Accueil

Load Time 5259 ms
Querying Time 3850 ms
Queries 4800
Memory Peak Usage 85.5 Mb
Included Files 1204 files - 13.59 Mb
PrestaShop Cache 5.29 Mb
Global vars 0.43 Mb
PrestaShop Version 8.2.1
PHP Version 8.1.32
MySQL Version 10.11.11-MariaDB-0ubuntu0.24.04.2
Memory Limit 4096M
Max Execution Time 600s
Smarty Cache enabled
Smarty Compilation auto
  Time Cumulated Time Memory Usage Memory Peak Usage
config 6.945 ms 6.945 ms 3.21 Mb 3.6 Mb
__construct 0.027 ms 6.972 ms - Mb 3.6 Mb
init 95.641 ms 102.613 ms 0.89 Mb 4.4 Mb
checkAccess 0.006 ms 102.619 ms - Mb 4.4 Mb
setMedia 33.442 ms 136.061 ms 0.61 Mb 4.7 Mb
postProcess 0.006 ms 136.067 ms - Mb 4.7 Mb
initHeader 0.002 ms 136.069 ms - Mb 4.7 Mb
initContent 4361 ms 4497 ms 55.51 Mb 60.3 Mb
initFooter 0.003 ms 4497 ms - Mb 60.3 Mb
display 761.285 ms 5259 ms 21.35 Mb 85.5 Mb
Hook Time Memory Usage
displayMainMenu 150.803 ms 5.67 Mb
ActionFrontControllerSetMedia 21.300 ms 0.19 Mb
displayLeftColumn 17.664 ms 0.74 Mb
DisplayHeader 11.175 ms 0.09 Mb
displayNav2 7.766 ms 0.19 Mb
displayFooter 6.366 ms 0.38 Mb
Footer 3.378 ms 0.18 Mb
IsJustElementor 1.926 ms 0.02 Mb
displayNav1 1.839 ms 0.08 Mb
DisplayBeforeBodyClosingTag 1.314 ms 0.05 Mb
DisplayGDPRConsent 1.002 ms 0.08 Mb
renderWidget 0.969 ms 0.05 Mb
ProductSearchProvider 0.466 ms - Mb
DisplayLeftColumn 0.334 ms 0.03 Mb
Header 0.137 ms - Mb
OverrideLayoutTemplate 0.094 ms - Mb
ActionDispatcher 0.018 ms - Mb
displayVerticalMenu 0.017 ms - Mb
ActionProductSearchAfter 0.017 ms - Mb
Top 0.014 ms - Mb
DisplayNavFullWidth 0.012 ms - Mb
ModuleRoutes 0.011 ms - Mb
DisplayAfterBodyOpeningTag 0.011 ms - Mb
DisplayFooterBefore 0.011 ms - Mb
DisplayFooterAfter 0.008 ms - Mb
25 hook(s) 226.652 ms 7.75 Mb
Module Time Memory Usage
ps_checkout 28.262 ms 0.22 Mb
iqitthemeeditor 3.823 ms 0.18 Mb
ps_emailsubscription 3.005 ms 0.26 Mb
blockreassurance 0.296 ms 0.02 Mb
nkmgls 7.522 ms 0.30 Mb
paybox 3.099 ms 0.08 Mb
ps_emailalerts 0.359 ms 0.01 Mb
ps_accounts 0.752 ms - Mb
revsliderprestashop 8.433 ms 0.05 Mb
productcomments 0.317 ms 0.01 Mb
ps_shoppingcart 0.250 ms 0.01 Mb
iqitcontactpage 2.934 ms 0.07 Mb
iqitsociallogin 0.525 ms 0.01 Mb
iqitmegamenu 151.458 ms 5.69 Mb
iqitelementor 2.815 ms 0.03 Mb
iqitfreedeliverycount 0.263 ms 0.01 Mb
sendinblue 2.999 ms 0.04 Mb
colissimo_simplicite 11.027 ms 0.09 Mb
lgcookieslaw 4.018 ms 0.19 Mb
ps_facetedsearch 1.468 ms 0.09 Mb
iqithtmlandbanners 2.315 ms 0.16 Mb
ps_languageselector 1.334 ms 0.05 Mb
ps_currencyselector 6.692 ms 0.15 Mb
iqitsearch 1.316 ms - Mb
ps_customersignin 0.095 ms 0.01 Mb
ps_categorytree 17.864 ms 0.75 Mb
iqitlinksmanager 1.966 ms 0.08 Mb
psgdpr 1.402 ms 0.19 Mb
statsdata 1.422 ms 0.05 Mb
29 module(s) 268.031 ms 8.74 Mb

Stopwatch SQL - 4800 queries

# Query Time (ms) Rows Filesort Group By Location
86
SELECT SQL_NO_CACHE p.id_product FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM hgt78_product p LEFT JOIN hgt78_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN hgt78_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN hgt78_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN hgt78_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN hgt78_category_product cp ON (p.id_product = cp.id_product) INNER JOIN hgt78_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN hgt78_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN hgt78_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN hgt78_stock_available sa_1 ON (p.id_product = sa_1.id_product AND IFNULL(pac.id_product_attribute, 0) = sa_1.id_product_attribute AND sa_1.id_shop = 1  AND sa_1.id_shop_group = 0 ) WHERE ((sa.quantity<=0 AND sa_1.out_of_stock IN (0, 2)) OR (sa.quantity>0)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND cp.id_category='38' GROUP BY p.id_product) p INNER JOIN hgt78_category_product cp ON (p.id_product = cp.id_product) GROUP BY p.id_product ORDER BY p.position ASC, p.id_product DESC
225.308 ms 35424 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
2
SELECT SQL_NO_CACHE c.`name`, cl.`id_lang`, IF(cl.`id_lang` IS NULL, c.`value`, cl.`value`) AS value, c.id_shop_group, c.id_shop
FROM `hgt78_configuration` c
LEFT JOIN `hgt78_configuration_lang` cl ON (c.`id_configuration` = cl.`id_configuration`)
26.387 ms 5859 /classes/Configuration.php:180
88
SELECT SQL_NO_CACHE p.*,
ps.*,
pl.*,
sa.out_of_stock,
IFNULL(sa.quantity, 0) as quantity,
(DATEDIFF(
p.`date_add`,
DATE_SUB(
'2025-05-01 00:00:00',
INTERVAL 20 DAY
)
) > 0) as new
FROM hgt78_product p
LEFT JOIN hgt78_product_lang pl
ON pl.id_product = p.id_product
AND pl.id_shop = 1
AND pl.id_lang = 1
LEFT JOIN hgt78_stock_available sa   ON sa.id_product = p.id_product
AND sa.id_product_attribute = 0
AND sa.id_shop = 1 LEFT JOIN hgt78_product_shop ps
ON ps.id_product = p.id_product
AND ps.id_shop = 1
WHERE p.id_product IN (7543,7542,7541,7540,7539,6727,5148,5147,5146,5145,5144,5143,5142,5141,5140,5139,5138,5137,5136,5135,5134,5133,4902,3743,3741,3740,3587,2893,2694,2660,2652,2651,2623,2767,2768,2769,2770,2773,2774,2775,2776,2766,2765,2661,2690,2691,2692,2693,2771,2738,2764,2777,2778,2779,2795,2797,2798,2799,2800,3178,3075,3176,2794,2793,2780,2781,3179,2788,2789,2790,2791,2792,3177,2659,2635,2631,2632,2633,2634,2782,2636,2637,2638,2639,2630,2629,2628,3477,2620,3459,2622,3458,2624,2625,2626,2627,2640,2641,2656,2648,2657,3456,2649,2658,2647,2646,2642,2643,2655,2644,2645,3252,3254,3255,3256,3264,3265,3326,3155,2818,2892,3099,3107,3132,3327,2490,2621,2733,2650,2654,3454,3455,3484,3556,3557,3558,3559,3584,3585,3586,3639,3689,3745,3746,3747,3748,3749,3750,3751,3752,3753,3754,3755,3756,3757,3763,3764,3765,3766,3771,3775,3776,3777,3804,3805,3806,3807,3808,3936,4256,4574,4575,4932,4934,4935,4942,4943,4944,4962,4963,4964,4965,4966,5265,5266,5267,5282,5283,5284,5293,5296,5335,5350,5093,5589,5590,5591,5592,5774,5970,5971,5972,5973,6047,6106,6107,6108,6129,6172,6173,6174,6176,6177,6178,6179,6180,6181,6182,6183,6184,6185,6186,6187,6188,6189,6191,6192,6193,6194,6195,6499,6500,6501,7938,7940,7941,7942,7943,7944,7945,7946,7769,7779,7773,8392,8393,8394,8395,8396,8397,8401,8417,8418,8419,8420,8975,8976,9055,9306,9321,9323,9324,9325,9535,9596,9597,9598,9687,9686,9688,9689,9690,9691,9692,9693,9694,9695,9697,10067,10068,10069,10070,10071,10072,10073,10111,10297,10298,10299,10302,10303,10304,10305,12552,12551,11001)
15.683 ms 296 /classes/ProductAssembler.php:95
103
SELECT SQL_NO_CACHE h.id_hook, h.name as h_name, title, description, h.position, hm.position as hm_position, m.id_module, m.name, m.active
FROM `hgt78_hook_module` hm
STRAIGHT_JOIN `hgt78_hook` h ON (h.id_hook = hm.id_hook AND hm.id_shop = 1)
STRAIGHT_JOIN `hgt78_module` as m ON (m.id_module = hm.id_module)
ORDER BY hm.position
8.868 ms 721 /classes/Hook.php:459
3508
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2775
ORDER BY `position`
8.813 ms 1 Yes /classes/Product.php:3545
14
SELECT SQL_NO_CACHE h.`name` as hook, m.`id_module`, h.`id_hook`, m.`name` as module
FROM `hgt78_module` m
INNER JOIN hgt78_module_shop module_shop
ON (module_shop.id_module = m.id_module AND module_shop.id_shop = 1 AND module_shop.enable_device & 1)
INNER JOIN `hgt78_hook_module` `hm` ON hm.`id_module` = m.`id_module`
INNER JOIN `hgt78_hook` `h` ON hm.`id_hook` = h.`id_hook`
LEFT JOIN `hgt78_module_group` `mg` ON mg.`id_module` = m.`id_module`
WHERE (h.`name` != "paymentOptions") AND (hm.`id_shop` = 1) AND (mg.id_shop = 1 AND  mg.`id_group` IN (1))
GROUP BY hm.id_hook, hm.id_module
ORDER BY hm.`position`
8.674 ms 219 Yes Yes /classes/Hook.php:1289
4778
SELECT SQL_NO_CACHE c.*, cl.*
FROM `hgt78_category` c
INNER JOIN hgt78_category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1)
LEFT JOIN `hgt78_category_lang` cl ON c.`id_category` = cl.`id_category` AND cl.id_shop = 1 
LEFT JOIN `hgt78_category_group` cg ON c.`id_category` = cg.`id_category`
RIGHT JOIN `hgt78_category` c2 ON c2.`id_category` = 2 AND c.`nleft` >= c2.`nleft` AND c.`nright` <= c2.`nright`
WHERE 1 AND c.`level_depth` <= 5 AND `id_lang` = 1
AND c.`active` = 1
AND cg.`id_group` IN (1)
GROUP BY c.`id_category`
ORDER BY c.`level_depth` ASC, category_shop.`position` ASC
8.393 ms 242 Yes Yes /classes/Category.php:799
3657
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3459) AND (b.`id_shop` = 1) LIMIT 1
7.533 ms 1 /src/Adapter/EntityMapper.php:71
266
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 5140) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
7.495 ms 1 /classes/stock/StockAvailable.php:453
490
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2768
ORDER BY f.position ASC
7.364 ms 5 Yes /classes/Product.php:6021
217
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 5144
ORDER BY `id_specific_price_priority` DESC LIMIT 1
7.283 ms 0 /classes/SpecificPrice.php:259
887
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2791
ORDER BY f.position ASC
7.137 ms 5 Yes /classes/Product.php:6021
861
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2789 AND id_shop=1 LIMIT 1
7.119 ms 1 /classes/Product.php:6876
539
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2775 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
6.864 ms 10 Yes /classes/SpecificPrice.php:576
489
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2768 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2768 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
6.582 ms 0 /classes/Cart.php:1430
3498
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2770) AND (b.`id_shop` = 1) LIMIT 1
6.326 ms 1 /src/Adapter/EntityMapper.php:71
1036
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2630 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
6.248 ms 10 Yes /classes/SpecificPrice.php:576
345
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 5133
ORDER BY f.position ASC
6.241 ms 5 Yes /classes/Product.php:6021
876
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2790
ORDER BY f.position ASC
5.982 ms 5 Yes /classes/Product.php:6021
540
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2775)
5.945 ms 1 /classes/Product.php:3860
40
SELECT SQL_NO_CACHE c.*, cl.`id_lang`, cl.`name`, cl.`description`, cl.`additional_description`, cl.`link_rewrite`, cl.`meta_title`, cl.`meta_keywords`, cl.`meta_description`
FROM `hgt78_category` c
INNER JOIN hgt78_category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1)
LEFT JOIN `hgt78_category_lang` cl ON (c.`id_category` = cl.`id_category` AND `id_lang` = 1  AND cl.id_shop = 1 )
LEFT JOIN `hgt78_category_group` cg ON (cg.`id_category` = c.`id_category`)
WHERE `id_parent` = 2
AND `active` = 1
AND cg.`id_group` =1
GROUP BY c.`id_category`
ORDER BY `level_depth` ASC, category_shop.`position` ASC
5.845 ms 31 Yes Yes /classes/Category.php:924
627
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2693 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
5.801 ms 10 Yes /classes/SpecificPrice.php:576
974
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2634 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2634 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
5.785 ms 0 /classes/Cart.php:1430
1031
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2639
ORDER BY f.position ASC
5.768 ms 5 Yes /classes/Product.php:6021
70
SELECT SQL_NO_CACHE * FROM hgt78_revslider_sliders
5.607 ms 2 /modules/revsliderprestashop/includes/revslider_db.class.php:214
445
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2652
ORDER BY f.position ASC
5.527 ms 5 Yes /classes/Product.php:6021
302
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 5136
AND image_shop.`cover` = 1 LIMIT 1
5.471 ms 1 /classes/Product.php:3570
104
SELECT SQL_NO_CACHE tr.*
FROM `hgt78_tax_rule` tr
JOIN `hgt78_tax_rules_group` trg ON (tr.`id_tax_rules_group` = trg.`id_tax_rules_group`)
WHERE trg.`active` = 1
AND tr.`id_country` = 8
AND tr.`id_tax_rules_group` = 28
AND tr.`id_state` IN (0, 0)
AND ('04510' BETWEEN tr.`zipcode_from` AND tr.`zipcode_to`
OR (tr.`zipcode_to` = 0 AND tr.`zipcode_from` IN(0, '04510')))
ORDER BY tr.`zipcode_from` DESC, tr.`zipcode_to` DESC, tr.`id_state` DESC, tr.`id_country` DESC
5.442 ms 1 /classes/tax/TaxRulesTaxManager.php:109
1597
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3558 LIMIT 1
5.424 ms 10 /classes/SpecificPrice.php:435
3492
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2768) AND (b.`id_shop` = 1) LIMIT 1
5.329 ms 1 /src/Adapter/EntityMapper.php:71
1058
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2628 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
5.198 ms 10 Yes /classes/SpecificPrice.php:576
85
SELECT SQL_NO_CACHE DISTINCT f.id_feature, f.*, fl.*, IF(liflv.`url_name` IS NULL OR liflv.`url_name` = "", NULL, liflv.`url_name`) AS url_name, IF(liflv.`meta_title` IS NULL OR liflv.`meta_title` = "", NULL, liflv.`meta_title`) AS meta_title, lif.indexable FROM `hgt78_feature` f  INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1) LEFT JOIN `hgt78_feature_lang` fl ON (f.`id_feature` = fl.`id_feature` AND fl.`id_lang` = 1) LEFT JOIN `hgt78_layered_indexable_feature` lif ON (f.`id_feature` = lif.`id_feature`) LEFT JOIN `hgt78_layered_indexable_feature_lang_value` liflv ON (f.`id_feature` = liflv.`id_feature` AND liflv.`id_lang` = 1) ORDER BY f.`position` ASC
5.146 ms 25 Yes /modules/ps_facetedsearch/src/Filters/DataAccessor.php:171
4310
SELECT SQL_NO_CACHE c.*, cl.*
FROM `hgt78_category` c
INNER JOIN hgt78_category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1)
LEFT JOIN `hgt78_category_lang` cl ON c.`id_category` = cl.`id_category` AND cl.id_shop = 1 
LEFT JOIN `hgt78_category_group` cg ON c.`id_category` = cg.`id_category`
RIGHT JOIN `hgt78_category` c2 ON c2.`id_category` = 40 AND c.`nleft` >= c2.`nleft` AND c.`nright` <= c2.`nright`
WHERE 1  AND `id_lang` = 1
AND c.`active` = 1
AND cg.`id_group` IN (1)
GROUP BY c.`id_category`
ORDER BY c.`level_depth` ASC
, category_shop.`position` ASC
5.136 ms 73 Yes Yes /classes/Category.php:799
84
SELECT SQL_NO_CACHE ag.id_attribute_group, agl.public_name as attribute_group_name, is_color_group, IF(liaglv.`url_name` IS NULL OR liaglv.`url_name` = "", NULL, liaglv.`url_name`) AS url_name, IF(liaglv.`meta_title` IS NULL OR liaglv.`meta_title` = "", NULL, liaglv.`meta_title`) AS meta_title, IFNULL(liag.indexable, TRUE) AS indexable FROM `hgt78_attribute_group` ag  INNER JOIN hgt78_attribute_group_shop attribute_group_shop
ON (attribute_group_shop.id_attribute_group = ag.id_attribute_group AND attribute_group_shop.id_shop = 1) LEFT JOIN `hgt78_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1) LEFT JOIN `hgt78_layered_indexable_attribute_group` liag ON (ag.`id_attribute_group` = liag.`id_attribute_group`) LEFT JOIN `hgt78_layered_indexable_attribute_group_lang_value` AS liaglv ON (ag.`id_attribute_group` = liaglv.`id_attribute_group` AND agl.`id_lang` = 1) GROUP BY ag.id_attribute_group ORDER BY ag.`position` ASC
5.072 ms 1 Yes Yes /modules/ps_facetedsearch/src/Filters/DataAccessor.php:137
3
SELECT SQL_NO_CACHE value FROM `hgt78_configuration` WHERE `name` = "PS_MULTISHOP_FEATURE_ACTIVE" LIMIT 1
