 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/CacheProvider.php
238 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/Cache.php
239 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/FlushableCache.php
240 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/ClearableCache.php
241 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/MultiOperationCache.php
242 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/MultiGetCache.php
243 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/MultiDeleteCache.php
244 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/MultiPutCache.php
245 /vendor/symfony/symfony/src/Symfony/Component/Cache/PruneableInterface.php
246 /vendor/symfony/symfony/src/Symfony/Component/Cache/ResettableInterface.php
247 /vendor/symfony/contracts/Service/ResetInterface.php
248 /vendor/symfony/symfony/src/Symfony/Component/Cache/Adapter/ArrayAdapter.php
249 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/ArrayTrait.php
250 /vendor/psr/log/Psr/Log/LoggerAwareTrait.php
251 /vendor/symfony/symfony/src/Symfony/Component/Cache/Adapter/AdapterInterface.php
252 /vendor/symfony/symfony/src/Symfony/Component/Cache/CacheItem.php
253 /vendor/symfony/contracts/Cache/ItemInterface.php
254 /vendor/psr/cache/src/CacheItemInterface.php
255 /vendor/psr/cache/src/CacheItemPoolInterface.php
256 /vendor/symfony/contracts/Cache/CacheInterface.php
257 /vendor/psr/log/Psr/Log/LoggerAwareInterface.php
258 /vendor/doctrine/orm/lib/Doctrine/ORM/Tools/Setup.php
259 /vendor/doctrine/deprecations/lib/Doctrine/Deprecations/Deprecation.php
260 /vendor/doctrine/orm/lib/Doctrine/ORM/Configuration.php
261 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Configuration.php
262 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/Psr6/CacheAdapter.php
263 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/Psr6/DoctrineProvider.php
264 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/AnnotationReader.php
265 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/Reader.php
266 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/AnnotationRegistry.php
267 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Driver/DoctrineAnnotations.php
268 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Annotation.php
269 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Entity.php
270 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Embeddable.php
271 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Embedded.php
272 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/MappedSuperclass.php
273 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/InheritanceType.php
274 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/DiscriminatorColumn.php
275 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/DiscriminatorMap.php
276 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Id.php
277 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/GeneratedValue.php
278 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Version.php
279 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/JoinColumn.php
280 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/JoinColumns.php
281 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Column.php
282 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/OneToOne.php
283 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/OneToMany.php
284 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/ManyToOne.php
285 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/ManyToMany.php
286 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Table.php
287 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/UniqueConstraint.php
288 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Index.php
289 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/JoinTable.php
290 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/SequenceGenerator.php
291 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/CustomIdGenerator.php
292 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/ChangeTrackingPolicy.php
293 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/OrderBy.php
294 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/NamedQueries.php
295 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/NamedQuery.php
296 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/HasLifecycleCallbacks.php
297 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PrePersist.php
298 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PostPersist.php
299 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PreUpdate.php
300 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PostUpdate.php
301 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PreRemove.php
302 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PostRemove.php
303 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PostLoad.php
304 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PreFlush.php
305 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/FieldResult.php
306 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/ColumnResult.php
307 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/EntityResult.php
308 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/NamedNativeQuery.php
309 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/NamedNativeQueries.php
310 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/SqlResultSetMapping.php
311 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/SqlResultSetMappings.php
312 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/AssociationOverride.php
313 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/AssociationOverrides.php
314 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/AttributeOverride.php
315 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/AttributeOverrides.php
316 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/EntityListeners.php
317 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Cache.php
318 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/SimpleAnnotationReader.php
319 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/DocParser.php
320 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/DocLexer.php
321 /vendor/doctrine/lexer/lib/Doctrine/Common/Lexer/AbstractLexer.php
322 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/Annotation/Target.php
323 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Driver/AnnotationDriver.php
324 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Driver/CompatibilityAnnotationDriver.php
325 /vendor/doctrine/persistence/src/Persistence/Mapping/Driver/MappingDriver.php
326 /vendor/doctrine/persistence/src/Persistence/Mapping/Driver/ColocatedMappingDriver.php
327 /var/cache/prod/FrontContainer.php
328 /src/Adapter/Container/LegacyContainer.php
329 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/Container.php
330 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/Argument/RewindableGenerator.php
331 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/Argument/ServiceLocator.php
332 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/ServiceLocator.php
333 /vendor/symfony/contracts/Service/ServiceLocatorTrait.php
334 /vendor/psr/container/src/ContainerExceptionInterface.php
335 /vendor/psr/container/src/NotFoundExceptionInterface.php
336 /vendor/symfony/contracts/Service/ServiceProviderInterface.php
337 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/ResettableContainerInterface.php
338 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/ContainerInterface.php
339 /src/Adapter/Container/LegacyContainerInterface.php
340 /modules/blockwishlist/vendor/autoload.php
341 /modules/blockwishlist/vendor/composer/autoload_real.php
342 /modules/blockwishlist/vendor/composer/autoload_static.php
343 /modules/contactform/vendor/autoload.php
344 /modules/contactform/vendor/composer/autoload_real.php
345 /modules/contactform/vendor/composer/autoload_static.php
346 /modules/dashactivity/vendor/autoload.php
347 /modules/dashactivity/vendor/composer/autoload_real.php
348 /modules/dashactivity/vendor/composer/autoload_static.php
349 /modules/dashtrends/vendor/autoload.php
350 /modules/dashtrends/vendor/composer/autoload_real.php
351 /modules/dashtrends/vendor/composer/autoload_static.php
352 /modules/dashgoals/vendor/autoload.php
353 /modules/dashgoals/vendor/composer/autoload_real.php
354 /modules/dashgoals/vendor/composer/autoload_static.php
355 /modules/dashproducts/vendor/autoload.php
356 /modules/dashproducts/vendor/composer/autoload_real.php
357 /modules/dashproducts/vendor/composer/autoload_static.php
358 /modules/graphnvd3/vendor/autoload.php
359 /modules/graphnvd3/vendor/composer/autoload_real.php
360 /modules/graphnvd3/vendor/composer/autoload_static.php
361 /modules/gridhtml/vendor/autoload.php
362 /modules/gridhtml/vendor/composer/autoload_real.php
363 /modules/gridhtml/vendor/composer/autoload_static.php
364 /modules/gsitemap/vendor/autoload.php
365 /modules/gsitemap/vendor/composer/autoload_real.php
366 /modules/gsitemap/vendor/composer/autoload_static.php
367 /modules/pagesnotfound/vendor/autoload.php
368 /modules/pagesnotfound/vendor/composer/autoload_real.php
369 /modules/pagesnotfound/vendor/composer/autoload_static.php
370 /modules/productcomments/vendor/autoload.php
371 /modules/productcomments/vendor/composer/autoload_real.php
372 /modules/productcomments/vendor/composer/autoload_static.php
373 /modules/ps_categorytree/vendor/autoload.php
374 /modules/ps_categorytree/vendor/composer/autoload_real.php
375 /modules/ps_categorytree/vendor/composer/autoload_static.php
376 /modules/ps_checkpayment/vendor/autoload.php
377 /modules/ps_checkpayment/vendor/composer/autoload_real.php
378 /modules/ps_checkpayment/vendor/composer/autoload_static.php
379 /modules/ps_contactinfo/vendor/autoload.php
380 /modules/ps_contactinfo/vendor/composer/autoload_real.php
381 /modules/ps_contactinfo/vendor/composer/autoload_static.php
382 /modules/ps_crossselling/vendor/autoload.php
383 /modules/ps_crossselling/vendor/composer/autoload_real.php
384 /modules/ps_crossselling/vendor/composer/autoload_static.php
385 /modules/ps_currencyselector/vendor/autoload.php
386 /modules/ps_currencyselector/vendor/composer/autoload_real.php
387 /modules/ps_currencyselector/vendor/composer/autoload_static.php
388 /modules/ps_customeraccountlinks/vendor/autoload.php
389 /modules/ps_customeraccountlinks/vendor/composer/autoload_real.php
390 /modules/ps_customeraccountlinks/vendor/composer/autoload_static.php
391 /modules/ps_customtext/vendor/autoload.php
392 /modules/ps_customtext/vendor/composer/autoload_real.php
393 /modules/ps_customtext/vendor/composer/autoload_static.php
394 /modules/ps_dataprivacy/vendor/autoload.php
395 /modules/ps_dataprivacy/vendor/composer/autoload_real.php
396 /modules/ps_dataprivacy/vendor/composer/autoload_static.php
397 /modules/ps_emailsubscription/vendor/autoload.php
398 /modules/ps_emailsubscription/vendor/composer/autoload_real.php
399 /modules/ps_emailsubscription/vendor/composer/autoload_static.php
400 /modules/ps_faviconnotificationbo/vendor/autoload.php
401 /modules/ps_faviconnotificationbo/vendor/composer/autoload_real.php
402 /modules/ps_faviconnotificationbo/vendor/composer/autoload_static.php
403 /modules/ps_featuredproducts/vendor/autoload.php
404 /modules/ps_featuredproducts/vendor/composer/autoload_real.php
405 /modules/ps_featuredproducts/vendor/composer/autoload_static.php
406 /modules/ps_imageslider/vendor/autoload.php
407 /modules/ps_imageslider/vendor/composer/autoload_real.php
408 /modules/ps_imageslider/vendor/composer/autoload_static.php
409 /modules/ps_languageselector/vendor/autoload.php
410 /modules/ps_languageselector/vendor/composer/autoload_real.php
411 /modules/ps_languageselector/vendor/composer/autoload_static.php
412 /modules/ps_linklist/vendor/autoload.php
413 /modules/ps_linklist/vendor/composer/autoload_real.php
414 /modules/ps_linklist/vendor/composer/autoload_static.php
415 /modules/ps_mainmenu/vendor/autoload.php
416 /modules/ps_mainmenu/vendor/composer/autoload_real.php
417 /modules/ps_mainmenu/vendor/composer/autoload_static.php
418 /modules/ps_searchbar/vendor/autoload.php
419 /modules/ps_searchbar/vendor/composer/autoload_real.php
420 /modules/ps_searchbar/vendor/composer/platform_check.php
421 /modules/ps_searchbar/vendor/composer/autoload_static.php
422 /modules/ps_sharebuttons/vendor/autoload.php
423 /modules/ps_sharebuttons/vendor/composer/autoload_real.php
424 /modules/ps_sharebuttons/vendor/composer/platform_check.php
425 /modules/ps_sharebuttons/vendor/composer/autoload_static.php
426 /modules/ps_shoppingcart/vendor/autoload.php
427 /modules/ps_shoppingcart/vendor/composer/autoload_real.php
428 /modules/ps_shoppingcart/vendor/composer/autoload_static.php
429 /modules/ps_socialfollow/vendor/autoload.php
430 /modules/ps_socialfollow/vendor/composer/autoload_real.php
431 /modules/ps_socialfollow/vendor/composer/autoload_static.php
432 /modules/ps_themecusto/vendor/autoload.php
433 /modules/ps_themecusto/vendor/composer/autoload_real.php
434 /modules/ps_themecusto/vendor/composer/autoload_static.php
435 /modules/ps_wirepayment/vendor/autoload.php
436 /modules/ps_wirepayment/vendor/composer/autoload_real.php
437 /modules/ps_wirepayment/vendor/composer/autoload_static.php
438 /modules/statsbestcustomers/vendor/autoload.php
439 /modules/statsbestcustomers/vendor/composer/autoload_real.php
440 /modules/statsbestcustomers/vendor/composer/autoload_static.php
441 /modules/statsbestsuppliers/vendor/autoload.php
442 /modules/statsbestsuppliers/vendor/composer/autoload_real.php
443 /modules/statsbestsuppliers/vendor/composer/autoload_static.php
444 /modules/statscatalog/vendor/autoload.php
445 /modules/statscatalog/vendor/composer/autoload_real.php
446 /modules/statscatalog/vendor/composer/autoload_static.php
447 /modules/statscheckup/vendor/autoload.php
448 /modules/statscheckup/vendor/composer/autoload_real.php
449 /modules/statscheckup/vendor/composer/autoload_static.php
450 /modules/statsdata/vendor/autoload.php
451 /modules/statsdata/vendor/composer/autoload_real.php
452 /modules/statsdata/vendor/composer/autoload_static.php
453 /modules/statsproduct/vendor/autoload.php
454 /modules/statsproduct/vendor/composer/autoload_real.php
455 /modules/statsproduct/vendor/composer/autoload_static.php
456 /modules/statsstock/vendor/autoload.php
457 /modules/statsstock/vendor/composer/autoload_real.php
458 /modules/statsstock/vendor/composer/autoload_static.php
459 /modules/psgdpr/vendor/autoload.php
460 /modules/psgdpr/vendor/composer/autoload_real.php
461 /modules/psgdpr/vendor/composer/autoload_static.php
462 /modules/blockreassurance/vendor/autoload.php
463 /modules/blockreassurance/vendor/composer/autoload_real.php
464 /modules/blockreassurance/vendor/composer/autoload_static.php
465 /modules/ps_facetedsearch/vendor/autoload.php
466 /modules/ps_facetedsearch/vendor/composer/autoload_real.php
467 /modules/ps_facetedsearch/vendor/composer/autoload_static.php
468 /modules/nkmgls/vendor/autoload.php
469 /modules/nkmgls/vendor/composer/autoload_real.php
470 /modules/nkmgls/vendor/composer/platform_check.php
471 /modules/nkmgls/vendor/composer/autoload_static.php
472 /modules/nkmgls/vendor/nukium/gls-prestashop/lib/NkmHelper.php
473 /modules/paybox/vendor/autoload.php
474 /modules/paybox/vendor/composer/autoload_real.php
475 /modules/paybox/vendor/composer/platform_check.php
476 /modules/paybox/vendor/composer/autoload_static.php
477 /modules/paybox/vendor/clue/stream-filter/src/functions_include.php
478 /modules/paybox/vendor/clue/stream-filter/src/functions.php
479 /modules/paybox/vendor/php-http/message/src/filters.php
480 /modules/iqitsociallogin/vendor/autoload.php
481 /modules/iqitsociallogin/vendor/composer/autoload_real.php
482 /modules/iqitsociallogin/vendor/composer/platform_check.php
483 /modules/iqitsociallogin/vendor/composer/autoload_static.php
484 /modules/ps_eventbus/vendor/autoload.php
485 /modules/ps_eventbus/vendor/composer/autoload_real.php
486 /modules/ps_eventbus/vendor/composer/autoload_static.php
487 /modules/ps_accounts/vendor/autoload.php
488 /modules/ps_accounts/vendor/composer/autoload_real.php
489 /modules/ps_accounts/vendor/composer/platform_check.php
490 /modules/ps_accounts/vendor/composer/autoload_static.php
491 /modules/ps_accounts/vendor/paragonie/random_compat/lib/random.php
492 /modules/ps_accounts/vendor/symfony/polyfill-ctype/bootstrap.php
493 /modules/ps_accounts/vendor/lcobucci/jwt/compat/class-aliases.php
494 /modules/ps_accounts/vendor/lcobucci/jwt/src/Token.php
495 /modules/ps_accounts/vendor/lcobucci/jwt/src/Signature.php
496 /modules/ps_accounts/vendor/lcobucci/jwt/compat/json-exception-polyfill.php
497 /modules/ps_accounts/vendor/lcobucci/jwt/compat/lcobucci-clock-polyfill.php
498 /modules/ps_accounts/vendor/phpseclib/phpseclib/phpseclib/bootstrap.php
499 /modules/ps_accounts/vendor/ramsey/uuid/src/functions.php