5.065 ms 1 /classes/shop/Shop.php:1183
694
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2779 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
5.034 ms 10 Yes /classes/SpecificPrice.php:576
623
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2693
AND image_shop.`cover` = 1 LIMIT 1
4.989 ms 1 /classes/Product.php:3570
578
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2765
ORDER BY f.position ASC
4.952 ms 5 Yes /classes/Product.php:6021
716
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2797 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
4.940 ms 10 Yes /classes/SpecificPrice.php:576
3655
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2620
ORDER BY `position`
4.835 ms 1 Yes /classes/Product.php:3545
82
SELECT SQL_NO_CACHE type, id_value, filter_show_limit, filter_type FROM hgt78_layered_category
WHERE controller = 'category'
AND id_category = 2
AND id_shop = 1
GROUP BY `type`, id_value ORDER BY position ASC
4.770 ms 12 Yes Yes /modules/ps_facetedsearch/src/Filters/Provider.php:61
941
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2631 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2631 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
4.757 ms 0 /classes/Cart.php:1430
943
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2632
AND image_shop.`cover` = 1 LIMIT 1
4.753 ms 1 /classes/Product.php:3570
3467
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3740
4.718 ms 1 /classes/Product.php:2902
898
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2792
ORDER BY f.position ASC
4.692 ms 5 Yes /classes/Product.php:6021
1054
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2628
AND image_shop.`cover` = 1 LIMIT 1
4.666 ms 1 /classes/Product.php:3570
4684
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (6106) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
4.616 ms 1 Yes Yes /classes/Product.php:4524
262
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 5140 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
4.559 ms 10 Yes /classes/SpecificPrice.php:576
920
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2659
ORDER BY f.position ASC
4.500 ms 5 Yes /classes/Product.php:6021
4259
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 10303) AND (b.`id_shop` = 1) LIMIT 1
4.498 ms 1 /src/Adapter/EntityMapper.php:71
706
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2795)
4.495 ms 1 /classes/Product.php:3860
19
SELECT SQL_NO_CACHE m.page, ml.url_rewrite, ml.id_lang
FROM `hgt78_meta` m
LEFT JOIN `hgt78_meta_lang` ml ON (m.id_meta = ml.id_meta AND ml.id_shop = 1 )
ORDER BY LENGTH(ml.url_rewrite) DESC
4.484 ms 129 Yes /classes/Dispatcher.php:654
63
SELECT SQL_NO_CACHE * FROM `hgt78_image_type` WHERE 1 AND `products` = 1  ORDER BY `width` DESC, `height` DESC, `name`ASC
4.454 ms 8 Yes /classes/ImageType.php:109
1056
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2628 LIMIT 1
4.451 ms 10 /classes/SpecificPrice.php:435
1484
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3327
ORDER BY f.position ASC
4.448 ms 5 Yes /classes/Product.php:6021
942
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2631
ORDER BY f.position ASC
4.437 ms 5 Yes /classes/Product.php:6021
617
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2692)
4.410 ms 1 /classes/Product.php:3860
3664
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3458
ORDER BY `position`
4.404 ms 1 Yes /classes/Product.php:3545
589
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2661
ORDER BY f.position ASC
4.391 ms 5 Yes /classes/Product.php:6021
1450
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3099 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3099 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
4.363 ms 0 /classes/Cart.php:1430
4386
SELECT SQL_NO_CACHE c.*, cl.*
FROM `hgt78_category` c
INNER JOIN hgt78_category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1)
LEFT JOIN `hgt78_category_lang` cl ON c.`id_category` = cl.`id_category` AND cl.id_shop = 1 
LEFT JOIN `hgt78_category_group` cg ON c.`id_category` = cg.`id_category`
RIGHT JOIN `hgt78_category` c2 ON c2.`id_category` = 37 AND c.`nleft` >= c2.`nleft` AND c.`nright` <= c2.`nright`
WHERE 1  AND `id_lang` = 1
AND c.`active` = 1
AND cg.`id_group` IN (1)
GROUP BY c.`id_category`
ORDER BY c.`level_depth` ASC
, category_shop.`position` ASC
4.340 ms 148 Yes Yes /classes/Category.php:799
3666
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2624) AND (b.`id_shop` = 1) LIMIT 1
4.294 ms 1 /src/Adapter/EntityMapper.php:71
1029
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2639) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
4.279 ms 1 /classes/stock/StockAvailable.php:453
4682
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (5973) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
4.254 ms 1 Yes Yes /classes/Product.php:4524
831
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2781 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2781 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
4.229 ms 0 /classes/Cart.php:1430
78
SELECT SQL_NO_CACHE * FROM hgt78_carrier_group WHERE id_carrier = 282 LIMIT 1
4.223 ms 8 /modules/colissimo_simplicite/colissimo_simplicite.php:1388
3504
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2774) AND (b.`id_shop` = 1) LIMIT 1
4.220 ms 1 /src/Adapter/EntityMapper.php:71
1229
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3456
ORDER BY f.position ASC
4.152 ms 5 Yes /classes/Product.php:6021
3506
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2774
4.137 ms 1 /classes/Product.php:2902
25
SELECT SQL_NO_CACHE c.id_currency
FROM `hgt78_currency` c
WHERE (iso_code = 'EUR') LIMIT 1
4.111 ms 1 /classes/Currency.php:893
2964
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 9306)
4.092 ms 1 /classes/Product.php:3860
944
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
4.075 ms 1 /classes/Product.php:5659
279
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 5139
ORDER BY f.position ASC
4.020 ms 5 Yes /classes/Product.php:6021
1468
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3132)
4.014 ms 1 /classes/Product.php:3860
248
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 309 LIMIT 1
4.005 ms 1 /classes/Product.php:5659
263
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 5140)
3.991 ms 1 /classes/Product.php:3860
294
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 5137
ORDER BY `id_specific_price_priority` DESC LIMIT 1
3.991 ms 0 /classes/SpecificPrice.php:259
3710
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2642
3.990 ms 1 /classes/Product.php:2902
765
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3178 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3178 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
3.987 ms 0 /classes/Cart.php:1430
4262
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 10304) AND (b.`id_shop` = 1) LIMIT 1
3.966 ms 1 /src/Adapter/EntityMapper.php:71
102
SELECT SQL_NO_CACHE `id_hook`, `name`
FROM `hgt78_hook`
UNION
SELECT `id_hook`, ha.`alias` as name
FROM `hgt78_hook_alias` ha
INNER JOIN `hgt78_hook` h ON ha.name = h.name
3.954 ms 0 /classes/Hook.php:1348
1049
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2629 AND id_shop=1 LIMIT 1
3.953 ms 1 /classes/Product.php:6876
1824
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3763) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
3.949 ms 1 /classes/stock/StockAvailable.php:453
550
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2776 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
3.947 ms 10 Yes /classes/SpecificPrice.php:576
3440
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 5138
3.930 ms 1 /classes/Product.php:2902
3468
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3587) AND (b.`id_shop` = 1) LIMIT 1
3.926 ms 1 /src/Adapter/EntityMapper.php:71
3474
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2694) AND (b.`id_shop` = 1) LIMIT 1
3.901 ms 1 /src/Adapter/EntityMapper.php:71
488
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2768) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
3.897 ms 1 /classes/stock/StockAvailable.php:453
965
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2634
AND image_shop.`cover` = 1 LIMIT 1
3.883 ms 1 /classes/Product.php:3570
684
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2778)
3.863 ms 1 /classes/Product.php:3860
2160
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 5267
ORDER BY f.position ASC
3.855 ms 5 Yes /classes/Product.php:6021
603
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2691 LIMIT 1
3.840 ms 10 /classes/SpecificPrice.php:435
1052
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2629 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2629 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
3.799 ms 0 /classes/Cart.php:1430
937
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2631)
3.760 ms 1 /classes/Product.php:3860
2970
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 9321
AND image_shop.`cover` = 1 LIMIT 1
3.748 ms 1 /classes/Product.php:3570
776
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3075 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3075 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
3.746 ms 0 /classes/Cart.php:1430
4294
SELECT SQL_NO_CACHE `id_module` FROM `hgt78_module` WHERE `name` = "ps_currencyselector" LIMIT 1
3.736 ms 1 /classes/module/Module.php:2664
3489
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2767) AND (b.`id_shop` = 1) LIMIT 1
3.735 ms 1 /src/Adapter/EntityMapper.php:71
31
SELECT SQL_NO_CACHE `id_lang` FROM `hgt78_lang`
WHERE `locale` = 'fr-fr'
OR `language_code` = 'fr-fr' LIMIT 1
3.733 ms 6 /classes/Language.php:883
495
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2769 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
3.711 ms 10 Yes /classes/SpecificPrice.php:576
838
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3179)
3.701 ms 1 /classes/Product.php:3860
4268
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 12552) AND (b.`id_shop` = 1) LIMIT 1
3.694 ms 1 /src/Adapter/EntityMapper.php:71
3668
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2624
3.688 ms 1 /classes/Product.php:2902
1996
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4575
ORDER BY `id_specific_price_priority` DESC LIMIT 1
3.672 ms 0 /classes/SpecificPrice.php:259
1592
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3557) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
3.647 ms 1 /classes/stock/StockAvailable.php:453
1786
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3755 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
3.630 ms 10 Yes /classes/SpecificPrice.php:576
4536
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2798) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
3.617 ms 1 Yes Yes /classes/Product.php:4524
3415
SELECT SQL_NO_CACHE h.`name` as hook, m.`id_module`, h.`id_hook`, m.`name` as module
FROM `hgt78_module` m
INNER JOIN hgt78_module_shop module_shop
ON (module_shop.id_module = m.id_module AND module_shop.id_shop = 1 AND module_shop.enable_device & 1)
INNER JOIN `hgt78_hook_module` `hm` ON hm.`id_module` = m.`id_module`
INNER JOIN `hgt78_hook` `h` ON hm.`id_hook` = h.`id_hook`
LEFT JOIN `hgt78_module_group` `mg` ON mg.`id_module` = m.`id_module`
WHERE (h.`name` != "paymentOptions") AND (hm.`id_shop` = 1) AND (mg.id_shop = 1 AND  mg.`id_group` IN (1))
GROUP BY hm.id_hook, hm.id_module
ORDER BY hm.`position`
3.599 ms 219 Yes Yes /classes/Hook.php:1289
4322
SELECT SQL_NO_CACHE c.*, cl.*
FROM `hgt78_category` c
INNER JOIN hgt78_category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1)
LEFT JOIN `hgt78_category_lang` cl ON c.`id_category` = cl.`id_category` AND cl.id_shop = 1 
LEFT JOIN `hgt78_category_group` cg ON c.`id_category` = cg.`id_category`
RIGHT JOIN `hgt78_category` c2 ON c2.`id_category` = 38 AND c.`nleft` >= c2.`nleft` AND c.`nright` <= c2.`nright`
WHERE 1  AND `id_lang` = 1
AND c.`active` = 1
AND cg.`id_group` IN (1)
GROUP BY c.`id_category`
ORDER BY c.`level_depth` ASC
, category_shop.`position` ASC
3.579 ms 93 Yes Yes /classes/Category.php:799
542
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2775 AND `id_group` = 1 LIMIT 1
3.561 ms 0 /classes/GroupReduction.php:156
2950
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 9055 LIMIT 1
3.544 ms 13 /classes/SpecificPrice.php:435
3447
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 5135) AND (b.`id_shop` = 1) LIMIT 1
3.540 ms 1 /src/Adapter/EntityMapper.php:71
3537
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2738) AND (b.`id_shop` = 1) LIMIT 1
3.540 ms 1 /src/Adapter/EntityMapper.php:71
3721
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2645
ORDER BY `position`
3.520 ms 1 Yes /classes/Product.php:3545
3480
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2652) AND (b.`id_shop` = 1) LIMIT 1
3.512 ms 1 /src/Adapter/EntityMapper.php:71
392
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3587 LIMIT 1
3.499 ms 11 /classes/SpecificPrice.php:435
2158
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 5267) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
3.468 ms 1 /classes/stock/StockAvailable.php:453
4693
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (6178) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
3.466 ms 1 Yes Yes /classes/Product.php:4524
3654
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2620) AND (b.`id_shop` = 1) LIMIT 1
3.458 ms 1 /src/Adapter/EntityMapper.php:71
536
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 182 LIMIT 1
3.447 ms 1 /classes/Product.php:5659
346
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4902
AND image_shop.`cover` = 1 LIMIT 1
3.430 ms 1 /classes/Product.php:3570
1224
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3456)
3.430 ms 1 /classes/Product.php:3860
653
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2738 AND `id_group` = 1 LIMIT 1
3.425 ms 0 /classes/GroupReduction.php:156
629
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2693 AND id_shop=1 LIMIT 1
3.419 ms 1 /classes/Product.php:6876
256
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 5141 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 5141 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
3.412 ms 0 /classes/Cart.php:1430
3444
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 5136) AND (b.`id_shop` = 1) LIMIT 1
3.410 ms 1 /src/Adapter/EntityMapper.php:71
17
SELECT SQL_NO_CACHE m.`id_module`, m.`name`, ms.`id_module`as `mshop`
FROM `hgt78_module` m
LEFT JOIN `hgt78_module_shop` ms
ON m.`id_module` = ms.`id_module`
AND ms.`id_shop` = 1
3.402 ms 118 /classes/module/Module.php:346
554
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2776) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
3.400 ms 1 /classes/stock/StockAvailable.php:453
4559
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2782) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
3.399 ms 1 Yes Yes /classes/Product.php:4524
725
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2798 LIMIT 1
3.398 ms 10 /classes/SpecificPrice.php:435
4014
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 6172) AND (b.`id_shop` = 1) LIMIT 1
3.381 ms 1 /src/Adapter/EntityMapper.php:71
3412
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5146
ORDER BY `position`
3.380 ms 1 Yes /classes/Product.php:3545
2751
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 7945
ORDER BY `id_specific_price_priority` DESC LIMIT 1
3.371 ms 0 /classes/SpecificPrice.php:259
815
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2780 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
3.365 ms 10 Yes /classes/SpecificPrice.php:576
67
SELECT SQL_NO_CACHE *
FROM `hgt78_country_lang`
WHERE `id_country` = 8
3.361 ms 6 /src/Adapter/EntityMapper.php:79
3186
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 10067 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
3.338 ms 10 Yes /classes/SpecificPrice.php:576
1074
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3477 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3477 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
3.335 ms 0 /classes/Cart.php:1430
626
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2693
ORDER BY `id_specific_price_priority` DESC LIMIT 1
3.327 ms 0 /classes/SpecificPrice.php:259
3476
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2694
3.310 ms 1 /classes/Product.php:2902
3471
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2893) AND (b.`id_shop` = 1) LIMIT 1
3.304 ms 1 /src/Adapter/EntityMapper.php:71
3434
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 5140
3.289 ms 1 /classes/Product.php:2902
1928
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 184 LIMIT 1
3.280 ms 1 /classes/Product.php:5659
3709
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2642
ORDER BY `position`
3.278 ms 1 Yes /classes/Product.php:3545
4677
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (5592) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
3.273 ms 1 Yes Yes /classes/Product.php:4524
4048
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 6184
ORDER BY `position`
3.272 ms 1 Yes /classes/Product.php:3545
2166
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 5282)
3.250 ms 1 /classes/Product.php:3860
3679
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2640
ORDER BY `position`
3.208 ms 1 Yes /classes/Product.php:3545
3497
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2769
3.206 ms 1 /classes/Product.php:2902
871
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2790)
3.195 ms 1 /classes/Product.php:3860
3458
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4902
3.194 ms 1 /classes/Product.php:2902
1202
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2648)
3.181 ms 1 /classes/Product.php:3860
3485
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2651
3.172 ms 1 /classes/Product.php:2902
3097
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 9689 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
3.150 ms 11 Yes /classes/SpecificPrice.php:576
1599
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3558 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
3.122 ms 10 Yes /classes/SpecificPrice.php:576
561
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2766 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
3.111 ms 10 Yes /classes/SpecificPrice.php:576
334
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 5134
ORDER BY f.position ASC
3.110 ms 5 Yes /classes/Product.php:6021
938
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2631 AND id_shop=1 LIMIT 1
3.074 ms 1 /classes/Product.php:6876
800
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2793
AND image_shop.`cover` = 1 LIMIT 1
3.049 ms 1 /classes/Product.php:3570
620
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2692) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
3.048 ms 1 /classes/stock/StockAvailable.php:453
3285
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 10297 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 10297 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
3.047 ms 0 /classes/Cart.php:1430
1063
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2628 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2628 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
3.029 ms 0 /classes/Cart.php:1430
485
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2768)
3.022 ms 1 /classes/Product.php:3860
75
SELECT SQL_NO_CACHE *
FROM `hgt78_carrier` a
LEFT JOIN `hgt78_carrier_shop` `c` ON a.`id_carrier` = c.`id_carrier` AND c.`id_shop` = 1
WHERE (a.`id_carrier` = 282) LIMIT 1
3.006 ms 1 /src/Adapter/EntityMapper.php:71
4017
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 6173) AND (b.`id_shop` = 1) LIMIT 1
2.995 ms 1 /src/Adapter/EntityMapper.php:71
783
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3176)
2.975 ms 1 /classes/Product.php:3860
3499
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2770
ORDER BY `position`
2.952 ms 1 Yes /classes/Product.php:3545
22
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 2) AND (b.`id_shop` = 1) LIMIT 1
2.950 ms 1 /src/Adapter/EntityMapper.php:71
3486
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2623) AND (b.`id_shop` = 1) LIMIT 1
2.942 ms 1 /src/Adapter/EntityMapper.php:71
2913
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 8419
ORDER BY f.position ASC
2.895 ms 5 Yes /classes/Product.php:6021
21
SELECT SQL_NO_CACHE m.`id_module`, m.`name`, ms.`id_module`as `mshop`
FROM `hgt78_module` m
LEFT JOIN `hgt78_module_shop` ms
ON m.`id_module` = ms.`id_module`
AND ms.`id_shop` = 1
2.892 ms 118 /classes/module/Module.php:346
1201
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2648 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
2.888 ms 10 Yes /classes/SpecificPrice.php:576
3459
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3743) AND (b.`id_shop` = 1) LIMIT 1
2.887 ms 1 /src/Adapter/EntityMapper.php:71
568
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2765
AND image_shop.`cover` = 1 LIMIT 1
2.852 ms 1 /classes/Product.php:3570
745
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2800
AND image_shop.`cover` = 1 LIMIT 1
2.847 ms 1 /classes/Product.php:3570
3427
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5142
ORDER BY `position`
2.843 ms 1 Yes /classes/Product.php:3545
3677
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2627
2.842 ms 1 /classes/Product.php:2902
854
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2788
ORDER BY f.position ASC
2.840 ms 5 Yes /classes/Product.php:6021
3500
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2770
2.840 ms 1 /classes/Product.php:2902
533
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2774 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2774 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
2.839 ms 0 /classes/Cart.php:1430
3717
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2644) AND (b.`id_shop` = 1) LIMIT 1
2.838 ms 1 /src/Adapter/EntityMapper.php:71
3483
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2651) AND (b.`id_shop` = 1) LIMIT 1
2.834 ms 1 /src/Adapter/EntityMapper.php:71
739
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2799)
2.831 ms 1 /classes/Product.php:3860
2167
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 5282 AND id_shop=1 LIMIT 1
2.830 ms 1 /classes/Product.php:6876
2383
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 6107
ORDER BY f.position ASC
2.828 ms 5 Yes /classes/Product.php:6021
4673
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (5093) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
2.809 ms 1 Yes Yes /classes/Product.php:4524
663
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2764 AND id_shop=1 LIMIT 1
2.774 ms 1 /classes/Product.php:6876
791
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2794 LIMIT 1
2.771 ms 10 /classes/SpecificPrice.php:435
1515
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2733) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
2.766 ms 1 /classes/stock/StockAvailable.php:453
1322
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2645 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
2.763 ms 10 Yes /classes/SpecificPrice.php:576
3675
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2627) AND (b.`id_shop` = 1) LIMIT 1
2.761 ms 1 /src/Adapter/EntityMapper.php:71
4302
SELECT SQL_NO_CACHE SUM(`quantity`)
FROM `hgt78_cart_product`
WHERE `id_cart` = 0 LIMIT 1
2.745 ms 1 /classes/Cart.php:1303
4010
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 6108
2.736 ms 1 /classes/Product.php:2902
874
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2790) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
2.733 ms 1 /classes/stock/StockAvailable.php:453
224
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 5144
ORDER BY f.position ASC
2.730 ms 5 Yes /classes/Product.php:6021
3494
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2768
2.714 ms 1 /classes/Product.php:2902
3137
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 9693
AND image_shop.`cover` = 1 LIMIT 1
2.700 ms 1 /classes/Product.php:3570
528
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2774 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
2.689 ms 10 Yes /classes/SpecificPrice.php:576
480
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2768
AND image_shop.`cover` = 1 LIMIT 1
2.687 ms 1 /classes/Product.php:3570
123
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 7542 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 7542 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
2.685 ms 0 /classes/Cart.php:1430
479
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2767
ORDER BY f.position ASC
2.678 ms 5 Yes /classes/Product.php:6021
2163
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 5282 LIMIT 1
2.676 ms 15 /classes/SpecificPrice.php:435
484
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2768 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
2.672 ms 10 Yes /classes/SpecificPrice.php:576
1038
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2630 AND id_shop=1 LIMIT 1
2.667 ms 1 /classes/Product.php:6876
322
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 5135 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 5135 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
2.665 ms 0 /classes/Cart.php:1430
4588
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2655) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
2.664 ms 1 Yes Yes /classes/Product.php:4524
4455
SELECT SQL_NO_CACHE c.*, cl.*
FROM `hgt78_category` c
INNER JOIN hgt78_category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1)
LEFT JOIN `hgt78_category_lang` cl ON c.`id_category` = cl.`id_category` AND cl.id_shop = 1 
LEFT JOIN `hgt78_category_group` cg ON c.`id_category` = cg.`id_category`
RIGHT JOIN `hgt78_category` c2 ON c2.`id_category` = 36 AND c.`nleft` >= c2.`nleft` AND c.`nright` <= c2.`nright`
WHERE 1  AND `id_lang` = 1
AND c.`active` = 1
AND cg.`id_group` IN (1)
GROUP BY c.`id_category`
ORDER BY c.`level_depth` ASC
, category_shop.`position` ASC
2.661 ms 73 Yes Yes /classes/Category.php:799
3487
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2623
ORDER BY `position`
2.653 ms 1 Yes /classes/Product.php:3545
4713
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (7938) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
2.652 ms 1 Yes Yes /classes/Product.php:4524
3217
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 10070
AND image_shop.`cover` = 1 LIMIT 1
2.652 ms 1 /classes/Product.php:3570
582
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2661
ORDER BY `id_specific_price_priority` DESC LIMIT 1
2.647 ms 0 /classes/SpecificPrice.php:259
640
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2771 AND id_shop=1 LIMIT 1
2.643 ms 1 /classes/Product.php:6876
3337
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 10304 AND id_shop=1 LIMIT 1
2.626 ms 1 /classes/Product.php:6876
180
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 5148
ORDER BY f.position ASC
2.619 ms 5 Yes /classes/Product.php:6021
622
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2692
ORDER BY f.position ASC
2.617 ms 5 Yes /classes/Product.php:6021
45
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 37) AND (b.`id_shop` = 1) LIMIT 1
2.609 ms 1 /src/Adapter/EntityMapper.php:71
915
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2659)
2.598 ms 1 /classes/Product.php:3860
1033
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
2.587 ms 1 /classes/Product.php:5659
264
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 5140 AND id_shop=1 LIMIT 1
2.580 ms 1 /classes/Product.php:6876
110
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 7543) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
2.571 ms 1 /classes/stock/StockAvailable.php:453
4266
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 10305
ORDER BY `position`
2.571 ms 1 Yes /classes/Product.php:3545
761
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3178)
2.568 ms 1 /classes/Product.php:3860
755
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2800
ORDER BY f.position ASC
2.566 ms 5 Yes /classes/Product.php:6021
3502
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2773
ORDER BY `position`
2.566 ms 1 Yes /classes/Product.php:3545
3939
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 5265) AND (b.`id_shop` = 1) LIMIT 1
2.561 ms 1 /src/Adapter/EntityMapper.php:71
62
SELECT SQL_NO_CACHE `id_module` FROM `hgt78_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
2.559 ms 0 /classes/module/Module.php:2137
2754
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 7945 AND id_shop=1 LIMIT 1
2.536 ms 1 /classes/Product.php:6876
222
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 5144) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
2.536 ms 1 /classes/stock/StockAvailable.php:453
4687
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (6129) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
2.526 ms 1 Yes Yes /classes/Product.php:4524
218
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 5144 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
2.517 ms 10 Yes /classes/SpecificPrice.php:576
89
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 7543
AND image_shop.`cover` = 1 LIMIT 1
2.500 ms 1 /classes/Product.php:3570
49
SELECT SQL_NO_CACHE * FROM `hgt78_image_type`
2.495 ms 8 /classes/ImageType.php:161
2974
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 9321
ORDER BY `id_specific_price_priority` DESC LIMIT 1
2.490 ms 0 /classes/SpecificPrice.php:259
468
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2767
AND image_shop.`cover` = 1 LIMIT 1
2.469 ms 1 /classes/Product.php:3570
1372