500 /modules/ps_accounts/vendor/segmentio/analytics-php/lib/Segment.php
501 /modules/ps_accounts/vendor/segmentio/analytics-php/lib/Segment/Client.php
502 /modules/ps_accounts/vendor/segmentio/analytics-php/lib/Segment/Consumer.php
503 /modules/ps_accounts/vendor/segmentio/analytics-php/lib/Segment/QueueConsumer.php
504 /modules/ps_accounts/vendor/segmentio/analytics-php/lib/Segment/Consumer/File.php
505 /modules/ps_accounts/vendor/segmentio/analytics-php/lib/Segment/Consumer/ForkCurl.php
506 /modules/ps_accounts/vendor/segmentio/analytics-php/lib/Segment/Consumer/LibCurl.php
507 /modules/ps_accounts/vendor/segmentio/analytics-php/lib/Segment/Consumer/Socket.php
508 /modules/ps_accounts/vendor/segmentio/analytics-php/lib/Segment/Version.php
509 /modules/ps_emailalerts/vendor/autoload.php
510 /modules/ps_emailalerts/vendor/composer/autoload_real.php
511 /modules/ps_emailalerts/vendor/composer/autoload_static.php
512 /modules/ps_checkout/vendor/autoload.php
513 /modules/ps_checkout/vendor/composer/autoload_real.php
514 /modules/ps_checkout/vendor/composer/platform_check.php
515 /modules/ps_checkout/vendor/composer/autoload_static.php
516 /modules/ps_checkout/vendor/ramsey/uuid/src/functions.php
517 /modules/autoupgrade/vendor/autoload.php
518 /modules/autoupgrade/vendor/composer/autoload_real.php
519 /modules/autoupgrade/vendor/composer/autoload_static.php
520 /modules/sendinblue/vendor/autoload.php
521 /modules/sendinblue/vendor/composer/autoload_real.php
522 /modules/sendinblue/vendor/composer/platform_check.php
523 /modules/sendinblue/vendor/composer/autoload_static.php
524 /src/Core/Hook/HookModuleFilter.php
525 /src/Core/Hook/HookModuleFilterInterface.php
526 /modules/ps_checkout/ps_checkout.php
527 /classes/PaymentModule.php
528 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_method_createdata.php
529 /vendor/smarty/smarty/libs/sysplugins/smarty_data.php
530 /classes/Translate.php
531 /modules/ps_checkout/translations/fr.php
532 /src/PrestaShopBundle/Translation/TranslatorComponent.php
533 /vendor/symfony/symfony/src/Symfony/Component/Translation/Translator.php
534 /vendor/symfony/symfony/src/Symfony/Component/Translation/TranslatorInterface.php
535 /vendor/symfony/contracts/Translation/LocaleAwareInterface.php
536 /vendor/symfony/contracts/Translation/TranslatorInterface.php
537 /vendor/symfony/symfony/src/Symfony/Component/Translation/TranslatorBagInterface.php
538 /src/PrestaShopBundle/Translation/PrestaShopTranslatorTrait.php
539 /src/PrestaShopBundle/Translation/TranslatorLanguageTrait.php
540 /src/PrestaShopBundle/Translation/TranslatorInterface.php
541 /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/MessageFormatter.php
542 /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/IntlFormatter.php
543 /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/IntlFormatterInterface.php
544 /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/MessageFormatterInterface.php
545 /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/ChoiceMessageFormatterInterface.php
546 /vendor/symfony/symfony/src/Symfony/Component/Translation/IdentityTranslator.php
547 /vendor/symfony/contracts/Translation/TranslatorTrait.php
548 /vendor/symfony/symfony/src/Symfony/Component/Config/ConfigCacheFactory.php
549 /vendor/symfony/symfony/src/Symfony/Component/Config/ConfigCacheFactoryInterface.php
550 /var/cache/prod/translations/catalogue.fr-FR.NXhscRe.php
551 /vendor/symfony/symfony/src/Symfony/Component/Translation/MessageCatalogue.php
552 /vendor/symfony/symfony/src/Symfony/Component/Translation/MessageCatalogueInterface.php
553 /vendor/symfony/symfony/src/Symfony/Component/Translation/MetadataAwareInterface.php
554 /controllers/front/listing/CategoryController.php
555 /classes/controller/ProductListingFrontController.php
556 /classes/controller/ProductPresentingFrontController.php
557 /classes/controller/FrontController.php
558 /src/Adapter/Presenter/Object/ObjectPresenter.php
559 /src/Adapter/Presenter/PresenterInterface.php
560 /src/Adapter/Presenter/Cart/CartPresenter.php
561 /src/Adapter/Image/ImageRetriever.php
562 /classes/tax/TaxConfiguration.php
563 /classes/Smarty/TemplateFinder.php
564 /classes/assets/StylesheetManager.php
565 /classes/assets/AbstractAssetManager.php
566 /src/Adapter/Assets/AssetUrlGeneratorTrait.php
567 /classes/assets/JavascriptManager.php
568 /classes/assets/CccReducer.php
569 /modules/iqitthemeeditor/iqitthemeeditor.php
570 /modules/iqitthemeeditor/src/IqitSmartyModifiers.php
571 /modules/iqitthemeeditor/translations/fr.php
572 /classes/Category.php
573 /classes/webservice/WebserviceRequest.php
574 /src/Core/Localization/Locale/Repository.php
575 /src/Core/Localization/Locale/RepositoryInterface.php
576 /src/Core/Localization/CLDR/LocaleRepository.php
577 /src/Core/Localization/CLDR/LocaleDataSource.php
578 /src/Core/Localization/CLDR/DataLayer/LocaleCache.php
579 /src/Core/Data/Layer/AbstractDataLayer.php
580 /src/Core/Localization/CLDR/LocaleDataLayerInterface.php
581 /vendor/symfony/symfony/src/Symfony/Component/Cache/Adapter/FilesystemAdapter.php
582 /vendor/symfony/symfony/src/Symfony/Component/Cache/Adapter/AbstractAdapter.php
583 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/AbstractAdapterTrait.php
584 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/AbstractTrait.php
585 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/ContractsTrait.php
586 /vendor/symfony/contracts/Cache/CacheTrait.php
587 /vendor/psr/cache/src/InvalidArgumentException.php
588 /vendor/psr/cache/src/CacheException.php
589 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/FilesystemTrait.php
590 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/FilesystemCommonTrait.php
591 /vendor/symfony/symfony/src/Symfony/Component/Cache/Marshaller/DefaultMarshaller.php
592 /vendor/symfony/symfony/src/Symfony/Component/Cache/Marshaller/MarshallerInterface.php
593 /src/Core/Localization/CLDR/DataLayer/LocaleReference.php
594 /src/Core/Localization/CLDR/Reader.php
595 /src/Core/Localization/CLDR/ReaderInterface.php
596 /src/Core/Localization/Currency/Repository.php
597 /src/Core/Localization/Currency/RepositoryInterface.php
598 /src/Core/Localization/Currency/CurrencyDataSource.php
599 /src/Core/Localization/Currency/DataSourceInterface.php
600 /src/Core/Localization/Currency/DataLayer/CurrencyCache.php
601 /src/Core/Localization/Currency/CurrencyDataLayerInterface.php
602 /src/Core/Localization/Currency/DataLayer/CurrencyDatabase.php
603 /src/Adapter/Currency/CurrencyDataProvider.php
604 /src/Core/Currency/CurrencyDataProviderInterface.php
605 /src/Adapter/LegacyContext.php
606 /src/Adapter/Tools.php
607 /src/Core/Localization/Currency/DataLayer/CurrencyReference.php
608 /src/Core/Localization/Currency/DataLayer/CurrencyInstalled.php
609 /vendor/prestashop/decimal/src/Operation/Rounding.php
610 /src/Core/Localization/Locale.php
611 /src/Core/Localization/LocaleInterface.php
612 /src/Core/Localization/Specification/Price.php
613 /src/Core/Localization/Specification/Number.php
614 /src/Core/Localization/Specification/NumberInterface.php
615 /src/Core/Localization/Specification/Factory.php
616 /src/Core/Localization/CLDR/LocaleData.php
617 /src/Core/Localization/CLDR/NumberSymbolsData.php
618 /src/Core/Localization/CLDR/CurrencyData.php
619 /src/Core/Localization/CLDR/Locale.php
620 /src/Core/Localization/CLDR/LocaleInterface.php
621 /src/Core/Localization/Specification/NumberSymbolList.php
622 /classes/Currency.php
623 /src/Core/Localization/Currency/LocalizedCurrencyId.php
624 /src/Core/Localization/Currency/CurrencyData.php
625 /src/Core/Localization/Currency/CurrencyCollection.php
626 /src/Core/Localization/Currency.php
627 /src/Core/Localization/CurrencyInterface.php
628 /src/Core/Localization/Specification/NumberCollection.php
629 /src/Core/Localization/Number/Formatter.php
630 /classes/Cart.php
631 /src/Adapter/AddressFactory.php
632 /classes/CartRule.php
633 /classes/Product.php
634 /src/Core/Domain/Product/ValueObject/RedirectType.php
635 /src/Core/Util/DateTime/DateTime.php
636 /src/Core/Domain/Product/Stock/ValueObject/OutOfStockType.php
637 /src/Core/Domain/Product/Pack/ValueObject/PackStockType.php
638 /src/Core/Domain/Product/ValueObject/ProductType.php
639 /src/Core/Domain/Product/ValueObject/Reference.php
640 /src/Core/Domain/Product/ValueObject/Ean13.php
641 /src/Core/Domain/Product/ValueObject/Isbn.php
642 /src/Core/Domain/Product/ValueObject/Upc.php