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3256 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3256 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
2.466 ms 0 /classes/Cart.php:1430
3513
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2766) AND (b.`id_shop` = 1) LIMIT 1
2.456 ms 1 /src/Adapter/EntityMapper.php:71
12
SELECT SQL_NO_CACHE COUNT(DISTINCT l.id_lang) FROM `hgt78_lang` l
JOIN hgt78_lang_shop lang_shop ON (lang_shop.id_lang = l.id_lang AND lang_shop.id_shop = 1)
WHERE l.`active` = 1 LIMIT 1
2.452 ms 6 /classes/Language.php:1216
3463
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3741
ORDER BY `position`
2.441 ms 1 Yes /classes/Product.php:3545
4090
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 7938
ORDER BY `position`
2.439 ms 1 Yes /classes/Product.php:3545
129
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 7541 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
2.429 ms 10 Yes /classes/SpecificPrice.php:576
13
SELECT SQL_NO_CACHE lower(name) as name
FROM `hgt78_hook` h
WHERE (h.active = 1)
2.428 ms 1185 /classes/Hook.php:1388
2768
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 7946 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 7946 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
2.428 ms 0 /classes/Cart.php:1430
1220
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
2.427 ms 1 /classes/Product.php:5659
695
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2779)
2.412 ms 1 /classes/Product.php:3860
350
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4902 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
2.377 ms 10 Yes /classes/SpecificPrice.php:576
4
SELECT SQL_NO_CACHE *
FROM `hgt78_shop` a
WHERE (a.`id_shop` = 1) LIMIT 1
2.376 ms 1 /src/Adapter/EntityMapper.php:71
501
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2769
ORDER BY f.position ASC
2.357 ms 5 Yes /classes/Product.php:6021
912
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2659 LIMIT 1
2.337 ms 10 /classes/SpecificPrice.php:435
4307
SELECT SQL_NO_CACHE hs.`id_tab` as id_tab, hssl.`title`, hssl.`label`, hssl.`url`,
hss.`position`,  hss.`active_label`, hss.`url_type`, hss.`id_url`, hss.`icon_type`, hss.`icon_class`, hss.`icon`, hss.`legend_icon`,
hss.`new_window`, hss.`float`, hss.`submenu_type`, hss.`submenu_content`, hss.`submenu_width`, hss.`group_access`
FROM hgt78_iqitmegamenu_tabs_shop hs
LEFT JOIN hgt78_iqitmegamenu_tabs hss ON (hs.id_tab = hss.id_tab)
LEFT JOIN hgt78_iqitmegamenu_tabs_lang hssl ON (hss.id_tab = hssl.id_tab)
WHERE id_shop = 1 AND menu_type = 1 AND active = 1
AND hssl.id_lang = 1
ORDER BY hss.position
2.336 ms 12 Yes /modules/iqitmegamenu/models/IqitMenuTab.php:178
538
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2775
ORDER BY `id_specific_price_priority` DESC LIMIT 1
2.328 ms 0 /classes/SpecificPrice.php:259
1064
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2628
ORDER BY f.position ASC
2.321 ms 5 Yes /classes/Product.php:6021
639
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2771)
2.313 ms 1 /classes/Product.php:3860
4541
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3176) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
2.309 ms 1 Yes Yes /classes/Product.php:4524
55
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 12) AND (b.`id_shop` = 1) LIMIT 1
2.306 ms 1 /src/Adapter/EntityMapper.php:71
3996
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 5973) AND (b.`id_shop` = 1) LIMIT 1
2.306 ms 1 /src/Adapter/EntityMapper.php:71
361
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3743 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
2.305 ms 10 Yes /classes/SpecificPrice.php:576
4317
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 165) LIMIT 1
2.294 ms 1 /src/Adapter/EntityMapper.php:71
3507
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2775) AND (b.`id_shop` = 1) LIMIT 1
2.292 ms 1 /src/Adapter/EntityMapper.php:71
354
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4902) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
2.290 ms 1 /classes/stock/StockAvailable.php:453
3672
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2626) AND (b.`id_shop` = 1) LIMIT 1
2.276 ms 1 /src/Adapter/EntityMapper.php:71
4685
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (6107) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
2.275 ms 1 Yes Yes /classes/Product.php:4524
3478
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2660
ORDER BY `position`
2.262 ms 1 Yes /classes/Product.php:3545
659
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2764 LIMIT 1
2.258 ms 10 /classes/SpecificPrice.php:435
545
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2775
ORDER BY f.position ASC
2.253 ms 5 Yes /classes/Product.php:6021
3466
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3740
ORDER BY `position`
2.243 ms 1 Yes /classes/Product.php:3545
4441
SELECT SQL_NO_CACHE c.*, cl.*
FROM `hgt78_category` c
INNER JOIN hgt78_category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1)
LEFT JOIN `hgt78_category_lang` cl ON c.`id_category` = cl.`id_category` AND cl.id_shop = 1 
LEFT JOIN `hgt78_category_group` cg ON c.`id_category` = cg.`id_category`
RIGHT JOIN `hgt78_category` c2 ON c2.`id_category` = 33 AND c.`nleft` >= c2.`nleft` AND c.`nright` <= c2.`nright`
WHERE 1  AND `id_lang` = 1
AND c.`active` = 1
AND cg.`id_group` IN (1)
GROUP BY c.`id_category`
ORDER BY c.`level_depth` ASC
, category_shop.`position` ASC
2.241 ms 7 Yes Yes /classes/Category.php:799
1196
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2656
ORDER BY f.position ASC
2.235 ms 5 Yes /classes/Product.php:6021
4265
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 10305) AND (b.`id_shop` = 1) LIMIT 1
2.209 ms 1 /src/Adapter/EntityMapper.php:71
211
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 5145) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
2.207 ms 1 /classes/stock/StockAvailable.php:453
456
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2651
ORDER BY f.position ASC
2.207 ms 5 Yes /classes/Product.php:6021
772
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3075)
2.204 ms 1 /classes/Product.php:3860
192
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 5146
AND image_shop.`cover` = 1 LIMIT 1
2.198 ms 1 /classes/Product.php:3570
52
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 44) AND (b.`id_shop` = 1) LIMIT 1
2.188 ms 1 /src/Adapter/EntityMapper.php:71
4140
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 8401) AND (b.`id_shop` = 1) LIMIT 1
2.178 ms 1 /src/Adapter/EntityMapper.php:71
2323
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 5971 AND id_shop=1 LIMIT 1
2.177 ms 1 /classes/Product.php:6876
958
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2633 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
2.167 ms 10 Yes /classes/SpecificPrice.php:576
48
SELECT SQL_NO_CACHE * FROM `hgt78_image_type` WHERE 1 AND `categories` = 1  ORDER BY `width` DESC, `height` DESC, `name`ASC
2.166 ms 8 Yes /classes/ImageType.php:109
1351
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3254
ORDER BY f.position ASC
2.166 ms 5 Yes /classes/Product.php:6021
3454
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5133
ORDER BY `position`
2.164 ms 1 Yes /classes/Product.php:3545
462
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2623)
2.162 ms 1 /classes/Product.php:3860
673
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2777)
2.158 ms 1 /classes/Product.php:3860
1230
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2649
AND image_shop.`cover` = 1 LIMIT 1
2.151 ms 1 /classes/Product.php:3570
1429
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2818
ORDER BY f.position ASC
2.142 ms 5 Yes /classes/Product.php:6021
1186
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2656
AND image_shop.`cover` = 1 LIMIT 1
2.139 ms 1 /classes/Product.php:3570
405
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2893 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
2.135 ms 11 Yes /classes/SpecificPrice.php:576
3453
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 5133) AND (b.`id_shop` = 1) LIMIT 1
2.108 ms 1 /src/Adapter/EntityMapper.php:71
1389
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3265 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
2.100 ms 10 Yes /classes/SpecificPrice.php:576
1434
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2892 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
2.100 ms 10 Yes /classes/SpecificPrice.php:576
467
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2623
ORDER BY f.position ASC
2.096 ms 5 Yes /classes/Product.php:6021
367
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3743
ORDER BY f.position ASC
2.095 ms 5 Yes /classes/Product.php:6021
537
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2775 LIMIT 1
2.093 ms 10 /classes/SpecificPrice.php:435
1015
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2638)
2.089 ms 1 /classes/Product.php:3860
1193
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2656 AND `id_group` = 1 LIMIT 1
2.076 ms 0 /classes/GroupReduction.php:156
722
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2797
ORDER BY f.position ASC
2.072 ms 5 Yes /classes/Product.php:6021
1654
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3639 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
2.072 ms 10 Yes /classes/SpecificPrice.php:576
412
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2694
AND image_shop.`cover` = 1 LIMIT 1
2.070 ms 1 /classes/Product.php:3570
1525
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2650 AND `id_group` = 1 LIMIT 1
2.070 ms 0 /classes/GroupReduction.php:156
632
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2693 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2693 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
2.068 ms 0 /classes/Cart.php:1430
329
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 5134)
2.066 ms 1 /classes/Product.php:3860
4692
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (6177) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
2.065 ms 1 Yes Yes /classes/Product.php:4524
1411
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3155 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
2.064 ms 10 Yes /classes/SpecificPrice.php:576
3922
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4944
ORDER BY `position`
2.060 ms 1 Yes /classes/Product.php:3545
124
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 7542
ORDER BY f.position ASC
2.059 ms 5 Yes /classes/Product.php:6021
4026
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 6177) AND (b.`id_shop` = 1) LIMIT 1
2.055 ms 1 /src/Adapter/EntityMapper.php:71
4689
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (6173) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
2.033 ms 1 Yes Yes /classes/Product.php:4524
4695
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (6180) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
2.031 ms 1 Yes Yes /classes/Product.php:4524
1373
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3256
ORDER BY f.position ASC
2.019 ms 5 Yes /classes/Product.php:6021
4270
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 12552
2.016 ms 1 /classes/Product.php:2902
681
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2778 LIMIT 1
2.012 ms 10 /classes/SpecificPrice.php:435
3477
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2660) AND (b.`id_shop` = 1) LIMIT 1
2.012 ms 1 /src/Adapter/EntityMapper.php:71
2405
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 6129
ORDER BY f.position ASC
2.011 ms 5 Yes /classes/Product.php:6021
4186
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 9597
ORDER BY `position`
1.997 ms 1 Yes /classes/Product.php:3545
4683
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (6047) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.997 ms 1 Yes Yes /classes/Product.php:4524
42
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 34) AND (b.`id_shop` = 1) LIMIT 1
1.996 ms 1 /src/Adapter/EntityMapper.php:71
2315
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 5970 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 5970 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.991 ms 0 /classes/Cart.php:1430
747
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2800 LIMIT 1
1.988 ms 10 /classes/SpecificPrice.php:435
3724
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3252
ORDER BY `position`
1.980 ms 1 Yes /classes/Product.php:3545
2820
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 8393)
1.977 ms 1 /classes/Product.php:3860
1505
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2621 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2621 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.973 ms 0 /classes/Cart.php:1430
2393
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 6108 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 6108 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.971 ms 0 /classes/Cart.php:1430
3457
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4902
ORDER BY `position`
1.970 ms 1 Yes /classes/Product.php:3545
449
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2651
ORDER BY `id_specific_price_priority` DESC LIMIT 1
1.969 ms 0 /classes/SpecificPrice.php:259
455
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2651 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2651 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.958 ms 0 /classes/Cart.php:1430
291
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 5137
AND image_shop.`cover` = 1 LIMIT 1
1.953 ms 1 /classes/Product.php:3570
734
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2799
AND image_shop.`cover` = 1 LIMIT 1
1.951 ms 1 /classes/Product.php:3570
365
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3743) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
1.944 ms 1 /classes/stock/StockAvailable.php:453
3994
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5972
ORDER BY `position`
1.944 ms 1 Yes /classes/Product.php:3545
668
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2777
AND image_shop.`cover` = 1 LIMIT 1
1.933 ms 1 /classes/Product.php:3570
4055
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 6186
1.925 ms 1 /classes/Product.php:2902
2007
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4932 LIMIT 1
1.922 ms 10 /classes/SpecificPrice.php:435
457
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2623
AND image_shop.`cover` = 1 LIMIT 1
1.919 ms 1 /classes/Product.php:3570
493
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2769 LIMIT 1
1.912 ms 10 /classes/SpecificPrice.php:435
3488
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2623
1.894 ms 1 /classes/Product.php:2902
1428
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2818 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2818 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.889 ms 0 /classes/Cart.php:1430
2360
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 6047 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 6047 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.886 ms 0 /classes/Cart.php:1430
378
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3741
ORDER BY f.position ASC
1.882 ms 5 Yes /classes/Product.php:6021
3517
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2765
ORDER BY `position`
1.877 ms 1 Yes /classes/Product.php:3545
2389
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 6108)
1.861 ms 1 /classes/Product.php:3860
9
SELECT SQL_NO_CACHE *
FROM `hgt78_lang` a
LEFT JOIN `hgt78_lang_shop` `c` ON a.`id_lang` = c.`id_lang` AND c.`id_shop` = 1
WHERE (a.`id_lang` = 1) LIMIT 1
1.856 ms 1 /src/Adapter/EntityMapper.php:71
56
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 13) AND (b.`id_shop` = 1) LIMIT 1
1.854 ms 1 /src/Adapter/EntityMapper.php:71
1210
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2657 LIMIT 1
1.850 ms 10 /classes/SpecificPrice.php:435
166
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 6727) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
1.846 ms 1 /classes/stock/StockAvailable.php:453
1360
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3255) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
1.843 ms 1 /classes/stock/StockAvailable.php:453
926
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2635)
1.834 ms 1 /classes/Product.php:3860
1091
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3459 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.834 ms 10 Yes /classes/SpecificPrice.php:576
332
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 5134) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
1.829 ms 1 /classes/stock/StockAvailable.php:453
388
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3740 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3740 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.819 ms 0 /classes/Cart.php:1430
3940
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5265
ORDER BY `position`
1.818 ms 1 Yes /classes/Product.php:3545
1430
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2892
AND image_shop.`cover` = 1 LIMIT 1
1.814 ms 1 /classes/Product.php:3570
4260
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 10303
ORDER BY `position`
1.811 ms 1 Yes /classes/Product.php:3545
1107
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2622 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2622 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.805 ms 0 /classes/Cart.php:1430
6
SELECT SQL_NO_CACHE l.*, ls.`id_shop`
FROM `hgt78_lang` l
LEFT JOIN `hgt78_lang_shop` ls ON (l.id_lang = ls.id_lang)
1.799 ms 6 /classes/Language.php:1080
737
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2799
ORDER BY `id_specific_price_priority` DESC LIMIT 1
1.798 ms 1 /classes/SpecificPrice.php:259
3414
SELECT SQL_NO_CACHE lower(name) as name
FROM `hgt78_hook` h
WHERE (h.active = 1)
1.796 ms 1185 /classes/Hook.php:1388
117
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 7542
ORDER BY `id_specific_price_priority` DESC LIMIT 1
1.796 ms 0 /classes/SpecificPrice.php:259
1211
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2657
ORDER BY `id_specific_price_priority` DESC LIMIT 1
1.794 ms 0 /classes/SpecificPrice.php:259
1207
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2648
ORDER BY f.position ASC
1.791 ms 5 Yes /classes/Product.php:6021
3438
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 5138) AND (b.`id_shop` = 1) LIMIT 1
1.787 ms 1 /src/Adapter/EntityMapper.php:71
240
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 5142 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.787 ms 10 Yes /classes/SpecificPrice.php:576
700
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2779
ORDER BY f.position ASC
1.787 ms 5 Yes /classes/Product.php:6021
1228
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3456 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3456 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.785 ms 0 /classes/Cart.php:1430
621
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2692 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2692 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.784 ms 0 /classes/Cart.php:1430
4002
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 6106) AND (b.`id_shop` = 1) LIMIT 1
1.778 ms 1 /src/Adapter/EntityMapper.php:71
701
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2795
AND image_shop.`cover` = 1 LIMIT 1
1.776 ms 1 /classes/Product.php:3570
771
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3075 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.776 ms 10 Yes /classes/SpecificPrice.php:576
822
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2781
AND image_shop.`cover` = 1 LIMIT 1
1.776 ms 1 /classes/Product.php:3570
596
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2690 AND id_shop=1 LIMIT 1
1.774 ms 1 /classes/Product.php:6876
940
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2631) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
1.768 ms 1 /classes/stock/StockAvailable.php:453
979
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2782 LIMIT 1
1.763 ms 10 /classes/SpecificPrice.php:435
4702
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (6187) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.758 ms 1 Yes Yes /classes/Product.php:4524
1218
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2657
ORDER BY f.position ASC
1.756 ms 5 Yes /classes/Product.php:6021
4016
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 6172
1.755 ms 1 /classes/Product.php:2902
186
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 5147)
1.750 ms 1 /classes/Product.php:3860
341
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 5133 AND id_shop=1 LIMIT 1
1.748 ms 1 /classes/Product.php:6876
573
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2765)
1.744 ms 1 /classes/Product.php:3860
4282
SELECT SQL_NO_CACHE c.id_elementor FROM hgt78_iqit_elementor_category c WHERE c.id_category = 2 LIMIT 1
1.744 ms 1 /modules/iqitelementor/src/IqitElementorCategory.php:87
4000
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 6047
ORDER BY `position`
1.743 ms 1 Yes /classes/Product.php:3545
486
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2768 AND id_shop=1 LIMIT 1
1.742 ms 1 /classes/Product.php:6876
1369
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3256 AND id_shop=1 LIMIT 1
1.742 ms 1 /classes/Product.php:6876
244
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 5142) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
1.733 ms 1 /classes/stock/StockAvailable.php:453
721
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2797 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2797 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.730 ms 0 /classes/Cart.php:1430
1069
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3477 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.729 ms 10 Yes /classes/SpecificPrice.php:576
1399
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3326
ORDER BY `id_specific_price_priority` DESC LIMIT 1
1.727 ms 0 /classes/SpecificPrice.php:259
206
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 5145
ORDER BY `id_specific_price_priority` DESC LIMIT 1
1.726 ms 0 /classes/SpecificPrice.php:259
720
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2797) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
1.723 ms 1 /classes/stock/StockAvailable.php:453
2293
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 5592 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 5592 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.723 ms 0 /classes/Cart.php:1430
3439
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5138
ORDER BY `position`
1.723 ms 1 Yes /classes/Product.php:3545
1835
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3764) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
1.722 ms 1 /classes/stock/StockAvailable.php:453
1340
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3252
ORDER BY f.position ASC
1.718 ms 5 Yes /classes/Product.php:6021
662
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2764)
1.717 ms 1 /classes/Product.php:3860
3723
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3252) AND (b.`id_shop` = 1) LIMIT 1
1.714 ms 1 /src/Adapter/EntityMapper.php:71
799
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2794
ORDER BY f.position ASC
1.712 ms 5 Yes /classes/Product.php:6021
506
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2770 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.708 ms 10 Yes /classes/SpecificPrice.php:576
1644
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3586)
1.707 ms 1 /classes/Product.php:3860
3469
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3587
ORDER BY `position`
1.707 ms 1 Yes /classes/Product.php:3545
4591
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3252) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.706 ms 1 Yes Yes /classes/Product.php:4524
1504
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2621) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
1.702 ms 1 /classes/stock/StockAvailable.php:453
169
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 5148
AND image_shop.`cover` = 1 LIMIT 1
1.699 ms 1 /classes/Product.php:3570
380
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 185 LIMIT 1
1.699 ms 1 /classes/Product.php:5659
343
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 5133) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
1.698 ms 1 /classes/stock/StockAvailable.php:453
1234
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2649 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.697 ms 10 Yes /classes/SpecificPrice.php:576
678
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2777
ORDER BY f.position ASC
1.687 ms 5 Yes /classes/Product.php:6021
111
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 7543 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 7543 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.686 ms 0 /classes/Cart.php:1430
3745
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3155
ORDER BY `position`
1.683 ms 1 Yes /classes/Product.php:3545
4659
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4963) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.677 ms 1 Yes Yes /classes/Product.php:4524
3441
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 5137) AND (b.`id_shop` = 1) LIMIT 1
1.675 ms 1 /src/Adapter/EntityMapper.php:71
1212
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2657 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.674 ms 10 Yes /classes/SpecificPrice.php:576
4251
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 10298
ORDER BY `position`
1.671 ms 1 Yes /classes/Product.php:3545
3501
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2773) AND (b.`id_shop` = 1) LIMIT 1
1.670 ms 1 /src/Adapter/EntityMapper.php:71
3510
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2776) AND (b.`id_shop` = 1) LIMIT 1
1.664 ms 1 /src/Adapter/EntityMapper.php:71
606
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2691)
1.662 ms 1 /classes/Product.php:3860
3451
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5134
ORDER BY `position`
1.657 ms 1 Yes /classes/Product.php:3545
1219
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3456
AND image_shop.`cover` = 1 LIMIT 1
1.655 ms 1 /classes/Product.php:3570
4086
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 6501) AND (b.`id_shop` = 1) LIMIT 1
1.655 ms 1 /src/Adapter/EntityMapper.php:71
61
SELECT SQL_NO_CACHE `id_module` FROM `hgt78_module` WHERE `name` = "ps_legalcompliance" LIMIT 1
1.654 ms 0 /classes/module/Module.php:2664
109
SELECT SQL_NO_CACHE tr.*
FROM `hgt78_tax_rule` tr
JOIN `hgt78_tax_rules_group` trg ON (tr.`id_tax_rules_group` = trg.`id_tax_rules_group`)
WHERE trg.`active` = 1
AND tr.`id_country` = 8
AND tr.`id_tax_rules_group` = 0
AND tr.`id_state` IN (0, 0)
AND ('04510' BETWEEN tr.`zipcode_from` AND tr.`zipcode_to`
OR (tr.`zipcode_to` = 0 AND tr.`zipcode_from` IN(0, '04510')))
ORDER BY tr.`zipcode_from` DESC, tr.`zipcode_to` DESC, tr.`id_state` DESC, tr.`id_country` DESC
1.651 ms 0 /classes/tax/TaxRulesTaxManager.php:109
213
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 5145
ORDER BY f.position ASC
1.649 ms 5 Yes /classes/Product.php:6021
1097
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3459
ORDER BY f.position ASC
1.647 ms 5 Yes /classes/Product.php:6021
885
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2791) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
1.646 ms 1 /classes/stock/StockAvailable.php:453
612
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2692
AND image_shop.`cover` = 1 LIMIT 1
1.643 ms 1 /classes/Product.php:3570
1508
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
1.643 ms 1 /classes/Product.php:5659
372
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3741 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.632 ms 10 Yes /classes/SpecificPrice.php:576
3475
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2694
ORDER BY `position`
1.632 ms 1 Yes /classes/Product.php:3545
2387
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 6108
ORDER BY `id_specific_price_priority` DESC LIMIT 1
1.631 ms 0 /classes/SpecificPrice.php:259
196
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 5146 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.629 ms 10 Yes /classes/SpecificPrice.php:576
793
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2794 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.629 ms 10 Yes /classes/SpecificPrice.php:576
1665
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3689 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.627 ms 10 Yes /classes/SpecificPrice.php:576
1053
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2629
ORDER BY f.position ASC
1.626 ms 5 Yes /classes/Product.php:6021
788
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3176
ORDER BY f.position ASC
1.623 ms 5 Yes /classes/Product.php:6021
4015
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 6172
ORDER BY `position`
1.621 ms 1 Yes /classes/Product.php:3545
340
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 5133)
1.619 ms 1 /classes/Product.php:3860
1909
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3804 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.617 ms 10 Yes /classes/SpecificPrice.php:576
369
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 185 LIMIT 1
1.617 ms 1 /classes/Product.php:5659
981
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2782 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.616 ms 10 Yes /classes/SpecificPrice.php:576
4047
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 6184) AND (b.`id_shop` = 1) LIMIT 1
1.614 ms 1 /src/Adapter/EntityMapper.php:71
948