643 /src/Core/Domain/Product/ProductSettings.php
644 /src/Core/Image/ImageFormatConfiguration.php
645 /src/Core/Image/ImageFormatConfigurationInterface.php
646 /classes/FeatureFlag.php
647 /src/Core/FeatureFlag/FeatureFlagSettings.php
648 /classes/ImageType.php
649 /src/Core/Domain/Shop/ValueObject/ShopId.php
650 /src/Core/Domain/Shop/ValueObject/ShopIdInterface.php
651 /modules/ps_emailsubscription/ps_emailsubscription.php
652 /src/Core/Module/WidgetInterface.php
653 /src/PrestaShopBundle/Translation/DomainNormalizer.php
654 /classes/Media.php
655 /modules/blockreassurance/blockreassurance.php
656 /modules/nkmgls/nkmgls.php
657 /modules/nkmgls/controllers/admin/AdminGlsOrderController.php
658 /classes/controller/ModuleAdminController.php
659 /classes/controller/AdminController.php
660 /modules/nkmgls/controllers/admin/AdminGlsAjaxController.php
661 /modules/nkmgls/controllers/admin/AdminGlsLabelController.php
662 /modules/nkmgls/controllers/admin/AdminGlsPackingListController.php
663 /classes/module/CarrierModule.php
664 /modules/nkmgls/translations/fr.php
665 /modules/nkmgls/vendor/nukium/gls-prestashop/src/Service/Init/PrestashopGlsInit.php
666 /modules/nkmgls/vendor/nukium/gls-common/src/Service/Init/GlsInit.php
667 /modules/nkmgls/vendor/nukium/gls-common/src/Util/ServiceInstantiationTrait.php
668 /modules/nkmgls/vendor/nukium/gls-common/src/Service/Container.php
669 /modules/nkmgls/vendor/nukium/gls-common/src/Service/ContainerInterface.php
670 /modules/nkmgls/vendor/nukium/gls-common/src/Service/Init/ShipItAdapterResolutionInit.php
671 /modules/nkmgls/vendor/nukium/gls-prestashop/src/Service/Init/PrestashopAdapterInit.php
672 /modules/nkmgls/vendor/nukium/gls-common/src/Service/Init/AdapterInitInterface.php
673 /modules/nkmgls/vendor/nukium/gls-common/src/Service/Repository/Cache/CacheRepositoryFactory.php
674 /modules/nkmgls/vendor/nukium/gls-prestashop/src/Service/Repository/Cache/PrestashopCacheRepository.php
675 /modules/nkmgls/vendor/nukium/gls-prestashop/src/Service/Repository/AbstractRepository.php
676 /modules/nkmgls/vendor/nukium/gls-common/src/Service/Repository/Cache/CacheRepositoryInterface.php
677 /modules/nkmgls/vendor/nukium/gls-prestashop/classes/GlsCacheClass.php
678 /modules/nkmgls/vendor/nukium/gls-common/src/Entity/CacheInterface.php
679 /modules/nkmgls/vendor/nukium/gls-common/src/Service/Handler/DTO/Adapter/Address/AddressHandlerFactory.php
680 /modules/nkmgls/vendor/nukium/gls-prestashop/src/Service/Handler/DTO/Adapter/Address/PrestashopAddressHandler.php
681 /modules/nkmgls/vendor/nukium/gls-common/src/Service/Handler/DTO/Adapter/Address/AddressHandler.php
682 /modules/nkmgls/vendor/nukium/gls-common/src/Service/Handler/DTO/Adapter/Carrier/CarrierHandlerFactory.php
683 /modules/nkmgls/vendor/nukium/gls-prestashop/src/Service/Handler/DTO/Adapter/Carrier/PrestashopCarrierHandler.php
684 /modules/nkmgls/vendor/nukium/gls-common/src/Service/Handler/DTO/Adapter/Carrier/CarrierHandler.php
685 /modules/nkmgls/vendor/nukium/gls-prestashop/src/Service/Helper/ModuleHelper.php
686 /modules/nkmgls/vendor/nukium/gls-prestashop/src/Service/Adapter/Config/PrestashopConfig.php
687 /modules/nkmgls/vendor/nukium/gls-common/src/Service/Adapter/Config/ConfigInterface.php
688 /modules/nkmgls/vendor/nukium/gls-prestashop/src/Service/Repository/Carrier/PrestashopCarrierRepository.php
689 /classes/Carrier.php
690 /modules/nkmgls/vendor/nukium/gls-common/src/Service/Handler/Entity/Cache/CacheHandlerFactory.php
691 /modules/nkmgls/vendor/nukium/gls-prestashop/src/Service/Handler/Entity/Cache/PrestashopCacheHandler.php
692 /modules/nkmgls/vendor/nukium/gls-common/src/Service/Handler/Entity/Cache/CacheHandler.php
693 /modules/nkmgls/vendor/nukium/gls-common/src/Service/Adapter/Config/ConfigFactory.php
694 /modules/nkmgls/vendor/nukium/gls-common/src/Service/Adapter/EntityManager/EntityManagerFactory.php
695 /modules/nkmgls/vendor/nukium/gls-prestashop/src/Service/Adapter/EntityManager/PrestashopEntityManager.php
696 /modules/nkmgls/vendor/nukium/gls-common/src/Service/Adapter/EntityManager/EntityManagerInterface.php
697 /modules/nkmgls/vendor/nukium/gls-common/src/Service/Adapter/Shop/ShopFactory.php
698 /modules/nkmgls/vendor/nukium/gls-prestashop/src/Service/Adapter/Shop/PrestashopShop.php
699 /modules/nkmgls/vendor/nukium/gls-common/src/Service/Adapter/Shop/ShopInterface.php
700 /modules/nkmgls/vendor/nukium/gls-common/src/Service/Adapter/Translator/TranslatorFactory.php
701 /modules/nkmgls/vendor/nukium/gls-prestashop/src/Service/Adapter/Translator/PrestashopTranslator.php
702 /modules/nkmgls/vendor/nukium/gls-common/src/Service/Adapter/Translator/TranslatorInterface.php
703 /modules/nkmgls/vendor/nukium/gls-common/src/Service/Adapter/Utility/UtilityFactory.php
704 /modules/nkmgls/vendor/nukium/gls-prestashop/src/Service/Adapter/Utility/PrestashopUtility.php
705 /modules/nkmgls/vendor/nukium/gls-common/src/Service/Adapter/Utility/Component/DefaultUtility.php
706 /modules/nkmgls/vendor/nukium/gls-prestashop/src/Service/Patch/PatchSystem.php
707 /modules/nkmgls/vendor/nukium/gls-common/src/Service/Adapter/Logger/Component/DefaultLogger.php
708 /modules/nkmgls/vendor/nukium/gls-prestashop/src/Service/Patch/Component/AddOriginalAddressPatch.php
709 /modules/nkmgls/vendor/nukium/gls-prestashop/src/Service/Patch/PatchComponentInterface.php
710 /modules/nkmgls/vendor/nukium/gls-common/src/Service/ShipIt/ShipItAdapterResolution.php
711 /modules/nkmgls/vendor/nukium/gls-common/src/Service/ShipIt/Adapter/NoShipItAdapter.php
712 /modules/nkmgls/vendor/nukium/gls-common/src/Service/ShipIt/ShipItAdapterInterface.php
713 /modules/nkmgls/vendor/nukium/gls-common/src/Service/ShipIt/Adapter/LabelAdapter.php
714 /modules/nkmgls/vendor/nukium/gls-common/src/Service/ShipIt/Adapter/AbstractAdapter.php
715 /modules/nkmgls/vendor/nukium/gls-common/src/Service/ShipIt/Adapter/Component/AuthErrorComponent.php
716 /modules/nkmgls/vendor/nukium/gls-common/src/Service/ShipIt/ShipItComponentInterface.php
717 /modules/nkmgls/vendor/nukium/gls-common/src/Service/ShipIt/Adapter/Component/DefaultErrorComponent.php
718 /modules/nkmgls/vendor/nukium/gls-common/src/Service/Adapter/Logger/LoggerFactory.php
719 /modules/nkmgls/vendor/nukium/gls-common/src/Service/ShipIt/Adapter/Component/LabelInternationalComponent.php
720 /modules/nkmgls/vendor/nukium/gls-common/src/Service/ShipIt/Routine/ShipItErrorRoutine.php
721 /modules/nkmgls/vendor/nukium/gls-common/src/Service/API/ShipmentApi.php
722 /modules/nkmgls/vendor/nukium/gls-common/src/Service/HttpClient/LegacyClient.php
723 /modules/nkmgls/vendor/nukium/gls-common/src/Service/Handler/Legacy/GlsApiHandler.php
724 /modules/nkmgls/vendor/nukium/gls-common/src/Service/HttpClient/GlsCurlClient.php
725 /modules/nkmgls/vendor/nukium/gls-common/src/Service/Helper/GlsHelper.php
726 /modules/nkmgls/vendor/nukium/gls-common/src/Service/ShipIt/Adapter/Component/LabelErrorComponent.php
727 /modules/nkmgls/vendor/nukium/gls-common/src/Service/ShipIt/Adapter/Component/LabelComponent.php
728 /modules/nkmgls/vendor/nukium/gls-common/src/Service/ShipIt/Adapter/RelayAdapter.php
729 /modules/nkmgls/vendor/nukium/gls-common/src/Service/ShipIt/Adapter/Component/RelayComponent.php
730 /modules/nkmgls/vendor/nukium/gls-common/src/Service/ShipIt/Adapter/TrackingAdapter.php
731 /modules/nkmgls/vendor/nukium/gls-common/src/Service/ShipIt/Adapter/Component/TrackingComponent.php
732 /modules/nkmgls/vendor/nukium/gls-common/src/Service/API/TrackingApi.php
733 /modules/nkmgls/vendor/nukium/gls-prestashop/src/Service/Handler/Carrier/GlsExpressHandler.php
734 /modules/nkmgls/vendor/nukium/gls-prestashop/src/Service/Helper/FtpHelper.php
735 /modules/nkmgls/vendor/nukium/gls-prestashop/src/Service/Helper/EnvHelper.php
736 /modules/nkmgls/vendor/nukium/gls-common/src/Service/Routine/AllowedServicesRoutine.php
737 /modules/nkmgls/vendor/nukium/gls-common/src/Service/DataLoader/AllowedServicesLoader.php
738 /modules/nkmgls/vendor/nukium/gls-common/src/Service/Handler/DTO/GLS/AllowedServicesHandler.php
739 /modules/nkmgls/vendor/nukium/gls-common/src/Service/API/AllowedServicesApi.php
740 /modules/nkmgls/vendor/nukium/gls-common/src/Service/Routine/CacheRoutine.php
741 /modules/nkmgls/vendor/nukium/gls-common/src/Service/DataLoader/CacheLoader.php
742 /modules/paybox/paybox.php
743 /modules/paybox/src/Configuration/Settings.php
744 /modules/paybox/vendor/netresearch/jsonmapper/src/JsonMapper.php