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2632)
1.614 ms 1 /classes/Product.php:3860
4051
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 6185
ORDER BY `position`
1.613 ms 1 Yes /classes/Product.php:3545
649
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2738
ORDER BY `id_specific_price_priority` DESC LIMIT 1
1.610 ms 0 /classes/SpecificPrice.php:259
318
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 5135)
1.608 ms 1 /classes/Product.php:3860
428
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2660 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.607 ms 10 Yes /classes/SpecificPrice.php:576
4686
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (6108) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.599 ms 1 Yes Yes /classes/Product.php:4524
59
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 20) AND (b.`id_shop` = 1) LIMIT 1
1.593 ms 1 /src/Adapter/EntityMapper.php:71
509
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2770 AND `id_group` = 1 LIMIT 1
1.592 ms 0 /classes/GroupReduction.php:156
473
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2767 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.590 ms 10 Yes /classes/SpecificPrice.php:576
2143
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 5266 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.584 ms 10 Yes /classes/SpecificPrice.php:576
1040
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2630) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
1.580 ms 1 /classes/stock/StockAvailable.php:453
2454
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 6177 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.579 ms 10 Yes /classes/SpecificPrice.php:576
4324
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 38 AND `id_shop` = 1
1.570 ms 6 /src/Adapter/EntityMapper.php:79
1010
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2638
AND image_shop.`cover` = 1 LIMIT 1
1.561 ms 1 /classes/Product.php:3570
60
SELECT SQL_NO_CACHE `id_module` FROM `hgt78_module` WHERE `name` = "ps_accounts" LIMIT 1
1.558 ms 1 /src/Adapter/Module/ModuleDataProvider.php:257
1213
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2657)
1.557 ms 1 /classes/Product.php:3860
347
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 185 LIMIT 1
1.557 ms 1 /classes/Product.php:5659
135
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 7541
ORDER BY f.position ASC
1.556 ms 5 Yes /classes/Product.php:6021
693
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2779
ORDER BY `id_specific_price_priority` DESC LIMIT 1
1.554 ms 0 /classes/SpecificPrice.php:259
2326
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 5971 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 5971 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.554 ms 0 /classes/Cart.php:1430
2154
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 5267 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.553 ms 10 Yes /classes/SpecificPrice.php:576
24
SELECT SQL_NO_CACHE `id_lang` FROM `hgt78_lang`
WHERE `locale` = 'fr-fr'
OR `language_code` = 'fr-fr' LIMIT 1
1.552 ms 6 /classes/Language.php:883
2395
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 6129
AND image_shop.`cover` = 1 LIMIT 1
1.551 ms 1 /classes/Product.php:3570
672
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2777 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.550 ms 10 Yes /classes/SpecificPrice.php:576
301
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 5137
ORDER BY f.position ASC
1.549 ms 5 Yes /classes/Product.php:6021
178
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 5148) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
1.544 ms 1 /classes/stock/StockAvailable.php:453
947
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2632 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.543 ms 10 Yes /classes/SpecificPrice.php:576
1076
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2620
AND image_shop.`cover` = 1 LIMIT 1
1.542 ms 1 /classes/Product.php:3570
893
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2792)
1.538 ms 1 /classes/Product.php:3860
106
SELECT SQL_NO_CACHE *
FROM `hgt78_tax_lang`
WHERE `id_tax` = 1
1.537 ms 6 /src/Adapter/EntityMapper.php:79
683
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2778 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.532 ms 10 Yes /classes/SpecificPrice.php:576
157
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 7539
ORDER BY f.position ASC
1.530 ms 5 Yes /classes/Product.php:6021
3969
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 5093) AND (b.`id_shop` = 1) LIMIT 1
1.528 ms 1 /src/Adapter/EntityMapper.php:71
174
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 5148 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.527 ms 10 Yes /classes/SpecificPrice.php:576
1421
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2818 LIMIT 1
1.521 ms 10 /classes/SpecificPrice.php:435
3514
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2766
ORDER BY `position`
1.520 ms 1 Yes /classes/Product.php:3545
1440
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2892
ORDER BY f.position ASC
1.519 ms 5 Yes /classes/Product.php:6021
837
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3179 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.517 ms 10 Yes /classes/SpecificPrice.php:576
3916
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4942
ORDER BY `position`
1.513 ms 1 Yes /classes/Product.php:3545
242
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 5142 AND id_shop=1 LIMIT 1
1.510 ms 1 /classes/Product.php:6876
4374
SELECT SQL_NO_CACHE c.*, cl.*
FROM `hgt78_category` c
INNER JOIN hgt78_category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1)
LEFT JOIN `hgt78_category_lang` cl ON c.`id_category` = cl.`id_category` AND cl.id_shop = 1 
LEFT JOIN `hgt78_category_group` cg ON c.`id_category` = cg.`id_category`
RIGHT JOIN `hgt78_category` c2 ON c2.`id_category` = 44 AND c.`nleft` >= c2.`nleft` AND c.`nright` <= c2.`nright`
WHERE 1  AND `id_lang` = 1
AND c.`active` = 1
AND cg.`id_group` IN (1)
GROUP BY c.`id_category`
ORDER BY c.`level_depth` ASC
, category_shop.`position` ASC
1.509 ms 24 Yes Yes /classes/Category.php:799
131
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 7541 AND id_shop=1 LIMIT 1
1.507 ms 1 /classes/Product.php:6876
1245
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2658 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.500 ms 10 Yes /classes/SpecificPrice.php:576
474
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2767)
1.495 ms 1 /classes/Product.php:3860
295
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 5137 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.495 ms 10 Yes /classes/SpecificPrice.php:576
810
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2793
ORDER BY f.position ASC
1.495 ms 5 Yes /classes/Product.php:6021
2957
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 9055 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 9055 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.493 ms 0 /classes/Cart.php:1430
4212
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 9693
ORDER BY `position`
1.493 ms 1 Yes /classes/Product.php:3545
1676
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3745 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.491 ms 10 Yes /classes/SpecificPrice.php:576
744
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2799
ORDER BY f.position ASC
1.485 ms 5 Yes /classes/Product.php:6021
3942
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 5266) AND (b.`id_shop` = 1) LIMIT 1
1.484 ms 1 /src/Adapter/EntityMapper.php:71
185
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 5147 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.484 ms 10 Yes /classes/SpecificPrice.php:576
1231
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
1.483 ms 1 /classes/Product.php:5659
4057
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 6187
ORDER BY `position`
1.482 ms 1 Yes /classes/Product.php:3545
544
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2775 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2775 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.481 ms 0 /classes/Cart.php:1430
2339
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 5973
AND image_shop.`cover` = 1 LIMIT 1
1.480 ms 1 /classes/Product.php:3570
452
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2651 AND id_shop=1 LIMIT 1
1.477 ms 1 /classes/Product.php:6876
3522
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2690) AND (b.`id_shop` = 1) LIMIT 1
1.474 ms 1 /src/Adapter/EntityMapper.php:71
139
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 7540
ORDER BY `id_specific_price_priority` DESC LIMIT 1
1.471 ms 0 /classes/SpecificPrice.php:259
1184
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2641 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2641 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.471 ms 0 /classes/Cart.php:1430
3964
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5335
ORDER BY `position`
1.471 ms 1 Yes /classes/Product.php:3545
1842
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3765 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.468 ms 11 Yes /classes/SpecificPrice.php:576
439
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2652 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.467 ms 10 Yes /classes/SpecificPrice.php:576
1327
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2645 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2645 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.467 ms 0 /classes/Cart.php:1430
338
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 5133
ORDER BY `id_specific_price_priority` DESC LIMIT 1
1.463 ms 0 /classes/SpecificPrice.php:259
4185
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 9597) AND (b.`id_shop` = 1) LIMIT 1
1.463 ms 1 /src/Adapter/EntityMapper.php:71
524
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2774
AND image_shop.`cover` = 1 LIMIT 1
1.462 ms 1 /classes/Product.php:3570
556
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2776
ORDER BY f.position ASC
1.460 ms 5 Yes /classes/Product.php:6021
1489
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2490 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.460 ms 10 Yes /classes/SpecificPrice.php:576
41
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 33) AND (b.`id_shop` = 1) LIMIT 1
1.457 ms 1 /src/Adapter/EntityMapper.php:71
7
SELECT SQL_NO_CACHE *
FROM `hgt78_country` a
LEFT JOIN `hgt78_country_lang` `b` ON a.`id_country` = b.`id_country` AND b.`id_lang` = 1
LEFT JOIN `hgt78_country_shop` `c` ON a.`id_country` = c.`id_country` AND c.`id_shop` = 1
WHERE (a.`id_country` = 8) LIMIT 1
1.457 ms 1 /src/Adapter/EntityMapper.php:71
1500
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2621 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.454 ms 11 Yes /classes/SpecificPrice.php:576
3531
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2693) AND (b.`id_shop` = 1) LIMIT 1
1.452 ms 1 /src/Adapter/EntityMapper.php:71
605
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2691 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.451 ms 10 Yes /classes/SpecificPrice.php:576
1328
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2645
ORDER BY f.position ASC
1.446 ms 5 Yes /classes/Product.php:6021
1335
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3252)
1.444 ms 1 /classes/Product.php:3860
4263
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 10304
ORDER BY `position`
1.443 ms 1 Yes /classes/Product.php:3545
592
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2690 LIMIT 1
1.443 ms 10 /classes/SpecificPrice.php:435
1775
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3754 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.442 ms 10 Yes /classes/SpecificPrice.php:576
1095
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3459) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
1.438 ms 1 /classes/stock/StockAvailable.php:453
1566
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3484 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.436 ms 10 Yes /classes/SpecificPrice.php:576
162
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 6727 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.435 ms 10 Yes /classes/SpecificPrice.php:576
374
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3741 AND id_shop=1 LIMIT 1
1.435 ms 1 /classes/Product.php:6876
421
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2694 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2694 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.432 ms 0 /classes/Cart.php:1430
2136
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 5265) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
1.430 ms 1 /classes/stock/StockAvailable.php:453
3715
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2655
ORDER BY `position`
1.430 ms 1 Yes /classes/Product.php:3545
384
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3740)
1.429 ms 1 /classes/Product.php:3860
159
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 185 LIMIT 1
1.428 ms 1 /classes/Product.php:5659
3462
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3741) AND (b.`id_shop` = 1) LIMIT 1
1.427 ms 1 /src/Adapter/EntityMapper.php:71
1780
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3754 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3754 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.422 ms 0 /classes/Cart.php:1430
328
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 5134 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.421 ms 10 Yes /classes/SpecificPrice.php:576
4595
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3264) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.419 ms 1 Yes Yes /classes/Product.php:4524
422
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2694
ORDER BY f.position ASC
1.414 ms 5 Yes /classes/Product.php:6021
2457
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 6177 AND `id_group` = 1 LIMIT 1
1.411 ms 0 /classes/GroupReduction.php:156
4202
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 9690) AND (b.`id_shop` = 1) LIMIT 1
1.411 ms 1 /src/Adapter/EntityMapper.php:71
642
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2771) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
1.410 ms 1 /classes/stock/StockAvailable.php:453
789
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2794
AND image_shop.`cover` = 1 LIMIT 1
1.410 ms 1 /classes/Product.php:3570
579
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2661
AND image_shop.`cover` = 1 LIMIT 1
1.409 ms 1 /classes/Product.php:3570
654
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2738) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
1.407 ms 1 /classes/stock/StockAvailable.php:453
3495
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2769) AND (b.`id_shop` = 1) LIMIT 1
1.407 ms 1 /src/Adapter/EntityMapper.php:71
4062
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 6189) AND (b.`id_shop` = 1) LIMIT 1
1.406 ms 1 /src/Adapter/EntityMapper.php:71
43
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 35) AND (b.`id_shop` = 1) LIMIT 1
1.404 ms 1 /src/Adapter/EntityMapper.php:71
2377
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 6107 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.401 ms 10 Yes /classes/SpecificPrice.php:576
3985
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5774
ORDER BY `position`
1.398 ms 1 Yes /classes/Product.php:3545
4543
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2793) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.397 ms 1 Yes Yes /classes/Product.php:4524
1593
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3557 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3557 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.396 ms 0 /classes/Cart.php:1430
335
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 5133
AND image_shop.`cover` = 1 LIMIT 1
1.391 ms 1 /classes/Product.php:3570
705
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2795 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.390 ms 10 Yes /classes/SpecificPrice.php:576
4680
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (5971) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.389 ms 1 Yes Yes /classes/Product.php:4524
3519
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2661) AND (b.`id_shop` = 1) LIMIT 1
1.387 ms 1 /src/Adapter/EntityMapper.php:71
884
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2791 AND `id_group` = 1 LIMIT 1
1.386 ms 0 /classes/GroupReduction.php:156
3484
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2651
ORDER BY `position`
1.384 ms 1 Yes /classes/Product.php:3545
827
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2781)
1.380 ms 1 /classes/Product.php:3860
2967
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 9306) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
1.376 ms 1 /classes/stock/StockAvailable.php:453
667
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2764
ORDER BY f.position ASC
1.375 ms 5 Yes /classes/Product.php:6021
2367
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 6106)
1.372 ms 1 /classes/Product.php:3860
1226
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3456 AND `id_group` = 1 LIMIT 1
1.368 ms 0 /classes/GroupReduction.php:156
46
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 38) AND (b.`id_shop` = 1) LIMIT 1
1.366 ms 1 /src/Adapter/EntityMapper.php:71
1650
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3639
AND image_shop.`cover` = 1 LIMIT 1
1.361 ms 1 /classes/Product.php:3570
567
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2766
ORDER BY f.position ASC
1.356 ms 5 Yes /classes/Product.php:6021
4370
SELECT SQL_NO_CACHE c.*, cl.*
FROM `hgt78_category` c
INNER JOIN hgt78_category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1)
LEFT JOIN `hgt78_category_lang` cl ON c.`id_category` = cl.`id_category` AND cl.id_shop = 1 
LEFT JOIN `hgt78_category_group` cg ON c.`id_category` = cg.`id_category`
RIGHT JOIN `hgt78_category` c2 ON c2.`id_category` = 35 AND c.`nleft` >= c2.`nleft` AND c.`nright` <= c2.`nright`
WHERE 1  AND `id_lang` = 1
AND c.`active` = 1
AND cg.`id_group` IN (1)
GROUP BY c.`id_category`
ORDER BY c.`level_depth` ASC
, category_shop.`position` ASC
1.350 ms 27 Yes Yes /classes/Category.php:799
140
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 7540 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.347 ms 10 Yes /classes/SpecificPrice.php:576
2391
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 6108 AND `id_group` = 1 LIMIT 1
1.347 ms 0 /classes/GroupReduction.php:156
4345
SELECT SQL_NO_CACHE c.*, cl.*
FROM `hgt78_category` c
INNER JOIN hgt78_category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1)
LEFT JOIN `hgt78_category_lang` cl ON c.`id_category` = cl.`id_category` AND cl.id_shop = 1 
LEFT JOIN `hgt78_category_group` cg ON c.`id_category` = cg.`id_category`
RIGHT JOIN `hgt78_category` c2 ON c2.`id_category` = 344 AND c.`nleft` >= c2.`nleft` AND c.`nright` <= c2.`nright`
WHERE 1  AND `id_lang` = 1
AND c.`active` = 1
AND cg.`id_group` IN (1)
GROUP BY c.`id_category`
ORDER BY c.`level_depth` ASC
, category_shop.`position` ASC
1.347 ms 15 Yes Yes /classes/Category.php:799
3663
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3458) AND (b.`id_shop` = 1) LIMIT 1
1.347 ms 1 /src/Adapter/EntityMapper.php:71
351
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4902)
1.346 ms 1 /classes/Product.php:3860
2952
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 9055 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.345 ms 13 Yes /classes/SpecificPrice.php:576
478
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2767 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2767 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.344 ms 0 /classes/Cart.php:1430
583
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2661 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.343 ms 10 Yes /classes/SpecificPrice.php:576
434
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2660
ORDER BY f.position ASC
1.343 ms 5 Yes /classes/Product.php:6021
145
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 7540 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 7540 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.342 ms 0 /classes/Cart.php:1430
2373
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 6107
AND image_shop.`cover` = 1 LIMIT 1
1.342 ms 1 /classes/Product.php:3570
1195
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2656 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2656 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.341 ms 0 /classes/Cart.php:1430
1198
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
1.341 ms 1 /classes/Product.php:5659
929
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2635) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
1.337 ms 1 /classes/stock/StockAvailable.php:453
3456
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4902) AND (b.`id_shop` = 1) LIMIT 1
1.335 ms 1 /src/Adapter/EntityMapper.php:71
4183
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 9596
ORDER BY `position`
1.335 ms 1 Yes /classes/Product.php:3545
400
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3587
ORDER BY f.position ASC
1.334 ms 5 Yes /classes/Product.php:6021
389
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3740
ORDER BY f.position ASC
1.332 ms 5 Yes /classes/Product.php:6021
936
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2631 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.327 ms 10 Yes /classes/SpecificPrice.php:576
2896
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 8418 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.318 ms 10 Yes /classes/SpecificPrice.php:576
1936
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3806 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3806 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.317 ms 0 /classes/Cart.php:1430
477
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2767) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
1.315 ms 1 /classes/stock/StockAvailable.php:453
1191
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2656)
1.314 ms 1 /classes/Product.php:3860
394
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3587 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.312 ms 11 Yes /classes/SpecificPrice.php:576
2320
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 5971
ORDER BY `id_specific_price_priority` DESC LIMIT 1
1.312 ms 0 /classes/SpecificPrice.php:259
595
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2690)
1.311 ms 1 /classes/Product.php:3860
325
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 309 LIMIT 1
1.310 ms 1 /classes/Product.php:5659
92
SELECT SQL_NO_CACHE `name`
FROM `hgt78_manufacturer`
WHERE `id_manufacturer` = 2
AND `active` = 1 LIMIT 1
1.310 ms 1 /classes/Manufacturer.php:316
1203
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2648 AND id_shop=1 LIMIT 1
1.309 ms 1 /classes/Product.php:6876
3465
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3740) AND (b.`id_shop` = 1) LIMIT 1
1.308 ms 1 /src/Adapter/EntityMapper.php:71
113
SELECT SQL_NO_CACHE tr.*
FROM `hgt78_tax_rule` tr
JOIN `hgt78_tax_rules_group` trg ON (tr.`id_tax_rules_group` = trg.`id_tax_rules_group`)
WHERE trg.`active` = 1
AND tr.`id_country` = 8
AND tr.`id_tax_rules_group` = 28
AND tr.`id_state` IN (0, 0)
AND ('0' BETWEEN tr.`zipcode_from` AND tr.`zipcode_to`
OR (tr.`zipcode_to` = 0 AND tr.`zipcode_from` IN(0, '0')))
ORDER BY tr.`zipcode_from` DESC, tr.`zipcode_to` DESC, tr.`id_state` DESC, tr.`id_country` DESC
1.306 ms 1 /classes/tax/TaxRulesTaxManager.php:109
635
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 182 LIMIT 1
1.305 ms 1 /classes/Product.php:5659
2372
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 6106
ORDER BY f.position ASC
1.305 ms 5 Yes /classes/Product.php:6021
670
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2777 LIMIT 1
1.304 ms 10 /classes/SpecificPrice.php:435
4593
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3255) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.303 ms 1 Yes Yes /classes/Product.php:4524
1217
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2657 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2657 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.301 ms 0 /classes/Cart.php:1430
2933
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 8975) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
1.300 ms 1 /classes/stock/StockAvailable.php:453
625
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2693 LIMIT 1
1.299 ms 10 /classes/SpecificPrice.php:435
633
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2693
ORDER BY f.position ASC
1.299 ms 5 Yes /classes/Product.php:6021
875
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2790 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2790 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.296 ms 0 /classes/Cart.php:1430
1417
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3155
ORDER BY f.position ASC
1.294 ms 5 Yes /classes/Product.php:6021
655
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2738 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2738 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.291 ms 0 /classes/Cart.php:1430
4672
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (5350) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.291 ms 1 Yes Yes /classes/Product.php:4524
992
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2636 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.287 ms 10 Yes /classes/SpecificPrice.php:576
1698
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3747 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.287 ms 10 Yes /classes/SpecificPrice.php:576
1692
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3746 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3746 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.286 ms 0 /classes/Cart.php:1430
1061
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2628 AND `id_group` = 1 LIMIT 1
1.285 ms 0 /classes/GroupReduction.php:156
547
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 182 LIMIT 1
1.282 ms 1 /classes/Product.php:5659
2137
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 5265 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 5265 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.282 ms 0 /classes/Cart.php:1430
4471
SELECT SQL_NO_CACHE c.*, cl.*
FROM `hgt78_category` c
INNER JOIN hgt78_category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1)
LEFT JOIN `hgt78_category_lang` cl ON c.`id_category` = cl.`id_category` AND cl.id_shop = 1 
LEFT JOIN `hgt78_category_group` cg ON c.`id_category` = cg.`id_category`
RIGHT JOIN `hgt78_category` c2 ON c2.`id_category` = 39 AND c.`nleft` >= c2.`nleft` AND c.`nright` <= c2.`nright`
WHERE 1  AND `id_lang` = 1
AND c.`active` = 1
AND cg.`id_group` IN (1)
GROUP BY c.`id_category`
ORDER BY c.`level_depth` ASC
, category_shop.`position` ASC
1.281 ms 73 Yes Yes /classes/Category.php:799
284
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 5138 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.280 ms 10 Yes /classes/SpecificPrice.php:576
1157
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2627 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.278 ms 10 Yes /classes/SpecificPrice.php:576
4093
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 7940
ORDER BY `position`
1.278 ms 1 Yes /classes/Product.php:3545
1400
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3326 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.277 ms 10 Yes /classes/SpecificPrice.php:576
466
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2623 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2623 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.276 ms 0 /classes/Cart.php:1430
1367
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3256 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.273 ms 10 Yes /classes/SpecificPrice.php:576
3987
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 5970) AND (b.`id_shop` = 1) LIMIT 1
1.272 ms 1 /src/Adapter/EntityMapper.php:71
1300
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2655 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.269 ms 10 Yes /classes/SpecificPrice.php:576
4655
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4942) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.264 ms 1 Yes Yes /classes/Product.php:4524
516
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2773
ORDER BY `id_specific_price_priority` DESC LIMIT 1
1.264 ms 0 /classes/SpecificPrice.php:259
1323
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2645)
1.263 ms 1 /classes/Product.php:3860
1438
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2892) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
1.263 ms 1 /classes/stock/StockAvailable.php:453
1346
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3254)
1.262 ms 1 /classes/Product.php:3860
4023
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 6176) AND (b.`id_shop` = 1) LIMIT 1
1.261 ms 1 /src/Adapter/EntityMapper.php:71
2148
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 5266 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 5266 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.257 ms 0 /classes/Cart.php:1430
3481
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2652
ORDER BY `position`
1.254 ms 1 Yes /classes/Product.php:3545
402
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 185 LIMIT 1
1.253 ms 1 /classes/Product.php:5659
100
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 7543)
1.252 ms 1 /classes/Product.php:3860