745 /modules/paybox/src/Configuration/Account.php
746 /modules/paybox/src/Configuration/DemoAccount.php
747 /modules/paybox/src/Configuration/PaymentConfiguration.php
748 /modules/paybox/src/Configuration/SubscriptionConfiguration.php
749 /modules/paybox/src/Configuration/InstalmentConfiguration.php
750 /modules/paybox/src/Configuration/Instalment.php
751 /modules/paybox/src/Configuration/Contract.php
752 /modules/paybox/src/Utils/Tools.php
753 /vendor/monolog/monolog/src/Monolog/Logger.php
754 /vendor/monolog/monolog/src/Monolog/ResettableInterface.php
755 /vendor/monolog/monolog/src/Monolog/Handler/RotatingFileHandler.php
756 /vendor/monolog/monolog/src/Monolog/Handler/StreamHandler.php
757 /vendor/monolog/monolog/src/Monolog/Handler/AbstractProcessingHandler.php
758 /vendor/monolog/monolog/src/Monolog/Handler/AbstractHandler.php
759 /vendor/monolog/monolog/src/Monolog/Handler/HandlerInterface.php
760 /vendor/monolog/monolog/src/Monolog/Utils.php
761 /modules/paybox/translations/fr.php
762 /modules/ps_emailalerts/ps_emailalerts.php
763 /modules/ps_emailalerts/MailAlert.php
764 /modules/ps_checkout/vendor/prestashop/module-lib-service-container/src/DependencyInjection/ServiceContainer.php
765 /modules/ps_checkout/vendor/prestashop/module-lib-cache-directory-provider/src/Cache/CacheDirectoryProvider.php
766 /modules/ps_checkout/vendor/prestashop/module-lib-service-container/src/DependencyInjection/ContainerProvider.php
767 /var/cache/prod/Ps_checkout8440FrontContainer.php
768 /modules/ps_checkout/src/Validator/FrontControllerValidator.php
769 /modules/ps_checkout/src/Validator/MerchantValidator.php
770 /modules/ps_checkout/src/PayPal/PayPalConfiguration.php
771 /modules/ps_checkout/src/Configuration/PrestaShopConfiguration.php
772 /modules/ps_checkout/src/Configuration/PrestaShopConfigurationOptionsResolver.php
773 /modules/ps_checkout/src/Shop/ShopProvider.php
774 /vendor/symfony/symfony/src/Symfony/Component/OptionsResolver/OptionsResolver.php
775 /vendor/symfony/symfony/src/Symfony/Component/OptionsResolver/Options.php
776 /modules/ps_checkout/src/Repository/PayPalCodeRepository.php
777 /modules/ps_checkout/src/Repository/PsAccountRepository.php
778 /modules/ps_checkout/vendor/prestashop/prestashop-accounts-installer/src/Installer/Facade/PsAccounts.php
779 /modules/ps_checkout/vendor/prestashop/prestashop-accounts-installer/src/Installer/Installer.php
780 /src/Core/Addon/Module/ModuleManagerBuilder.php
781 /src/Core/Util/File/YamlParser.php
782 /vendor/symfony/symfony/src/Symfony/Component/Config/Resource/SelfCheckingResourceChecker.php
783 /vendor/symfony/symfony/src/Symfony/Component/Config/ResourceCheckerInterface.php
784 /vendor/symfony/symfony/src/Symfony/Component/Config/Resource/FileResource.php
785 /vendor/symfony/symfony/src/Symfony/Component/Config/Resource/SelfCheckingResourceInterface.php
786 /vendor/symfony/symfony/src/Symfony/Component/Config/Resource/ResourceInterface.php
787 /var/cache/prod/yaml/4b591b7a28d98961575010499c0558f3.php
788 /src/Adapter/LegacyLogger.php
789 /src/PrestaShopBundle/Service/DataProvider/Admin/CategoriesProvider.php
790 /src/Adapter/Module/ModuleDataProvider.php
791 /src/Adapter/Module/AdminModuleDataProvider.php
792 /src/PrestaShopBundle/Service/DataProvider/Admin/ModuleInterface.php
793 /src/Adapter/Module/Module.php
794 /src/Core/Module/ModuleInterface.php
795 /vendor/symfony/symfony/src/Symfony/Component/Config/FileLocator.php
796 /vendor/symfony/symfony/src/Symfony/Component/Config/FileLocatorInterface.php
797 /vendor/symfony/symfony/src/Symfony/Component/Routing/Loader/YamlFileLoader.php
798 /vendor/symfony/symfony/src/Symfony/Component/Config/Loader/FileLoader.php
799 /vendor/symfony/symfony/src/Symfony/Component/Config/Loader/Loader.php
800 /vendor/symfony/symfony/src/Symfony/Component/Config/Loader/LoaderInterface.php
801 /vendor/symfony/symfony/src/Symfony/Component/Routing/Router.php
802 /vendor/symfony/symfony/src/Symfony/Component/Routing/RouterInterface.php
803 /vendor/symfony/symfony/src/Symfony/Component/Routing/Matcher/UrlMatcherInterface.php
804 /vendor/symfony/symfony/src/Symfony/Component/Routing/RequestContextAwareInterface.php
805 /vendor/symfony/symfony/src/Symfony/Component/Routing/Generator/UrlGeneratorInterface.php
806 /vendor/symfony/symfony/src/Symfony/Component/Routing/Matcher/RequestMatcherInterface.php
807 /vendor/symfony/symfony/src/Symfony/Component/Routing/RequestContext.php
808 /src/Adapter/Module/ModuleDataUpdater.php
809 /src/Core/Module/ModuleManager.php
810 /src/Core/Module/ModuleManagerInterface.php
811 /src/Core/Module/ModuleRepository.php
812 /src/Core/Module/ModuleRepositoryInterface.php
813 /src/Adapter/HookManager.php
814 /src/Core/Module/SourceHandler/SourceHandlerFactory.php
815 /src/PrestaShopBundle/Event/Dispatcher/NullDispatcher.php
816 /vendor/symfony/symfony/src/Symfony/Component/EventDispatcher/EventDispatcherInterface.php
817 /vendor/symfony/contracts/EventDispatcher/EventDispatcherInterface.php
818 /src/Core/Hook/HookDispatcherInterface.php
819 /modules/ps_accounts/ps_accounts.php
820 /modules/ps_accounts/src/Hook/HookableTrait.php
821 /modules/ps_accounts/src/Module/Install.php
822 /modules/ps_accounts/translations/fr.php
823 /modules/ps_accounts/src/ServiceContainer/PsAccountsContainer.php
824 /modules/ps_accounts/vendor/prestashopcorp/lightweight-container/src/ServiceContainer/ServiceContainer.php
825 /modules/ps_accounts/config.php
826 /modules/ps_accounts/src/Log/Logger.php
827 /modules/ps_accounts/vendor/monolog/monolog/src/Monolog/Logger.php
828 /modules/ps_accounts/vendor/psr/log/Psr/Log/LoggerInterface.php
829 /modules/ps_accounts/vendor/monolog/monolog/src/Monolog/ResettableInterface.php
830 /modules/ps_accounts/vendor/monolog/monolog/src/Monolog/Handler/RotatingFileHandler.php
831 /modules/ps_accounts/vendor/monolog/monolog/src/Monolog/Handler/StreamHandler.php
832 /modules/ps_accounts/vendor/monolog/monolog/src/Monolog/Handler/AbstractProcessingHandler.php
833 /modules/ps_accounts/vendor/monolog/monolog/src/Monolog/Handler/AbstractHandler.php
834 /modules/ps_accounts/vendor/monolog/monolog/src/Monolog/Handler/HandlerInterface.php
835 /modules/ps_accounts/vendor/monolog/monolog/src/Monolog/Utils.php
836 /modules/ps_accounts/src/ServiceProvider/ApiClientProvider.php
837 /modules/ps_accounts/vendor/prestashopcorp/lightweight-container/src/ServiceContainer/Contract/IServiceProvider.php
838 /modules/ps_accounts/src/ServiceProvider/CommandProvider.php
839 /modules/ps_accounts/src/ServiceProvider/DefaultProvider.php
840 /modules/ps_accounts/src/ServiceProvider/OAuth2Provider.php
841 /modules/ps_accounts/src/ServiceProvider/RepositoryProvider.php
842 /modules/ps_accounts/src/ServiceProvider/SessionProvider.php
843 /modules/ps_accounts/src/Service/PsAccountsService.php
844 /modules/ps_accounts/src/Account/Session/ShopSession.php
845 /modules/ps_accounts/src/Account/Session/Session.php
846 /modules/ps_accounts/src/Account/Session/SessionInterface.php
847 /modules/ps_accounts/src/Repository/ConfigurationRepository.php
848 /modules/ps_accounts/src/Adapter/Configuration.php
849 /modules/ps_accounts/src/Service/OAuth2/OAuth2Service.php
850 /modules/ps_accounts/src/Http/Client/ClientConfig.php
851 /modules/ps_accounts/src/Http/Client/ConfigObject.php
852 /modules/ps_accounts/src/Type/Enum.php
853 /modules/ps_accounts/src/Service/OAuth2/OAuth2Client.php
854 /modules/ps_accounts/src/Adapter/Link.php
855 /modules/ps_accounts/src/Context/ShopContext.php
856 /modules/ps_accounts/vendor/ramsey/uuid/src/Uuid.php
857 /modules/ps_accounts/vendor/ramsey/uuid/src/UuidInterface.php
858 /modules/ps_accounts/vendor/ramsey/uuid/src/UuidFactory.php
859 /modules/ps_accounts/vendor/ramsey/uuid/src/UuidFactoryInterface.php
860 /modules/ps_accounts/vendor/ramsey/uuid/src/FeatureSet.php
861 /modules/ps_accounts/vendor/ramsey/uuid/src/Converter/Number/DegradedNumberConverter.php
862 /modules/ps_accounts/vendor/ramsey/uuid/src/Converter/NumberConverterInterface.php
863 /modules/ps_accounts/vendor/ramsey/uuid/src/Builder/DefaultUuidBuilder.php
864 /modules/ps_accounts/vendor/ramsey/uuid/src/Builder/UuidBuilderInterface.php
865 /modules/ps_accounts/vendor/ramsey/uuid/src/Codec/StringCodec.php
866 /modules/ps_accounts/vendor/ramsey/uuid/src/Codec/CodecInterface.php
867 /modules/ps_accounts/vendor/ramsey/uuid/src/Provider/Node/FallbackNodeProvider.php
868 /modules/ps_accounts/vendor/ramsey/uuid/src/Provider/NodeProviderInterface.php
869 /modules/ps_accounts/vendor/ramsey/uuid/src/Provider/Node/SystemNodeProvider.php
870 /modules/ps_accounts/vendor/ramsey/uuid/src/Provider/Node/RandomNodeProvider.php
871 /modules/ps_accounts/vendor/ramsey/uuid/src/Generator/RandomGeneratorFactory.php
872 /modules/ps_accounts/vendor/ramsey/uuid/src/Generator/RandomBytesGenerator.php
873 /modules/ps_accounts/vendor/ramsey/uuid/src/Generator/RandomGeneratorInterface.php
874 /modules/ps_accounts/vendor/ramsey/uuid/src/Provider/Time/SystemTimeProvider.php
875 /modules/ps_accounts/vendor/ramsey/uuid/src/Provider/TimeProviderInterface.php
876 /modules/ps_accounts/vendor/ramsey/uuid/src/Generator/TimeGeneratorFactory.php
877 /modules/ps_accounts/vendor/ramsey/uuid/src/Converter/Time/PhpTimeConverter.php
878 /modules/ps_accounts/vendor/ramsey/uuid/src/Converter/TimeConverterInterface.php
879 /modules/ps_accounts/vendor/ramsey/uuid/src/Generator/DefaultTimeGenerator.php
880 /modules/ps_accounts/vendor/ramsey/uuid/src/Generator/TimeGeneratorInterface.php
881 /modules/ps_accounts/vendor/ramsey/uuid/src/BinaryUtils.php
882 /modules/ps_accounts/src/Service/OAuth2/CachedFile.php
883 /modules/ps_accounts/src/Account/LinkShop.php
884 /modules/ps_accounts/src/Cqrs/CommandBus.php
885 /modules/ps_accounts/src/Cqrs/Bus.php
886 /modules/ps_accounts/src/Account/Session/Firebase/ShopSession.php
887 /modules/ps_accounts/src/Account/Session/Firebase/FirebaseSession.php
888 /modules/ps_accounts/src/Account/Session/Firebase/OwnerSession.php
889 /modules/ps_checkout/src/Context/PrestaShopContext.php
890 /modules/ps_checkout/src/ExpressCheckout/ExpressCheckoutConfiguration.php
891 /modules/ps_checkout/src/PayPal/PayPalPayLaterConfiguration.php
892 /modules/ps_checkout/src/Version/Version.php
893 /modules/ps_accounts/src/Adapter/ConfigurationKeys.php
894 /src/Adapter/Presenter/Cart/CartLazyArray.php
895 /src/Adapter/Presenter/AbstractLazyArray.php
896 /src/Adapter/Product/PriceFormatter.php
897 /src/Core/Util/Inflector.php
898 /vendor/doctrine/inflector/lib/Doctrine/Inflector/InflectorFactory.php
899 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Language.php
900 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/English/InflectorFactory.php
901 /vendor/doctrine/inflector/lib/Doctrine/Inflector/GenericLanguageInflectorFactory.php
902 /vendor/doctrine/inflector/lib/Doctrine/Inflector/LanguageInflectorFactory.php
903 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/English/Rules.php
904 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Ruleset.php
905 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Transformations.php
906 /vendor/doctrine/inflector/lib/Doctrine/Inflector/WordInflector.php
907 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/English/Inflectible.php
908 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Transformation.php
909 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Pattern.php
910 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Patterns.php
911 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/English/Uninflected.php
912 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Substitutions.php
913 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Substitution.php
914 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Word.php
915 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Inflector.php
916 /vendor/doctrine/inflector/lib/Doctrine/Inflector/CachedWordInflector.php
917 /vendor/doctrine/inflector/lib/Doctrine/Inflector/RulesetInflector.php
918 /classes/Gender.php
919 /classes/Risk.php
920 /classes/Meta.php
921 /modules/revsliderprestashop/revsliderprestashop.php
922 /modules/revsliderprestashop/rev-loader.php
923 /modules/revsliderprestashop/includes/revslider_db.class.php
924 /modules/revsliderprestashop/includes/data.class.php
925 /modules/revsliderprestashop/includes/functions.class.php
926 /modules/revsliderprestashop/includes/em-integration.class.php
927 /modules/revsliderprestashop/includes/cssparser.class.php
928 /modules/revsliderprestashop/includes/woocommerce.class.php
929 /modules/revsliderprestashop/includes/wpml.class.php
930 /modules/revsliderprestashop/includes/colorpicker.class.php
931 /modules/revsliderprestashop/includes/navigation.class.php
932 /modules/revsliderprestashop/includes/object-library.class.php
933 /modules/revsliderprestashop/admin/includes/loadbalancer.class.php
934 /modules/revsliderprestashop/admin/includes/plugin-update.class.php
935 /modules/revsliderprestashop/includes/extension.class.php
936 /modules/revsliderprestashop/includes/favorite.class.php
937 /modules/revsliderprestashop/includes/aq-resizer.class.php
938 /modules/revsliderprestashop/includes/external-sources.class.php
939 /modules/revsliderprestashop/includes/page-template.class.php
940 /modules/revsliderprestashop/includes/slider.class.php
941 /modules/revsliderprestashop/includes/slide.class.php
942 /modules/revsliderprestashop/includes/output.class.php
943 /modules/revsliderprestashop/public/revslider-front.class.php
944 /modules/revsliderprestashop/includes/backwards.php
945 /modules/revsliderprestashop/admin/includes/class-pclzip.php
946 /modules/revsliderprestashop/admin/includes/license.class.php
947 /modules/revsliderprestashop/admin/includes/addons.class.php
948 /modules/revsliderprestashop/admin/includes/template.class.php
949 /modules/revsliderprestashop/admin/includes/functions-admin.class.php
950 /modules/revsliderprestashop/admin/includes/folder.class.php
951 /modules/revsliderprestashop/admin/includes/import.class.php
952 /modules/revsliderprestashop/admin/includes/export.class.php
953 /modules/revsliderprestashop/admin/includes/export-html.class.php
954 /modules/revsliderprestashop/admin/includes/newsletter.class.php
955 /modules/revsliderprestashop/admin/revslider-admin.class.php
956 /modules/revsliderprestashop/includes/update.class.php
957 /modules/revsliderprestashop/includes/resize-imag.php
958 /modules/revsliderprestashop/translations/fr.php
959 /classes/Address.php
960 /classes/State.php
961 /src/Core/Security/PasswordPolicyConfiguration.php
962 /src/Core/Configuration/DataConfigurationInterface.php
963 /src/Core/Security/Hashing.php
964 /src/Core/Filter/FrontEndObject/MainFilter.php
965 /src/Core/Filter/FilterInterface.php
966 /src/Core/Filter/FrontEndObject/CartFilter.php
967 /src/Core/Filter/HashMapWhitelistFilter.php
968 /src/Core/Filter/CollectionFilter.php
969 /src/Core/Filter/FrontEndObject/ProductFilter.php
970 /src/Core/Filter/FrontEndObject/EmbeddedAttributesFilter.php
971 /src/Core/Filter/FrontEndObject/CustomerFilter.php
972 /src/Core/Filter/FrontEndObject/ShopFilter.php
973 /src/Core/Filter/FrontEndObject/ConfigurationFilter.php
974 /modules/productcomments/productcomments.php
975 /modules/ps_shoppingcart/ps_shoppingcart.php
976 /modules/iqitcontactpage/iqitcontactpage.php
977 /modules/iqitcontactpage/translations/fr.php
978 /modules/iqitsociallogin/iqitsociallogin.php
979 /modules/iqitsociallogin/translations/fr.php
980 /modules/iqitmegamenu/iqitmegamenu.php
981 /modules/iqitmegamenu/models/IqitMenuTab.php
982 /modules/iqitmegamenu/models/IqitMenuHtml.php
983 /modules/iqitmegamenu/models/IqitMenuLinks.php
984 /modules/iqitmegamenu/translations/fr.php
985 /modules/iqitelementor/iqitelementor.php
986 /modules/iqitelementor/src/IqitElementorLanding.php
987 /modules/iqitelementor/src/IqitElementorTemplate.php
988 /modules/iqitelementor/src/IqitElementorProduct.php
989 /modules/iqitelementor/src/IqitElementorCategory.php
990 /modules/iqitelementor/src/IqitElementorContent.php
991 /modules/iqitelementor/src/iqitElementorWpHelper.php
992 /modules/iqitelementor/includes/plugin-elementor.php
993 /modules/iqitelementor/src/widgets/IqitElementorWidget_Brands.php
994 /modules/iqitelementor/src/widgets/IqitElementorWidget_ProductsList.php
995 /modules/iqitelementor/src/widgets/IqitElementorWidget_ProductsListTabs.php
996 /modules/iqitelementor/src/widgets/IqitElementorWidget_Modules.php
997 /modules/iqitelementor/src/widgets/IqitElementorWidget_CustomTpl.php
998 /modules/iqitelementor/src/widgets/IqitElementorWidget_Menu.php
999 /modules/iqitelementor/src/widgets/IqitElementorWidget_RevolutionSlider.php
1000 /modules/iqitelementor/src/widgets/IqitElementorWidget_Newsletter.php
1001 /modules/iqitelementor/src/widgets/IqitElementorWidget_Blog.php
1002 /modules/iqitelementor/src/widgets/IqitElementorWidget_Search.php
1003 /modules/iqitelementor/src/widgets/IqitElementorWidget_Links.php
1004 /modules/iqitelementor/src/widgets/IqitElementorWidget_ContactForm.php
1005 /modules/iqitelementor/translations/fr.php
1006 /modules/iqitfreedeliverycount/iqitfreedeliverycount.php
1007 /modules/iqitfreedeliverycount/translations/fr.php
1008 /modules/sendinblue/sendinblue.php
1009 /modules/sendinblue/translations/fr.php
1010 /modules/sendinblue/services/ConfigService.php
1011 /modules/colissimo_simplicite/colissimo_simplicite.php
1012 /modules/colissimo_simplicite/models/ColissimoDeliveryInfo.php
1013 /modules/colissimo_simplicite/models/ColissimoDeliveryPoint.php
1014 /modules/colissimo_simplicite/translations/fr.php
1015 /modules/lgcookieslaw/lgcookieslaw.php
1016 /modules/lgcookieslaw/translations/fr.php
1017 /src/Core/Product/Search/ProductSearchContext.php
1018 /src/Core/Product/Search/ProductSearchQuery.php
1019 /src/Core/Product/Search/SortOrder.php
1020 /modules/ps_facetedsearch/ps_facetedsearch.php
1021 /modules/ps_facetedsearch/src/HookDispatcher.php
1022 /modules/ps_facetedsearch/src/Hook/Attribute.php
1023 /modules/ps_facetedsearch/src/Hook/AbstractHook.php
1024 /modules/ps_facetedsearch/src/Hook/AttributeGroup.php
1025 /modules/ps_facetedsearch/src/Hook/Category.php
1026 /modules/ps_facetedsearch/src/Hook/Configuration.php
1027 /modules/ps_facetedsearch/src/Hook/Design.php
1028 /modules/ps_facetedsearch/src/Hook/Feature.php
1029 /modules/ps_facetedsearch/src/Form/Feature/FormModifier.php
1030 /modules/ps_facetedsearch/src/Form/Feature/FormDataProvider.php
1031 /modules/ps_facetedsearch/src/Hook/FeatureValue.php
1032 /modules/ps_facetedsearch/src/Form/FeatureValue/FormModifier.php
1033 /modules/ps_facetedsearch/src/Form/FeatureValue/FormDataProvider.php
1034 /modules/ps_facetedsearch/src/Hook/Product.php
1035 /modules/ps_facetedsearch/src/Hook/ProductSearch.php
1036 /modules/ps_facetedsearch/src/Hook/SpecificPrice.php
1037 /modules/ps_facetedsearch/src/Filters/Provider.php
1038 /modules/ps_facetedsearch/src/URLSerializer.php
1039 /modules/ps_facetedsearch/src/Filters/DataAccessor.php
1040 /modules/ps_facetedsearch/src/Product/SearchProvider.php
1041 /src/Core/Product/Search/FacetsRendererInterface.php
1042 /src/Core/Product/Search/ProductSearchProviderInterface.php
1043 /modules/ps_facetedsearch/src/Filters/Converter.php
1044 /modules/ps_facetedsearch/src/Product/SearchFactory.php
1045 /src/Core/Product/Search/ProductSearchResult.php
1046 /classes/Combination.php
1047 /classes/Manufacturer.php
1048 /src/Core/Util/String/StringModifier.php
1049 /src/Core/Util/String/StringModifierInterface.php
1050 /modules/ps_facetedsearch/src/Product/Search.php
1051 /modules/ps_facetedsearch/src/Adapter/MySQL.php
1052 /modules/ps_facetedsearch/src/Adapter/AbstractAdapter.php
1053 /modules/ps_facetedsearch/src/Adapter/InterfaceAdapter.php
1054 /vendor/doctrine/collections/lib/Doctrine/Common/Collections/ArrayCollection.php
1055 /vendor/doctrine/collections/lib/Doctrine/Common/Collections/Collection.php
1056 /vendor/doctrine/collections/lib/Doctrine/Common/Collections/ReadableCollection.php
1057 /vendor/doctrine/collections/lib/Doctrine/Common/Collections/Selectable.php
1058 /modules/ps_facetedsearch/src/Filters/Products.php
1059 /classes/stock/StockAvailable.php
1060 /modules/ps_facetedsearch/src/Filters/Block.php
1061 /modules/ps_facetedsearch/src/Definition/Availability.php
1062 /src/Core/Product/Search/Facet.php
1063 /src/Core/Product/Search/Filter.php
1064 /vendor/prestashop/decimal/src/DecimalNumber.php
1065 /vendor/prestashop/decimal/src/Builder.php
1066 /src/Core/Product/Search/FacetCollection.php
1067 /classes/ProductAssembler.php
1068 /classes/tax/Tax.php
1069 /classes/SpecificPrice.php
1070 /classes/tax/TaxManagerFactory.php
1071 /classes/tax/TaxRulesTaxManager.php
1072 /classes/tax/TaxManagerInterface.php
1073 /classes/tax/TaxCalculator.php
1074 /classes/GroupReduction.php
1075 /src/Core/Localization/CLDR/ComputingPrecision.php
1076 /src/Core/Localization/CLDR/ComputingPrecisionInterface.php
1077 /classes/Pack.php
1078 /classes/order/Order.php
1079 /classes/Feature.php
1080 /classes/ProductPresenterFactory.php
1081 /src/Adapter/Presenter/Product/ProductListingPresenter.php
1082 /src/Adapter/Presenter/Product/ProductPresenter.php
1083 /src/Adapter/Product/ProductColorsRetriever.php
1084 /src/Core/Product/ProductPresentationSettings.php
1085 /src/Adapter/Presenter/Product/ProductListingLazyArray.php
1086 /src/Adapter/Presenter/Product/ProductLazyArray.php
1087 /classes/Image.php
1088 /vendor/prestashop/decimal/src/Operation/Division.php
1089 /vendor/prestashop/decimal/src/Operation/Multiplication.php
1090 /vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php
1091 /var/cache/prod/smarty/compile/warehouse/d4/1d/65/d41d65d76b9471b5d365fe06cf1737c89a53af9f_2.module.ps_facetedsearchviewstemplatesfrontcatalogfacets.tpl.php
1092 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_block.php
1093 /vendor/smarty/smarty/libs/plugins/modifier.count.php
1094 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php
1095 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_foreach.php
1096 /var/cache/prod/smarty/compile/warehouse/2e/80/73/2e807335546cfa2360c36327ac89dd2fcb054379_2.module.ps_facetedsearchviewstemplatesfrontcatalogactivefilters.tpl.php
1097 /src/Core/Product/Search/Pagination.php
1098 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/bb/85/6b/bb856bc456eeb8d3881b4b16559692931100cee3_2.file.category.tpl.php
1099 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_capture.php
1100 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/92/5b/54/925b5420d64b948b3229da21ab6dd2ff798a7a1a_2.file.product-list.tpl.php
1101 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/24/3e/71/243e71636e97556888c0393b2f9b2707ca88ed68_2.file.layout-left-column.tpl.php
1102 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/71/d7/35/71d735abfb624f417275d842d825bca284f61193_2.file.layout-both-columns.tpl.php
1103 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/7d/45/b7/7d45b7ec7efac918307809de29557d44680a63e4_2.file.helpers.tpl.php
1104 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_tplfunction.php
1105 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/86/07/8b/86078b28459fa7cd90601729f42410aa6198246a_2.file.head.tpl.php
1106 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/75/a1/41/75a14189d0796b2f1afd51b5286ce629009a30ed_2.file.head-jsonld.tpl.php
1107 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/4f/0b/1f/4f0b1fdd2b9e22e8147a81c8cb2124c0a64a0d9f_2.file.product-list-jsonld.tpl.php
1108 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/53/60/5f/53605fdf8a8949b6a22d2d9cb063fe42d53e06b8_2.file.pagination-seo.tpl.php
1109 /vendor/smarty/smarty/libs/plugins/modifier.replace.php
1110 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/39/a8/b1/39a8b12a758387bfe9a459af55b35aa2633c339c_2.file.stylesheets.tpl.php
1111 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/cd/b1/00/cdb100cf3c2798f0d78781ef17d51d53ad8d6aa3_2.file.javascript.tpl.php
1112 /classes/ProductDownload.php
1113 /src/Core/Cart/Calculator.php
1114 /src/Core/Cart/CartRowCollection.php
1115 /src/Core/Cart/Fees.php
1116 /src/Core/Cart/AmountImmutable.php
1117 /src/Core/Cart/CartRuleCollection.php
1118 /src/Core/Cart/CartRuleCalculator.php
1119 /src/Adapter/Product/PriceCalculator.php
1120 /src/Core/Cart/CartRow.php
1121 /vendor/symfony/symfony/src/Symfony/Component/Translation/PluralizationRules.php
1122 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/15/5f/49/155f4970adacdf2bb136d57371ece6919a20a9f4_2.file.product-activation.tpl.php
1123 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/49/3f/fd/493ffd63fb8e54f110fda59bc59cba5f0243b073_2.file.header.tpl.php
1124 /modules/iqithtmlandbanners/iqithtmlandbanners.php
1125 /modules/iqithtmlandbanners/src/IqitHtmlAndBannerRepository.php
1126 /modules/iqithtmlandbanners/src/IqitHtmlAndBannerPresenter.php
1127 /modules/iqithtmlandbanners/src/IqitHtmlAndBanner.php
1128 /modules/iqithtmlandbanners/translations/fr.php
1129 /vendor/smarty/smarty/libs/sysplugins/smarty_template_cached.php
1130 /vendor/smarty/smarty/libs/sysplugins/smarty_cacheresource.php
1131 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_cacheresource_file.php
1132 /var/cache/prod/smarty/cache/iqithtmlandbanners/1/1/1/1/8/displayNav1/warehouse/c7/74/df/c774dfa1ec092af1bad964e2e84d44e094a12e16.iqithtmlandbannersviewstemplateshookiqithtmlandbanners.tpl.php
1133 /modules/ps_languageselector/ps_languageselector.php
1134 /modules/ps_currencyselector/ps_currencyselector.php
1135 /var/cache/prod/smarty/compile/warehouse/b9/77/56/b97756c07f8c7dd53da6530f78f67ddd242f77c9_2.module.ps_currencyselectorps_currencyselector.tpl.php
1136 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/16/a1/8f/16a18f495002f0441eaa5151434d5866441bac65_2.file.header-2.tpl.php
1137 /modules/iqitsearch/iqitsearch.php
1138 /modules/iqitsearch/translations/fr.php
1139 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_method_gettemplatevars.php
1140 /var/cache/prod/smarty/compile/warehouse/78/3c/e0/783ce0bc99544193d9645b02e003b32e879d6a43_2.module.iqitsearchviewstemplateshookiqitsearch.tpl.php
1141 /var/cache/prod/smarty/compile/warehouse/46/29/db/4629dbb3c4efa13c090c633dc2e46e5f2b42bed3_2.module.iqitsearchviewstemplateshooksearchbar.tpl.php
1142 /modules/ps_customersignin/ps_customersignin.php
1143 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/72/be/19/72be192e406191c1cad554abe284e159adeb4234_2.module.ps_customersigninps_customersigninbtn.tpl.php
1144 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/b4/a4/76/b4a476e0a8201677b298f7c0f8ca1ac698e1bac3_2.module.ps_shoppingcartps_shoppingcartbtn.tpl.php
1145 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/35/65/5e/35655e6409b6198f29dd6e732ef9598dec599880_2.module.ps_shoppingcartps_shoppingcart.tpl.php
1146 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/f6/e9/f2/f6e9f2b1680a466582d2199d038efe2cfa3a83f7_2.module.ps_shoppingcartps_shoppingcartcontent.tpl.php
1147 /var/cache/prod/smarty/cache/iqitmegamenu/index/1/1/1/1/8/warehouse/12/c6/31/12c63107907c6d214b90e77509786468cad41332.iqitmegamenuviewstemplateshookhorizontal.tpl.php
1148 /classes/CMS.php
1149 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_updatecache.php
1150 /var/cache/prod/smarty/compile/warehouse/79/74/04/797404135c3d6163c184d5946c377ac2bc91c4d2_2.module.iqitmegamenuviewstemplateshookhorizontal.tpl.cache.php
1151 /vendor/smarty/smarty/libs/plugins/shared.mb_str_replace.php
1152 /var/cache/prod/smarty/compile/warehouse/47/0d/5c/470d5c96fd175e37e89afd5cc78d331c9756e29d_2.module.iqitmegamenuviewstemplateshook_partialssubmenu_content.tpl.cache.php
1153 /var/cache/prod/smarty/compile/warehouse/98/cb/9e/98cb9e3fbf4c879e219db3109049550b02a2da1b_2.module.iqitmegamenuviewstemplateshookmobile.tpl.cache.php
1154 /var/cache/prod/smarty/compile/warehouse/56/f0/d4/56f0d4faf7cc1ec9240e891fedda6e0b4794dc62_2.module.iqitmegamenuviewstemplateshook_partialssubmenu_content_mobile.tpl.cache.php
1155 /var/cache/prod/smarty/compile/warehouse/9b/b6/a9/9bb6a9970aa01b8fd3c752c16e574cb1b14bf323_2.module.ps_languageselectorps_languageselectormobilemenu.tpl.cache.php
1156 /var/cache/prod/smarty/compile/warehouse/dd/65/22/dd6522dbacb2ead7139cef7a64e59ac80e0726fc_2.module.ps_currencyselectorps_currencyselectormobilemenu.tpl.cache.php
1157 /var/cache/prod/smarty/compile/warehouse/d3/f6/c8/d3f6c8247111f1ef9bebabfff451b9cb9207ba0b_2.module.ps_customersigninps_customersigninmobilemenu.tpl.cache.php
1158 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_codeframe.php
1159 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_writefile.php
1160 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/27/7f/d3/277fd37fbd4e3d5997a6729163ed4291fb7b747e_2.file.mobile-header-1.tpl.php
1161 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/7a/30/38/7a3038780284d52e9fcd7a66e51e5b86a166106b_2.module.iqitsearchviewstemplateshooksearchbarmobile.tpl.php
1162 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/be/ee/e6/beeee6f3d87613010f8af1cabc4c4562f8cf600a_2.module.ps_customersigninps_customersigninmobile.tpl.php
1163 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/d4/e1/57/d4e1571b6b210795247564db06deb17061778b51_2.module.ps_shoppingcartps_shoppingcartmqty.tpl.php
1164 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/9a/64/f3/9a64f33010c8c3420bbc410257bdb57f0a9bc3be_2.file.breadcrumb.tpl.php
1165 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/d4/35/7f/d4357f43e19050f2d2f2028e6f165cd3b7cc2cd7_2.file.notifications.tpl.php
1166 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/a7/28/48/a72848955674ed794c6c6a5e504b11a1cb173ed8_2.file.category-header.tpl.php
1167 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/92/94/ca/9294ca5ac8cef4c021336349ebba4cf8ccc608a1_2.file.products-top.tpl.php
1168 /vendor/smarty/smarty/libs/plugins/modifier.regex_replace.php
1169 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/83/e9/08/83e90827ba40fafa2a771c4073ac57f31928625e_2.file.sort-orders.tpl.php
1170 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/18/fe/cb/18fecbdf20428cf6869837dea2e0d5ca5dd8d3ec_2.file.products.tpl.php
1171 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/3f/3e/f7/3f3ef74c741ca95575dc32ec76705f946e3422a0_2.file.product.tpl.php
1172 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/0d/c1/99/0dc199c5d12599ceeb88b6a2b1d98a7a56f14314_2.file.product-miniature-1.tpl.php
1173 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/b6/dd/21/b6dd2164727c4f6493fca8e8e7fc27495f5e513d_2.file.product-miniature-thumb.tpl.php
1174 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/56/c3/f2/56c3f2a516718b563166d070fcdb1702f53c5b74_2.file.product-miniature-btn.tpl.php
1175 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/c3/b4/5d/c3b45dd17613497fe3573058ca4c0e68116beb49_2.file.pagination.tpl.php
1176 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/d7/38/da/d738dab394eb6986b6d095fda5b79bd9db20b43b_2.file.products-bottom.tpl.php
1177 /modules/ps_categorytree/ps_categorytree.php
1178 /var/cache/prod/smarty/compile/warehouse/89/21/00/8921007f54626fc7fe42cbff53f1d70828d3393d_2.module.ps_categorytreeviewstemplateshookps_categorytree.tpl.php
1179 /var/cache/prod/smarty/compile/warehouse/81/a1/04/81a1040ed0eeab6f58198f9907167c7fced628c5_2.module.ps_facetedsearchps_facetedsearch.tpl.php
1180 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/a1/9f/e0/a19fe04169c26490610977ee4790590b01e18353_2.file.footer.tpl.php
1181 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/49/8a/94/498a94e3fb2e357d8f6d4e4c267d7b70c033a1c3_2.file.footer-1.tpl.php
1182 /modules/iqitlinksmanager/iqitlinksmanager.php
1183 /modules/iqitlinksmanager/src/IqitLinkBlockRepository.php
1184 /modules/iqitlinksmanager/src/IqitLinkBlock.php
1185 /modules/iqitlinksmanager/src/IqitLinkBlockPresenter.php
1186 /modules/iqitlinksmanager/translations/fr.php
1187 /var/cache/prod/smarty/cache/iqitlinksmanager/1/1/1/1/8/displayFooter/warehouse/a3/94/0b/a3940bd1d7ebdb077f5394215b97cf9d975f5741.iqitlinksmanagerviewstemplateshookiqitlinksmanager.tpl.php
1188 /var/cache/prod/smarty/cache/iqitcontactpage/1/1/1/1/8/warehouse/c4/e5/8b/c4e58ba5baab27adb5450fcac6725664cd1cef81.iqitcontactpageviewstemplateshookiqitcontactpageblock.tpl.php
1189 /var/cache/prod/smarty/compile/warehouse/ee/75/26/ee752603de038a9aef5378771f6bf531aa9e40f3_2.module.iqitcontactpageviewstemplateshookiqitcontactpageblock.tpl.cache.php
1190 /var/cache/prod/smarty/compile/warehouse/44/b4/ef/44b4ef888deb2f933dcd9da2c1066fcd712ea5c6_2.module.iqitcontactpageviewstemplateshook_partialscontent.tpl.cache.php
1191 /var/cache/prod/smarty/compile/warehouse/2d/c2/29/2dc229bcd2fcd72db57e2012572582b00bdf5abe_2.file.cookieslaw.tpl.php
1192 /vendor/smarty/smarty/libs/plugins/modifier.escape.php
1193 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/63/d3/ad/63d3adee5f6b5e391329228d089f792c3bb82b69_2.file.social-links.tpl.php
1194 /var/cache/prod/smarty/compile/warehouse/30/7d/c6/307dc6bd4724d29d1572cc301dd7148e962604ef_2.module.ps_emailsubscriptionviewstemplateshookps_emailsubscription.tpl.php
1195 /modules/psgdpr/psgdpr.php
1196 /modules/psgdpr/translations/fr.php
1197 /modules/psgdpr/classes/GDPRConsent.php
1198 /var/cache/prod/smarty/compile/warehouse/5e/ee/24/5eee242e5cbca9bb89b8ffa439cebef7beaaf2e4_2.module.psgdprviewstemplateshookdisplayGDPRConsent.tpl.php
1199 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/16/d6/b8/16d6b8721374815caf8784f27e2d077ed824ca86_2.file.footer-copyrights-1.tpl.php
1200 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/22/f3/55/22f35596a1c264e5427f9b58f5206b3b8a797425_2.file.password-policy-template.tpl.php
1201 /modules/statsdata/statsdata.php
1202 /classes/Connection.php
1203 /classes/ConnectionsSource.php