4022
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 6174
1.251 ms 1 /classes/Product.php:2902
112
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 7543
ORDER BY f.position ASC
1.250 ms 5 Yes /classes/Product.php:6021
383
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3740 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.249 ms 10 Yes /classes/SpecificPrice.php:576
616
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2692 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.245 ms 10 Yes /classes/SpecificPrice.php:576
986
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2782 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2782 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.245 ms 0 /classes/Cart.php:1430
1185
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2641
ORDER BY f.position ASC
1.244 ms 5 Yes /classes/Product.php:6021
356
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4902
ORDER BY f.position ASC
1.241 ms 5 Yes /classes/Product.php:6021
4143
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 8417) AND (b.`id_shop` = 1) LIMIT 1
1.239 ms 1 /src/Adapter/EntityMapper.php:71
168
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 6727
ORDER BY f.position ASC
1.236 ms 5 Yes /classes/Product.php:6021
656
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2738
ORDER BY f.position ASC
1.236 ms 5 Yes /classes/Product.php:6021
3726
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3254) AND (b.`id_shop` = 1) LIMIT 1
1.236 ms 1 /src/Adapter/EntityMapper.php:71
187
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 5147 AND id_shop=1 LIMIT 1
1.234 ms 1 /classes/Product.php:6876
4056
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 6187) AND (b.`id_shop` = 1) LIMIT 1
1.233 ms 1 /src/Adapter/EntityMapper.php:71
4236
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 10071
ORDER BY `position`
1.232 ms 1 Yes /classes/Product.php:3545
1394
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3265 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3265 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.231 ms 0 /classes/Cart.php:1430
1538
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2654 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2654 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.231 ms 0 /classes/Cart.php:1430
4619
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3586) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.230 ms 1 Yes Yes /classes/Product.php:4524
2404
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 6129 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 6129 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.228 ms 0 /classes/Cart.php:1430
3984
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 5774) AND (b.`id_shop` = 1) LIMIT 1
1.227 ms 1 /src/Adapter/EntityMapper.php:71
2427
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 6173
ORDER BY f.position ASC
1.227 ms 5 Yes /classes/Product.php:6021
435
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2652
AND image_shop.`cover` = 1 LIMIT 1
1.226 ms 1 /classes/Product.php:3570
4277
SELECT SQL_NO_CACHE `id_hook`, `name` FROM `hgt78_hook`
1.225 ms 1185 /classes/Hook.php:1348
4638
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3766) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.223 ms 1 Yes Yes /classes/Product.php:4524
1544
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3454 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.221 ms 10 Yes /classes/SpecificPrice.php:576
2388
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 6108 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.219 ms 10 Yes /classes/SpecificPrice.php:576
1256
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2647 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.216 ms 10 Yes /classes/SpecificPrice.php:576
4653
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4934) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.214 ms 1 Yes Yes /classes/Product.php:4524
4116
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 7779) AND (b.`id_shop` = 1) LIMIT 1
1.212 ms 1 /src/Adapter/EntityMapper.php:71
432
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2660) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
1.209 ms 1 /classes/stock/StockAvailable.php:453
1350
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3254 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3254 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.208 ms 0 /classes/Cart.php:1430
362
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3743)
1.207 ms 1 /classes/Product.php:3860
4344
SELECT SQL_NO_CACHE c.*, cl.*
FROM `hgt78_category` c
INNER JOIN hgt78_category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1)
LEFT JOIN `hgt78_category_lang` cl ON c.`id_category` = cl.`id_category` AND cl.id_shop = 1 
LEFT JOIN `hgt78_category_group` cg ON c.`id_category` = cg.`id_category`
RIGHT JOIN `hgt78_category` c2 ON c2.`id_category` = 41 AND c.`nleft` >= c2.`nleft` AND c.`nright` <= c2.`nright`
WHERE 1  AND `id_lang` = 1
AND c.`active` = 1
AND cg.`id_group` IN (1)
GROUP BY c.`id_category`
ORDER BY c.`level_depth` ASC
, category_shop.`position` ASC
1.207 ms 7 Yes Yes /classes/Category.php:799
1200
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2648
ORDER BY `id_specific_price_priority` DESC LIMIT 1
1.206 ms 0 /classes/SpecificPrice.php:259
4696
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (6181) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.205 ms 1 Yes Yes /classes/Product.php:4524
2407
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 182 LIMIT 1
1.201 ms 1 /classes/Product.php:5659
2165
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 5282 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.200 ms 15 Yes /classes/SpecificPrice.php:576
460
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2623
ORDER BY `id_specific_price_priority` DESC LIMIT 1
1.199 ms 0 /classes/SpecificPrice.php:259
1106
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2622) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
1.199 ms 1 /classes/stock/StockAvailable.php:453
4189
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 9598
ORDER BY `position`
1.199 ms 1 Yes /classes/Product.php:3545
4698
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (6183) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.199 ms 1 Yes Yes /classes/Product.php:4524
4321
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 38) AND (b.`id_shop` = 1) LIMIT 1
1.197 ms 1 /src/Adapter/EntityMapper.php:71
151
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 7539 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.196 ms 10 Yes /classes/SpecificPrice.php:576
101
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 7543 AND id_shop=1 LIMIT 1
1.195 ms 1 /classes/Product.php:6876
3335
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 10304 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.195 ms 10 Yes /classes/SpecificPrice.php:576
386
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3740 AND `id_group` = 1 LIMIT 1
1.194 ms 0 /classes/GroupReduction.php:156
1649
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3586
ORDER BY f.position ASC
1.192 ms 5 Yes /classes/Product.php:6021
2968
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 9306 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 9306 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.189 ms 0 /classes/Cart.php:1430
1102
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2622 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.188 ms 10 Yes /classes/SpecificPrice.php:576
1174
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2640
ORDER BY f.position ASC
1.188 ms 5 Yes /classes/Product.php:6021
1368
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3256)
1.186 ms 1 /classes/Product.php:3860
2476
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 6179 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.186 ms 10 Yes /classes/SpecificPrice.php:576
273
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 5139 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.185 ms 10 Yes /classes/SpecificPrice.php:576
3943
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5266
ORDER BY `position`
1.185 ms 1 Yes /classes/Product.php:3545
197
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 5146)
1.183 ms 1 /classes/Product.php:3860
108
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_group`
WHERE `id_group` = 1 LIMIT 1
1.180 ms 1 /classes/Group.php:154
1687
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3746 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.180 ms 10 Yes /classes/SpecificPrice.php:576
949
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2632 AND id_shop=1 LIMIT 1
1.179 ms 1 /classes/Product.php:6876
1495
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2490
ORDER BY f.position ASC
1.179 ms 5 Yes /classes/Product.php:6021
1035
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2630
ORDER BY `id_specific_price_priority` DESC LIMIT 1
1.175 ms 0 /classes/SpecificPrice.php:259
39
SELECT SQL_NO_CACHE ctg.`id_group`
FROM hgt78_category_group ctg
WHERE ctg.`id_category` = 2 AND ctg.`id_group` = 1 LIMIT 1
1.173 ms 1 /classes/Category.php:1754
749
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2800 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.171 ms 10 Yes /classes/SpecificPrice.php:576
4627
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3750) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.170 ms 1 Yes Yes /classes/Product.php:4524
3849
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3756) AND (b.`id_shop` = 1) LIMIT 1
1.169 ms 1 /src/Adapter/EntityMapper.php:71
973
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2634) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
1.167 ms 1 /classes/stock/StockAvailable.php:453
1065
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3477
AND image_shop.`cover` = 1 LIMIT 1
1.167 ms 1 /classes/Product.php:3570
16
SELECT SQL_NO_CACHE `id_hook`, `name` FROM `hgt78_hook`
1.167 ms 1185 /classes/Hook.php:1348
3771
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2733) AND (b.`id_shop` = 1) LIMIT 1
1.167 ms 1 /src/Adapter/EntityMapper.php:71
212
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 5145 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 5145 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.165 ms 0 /classes/Cart.php:1430
181
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 5147
AND image_shop.`cover` = 1 LIMIT 1
1.164 ms 1 /classes/Product.php:3570
252
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 5141)
1.163 ms 1 /classes/Product.php:3860
1062
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2628) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
1.162 ms 1 /classes/stock/StockAvailable.php:453
1420
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2818) AND (b.`id_shop` = 1) LIMIT 1
1.162 ms 1 /src/Adapter/EntityMapper.php:71
2963
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 9306 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.161 ms 10 Yes /classes/SpecificPrice.php:576
3929
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4963
1.160 ms 1 /classes/Product.php:2902
423
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2660
AND image_shop.`cover` = 1 LIMIT 1
1.160 ms 1 /classes/Product.php:3570
1067
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3477 LIMIT 1
1.158 ms 10 /classes/SpecificPrice.php:435
1098
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2622
AND image_shop.`cover` = 1 LIMIT 1
1.156 ms 1 /classes/Product.php:3570
3496
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2769
ORDER BY `position`
1.156 ms 1 Yes /classes/Product.php:3545
897
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2792 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2792 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.156 ms 0 /classes/Cart.php:1430
1334
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3252 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.154 ms 10 Yes /classes/SpecificPrice.php:576
513
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2773
AND image_shop.`cover` = 1 LIMIT 1
1.154 ms 1 /classes/Product.php:3570
3921
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4944) AND (b.`id_shop` = 1) LIMIT 1
1.153 ms 1 /src/Adapter/EntityMapper.php:71
1897
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3777 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.152 ms 10 Yes /classes/SpecificPrice.php:576
3982
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5592
ORDER BY `position`
1.151 ms 1 Yes /classes/Product.php:3545
3411
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 5146) AND (b.`id_shop` = 1) LIMIT 1
1.150 ms 1 /src/Adapter/EntityMapper.php:71
3960
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 5296) AND (b.`id_shop` = 1) LIMIT 1
1.148 ms 1 /src/Adapter/EntityMapper.php:71
3963
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 5335) AND (b.`id_shop` = 1) LIMIT 1
1.148 ms 1 /src/Adapter/EntityMapper.php:71
637
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2771
ORDER BY `id_specific_price_priority` DESC LIMIT 1
1.147 ms 1 /classes/SpecificPrice.php:259
3729
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3255) AND (b.`id_shop` = 1) LIMIT 1
1.147 ms 1 /src/Adapter/EntityMapper.php:71
4544
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2780) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.145 ms 1 Yes Yes /classes/Product.php:4524
1886
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3776 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.144 ms 10 Yes /classes/SpecificPrice.php:576
638
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2771 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.143 ms 10 Yes /classes/SpecificPrice.php:576
234
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 5143 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 5143 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.142 ms 0 /classes/Cart.php:1430
674
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2777 AND id_shop=1 LIMIT 1
1.142 ms 1 /classes/Product.php:6876
906
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3177 AND `id_group` = 1 LIMIT 1
1.142 ms 0 /classes/GroupReduction.php:156
1831
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3764 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.142 ms 10 Yes /classes/SpecificPrice.php:576
2378
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 6107)
1.142 ms 1 /classes/Product.php:3860
1494
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2490 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2490 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.142 ms 0 /classes/Cart.php:1430
1316
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2644 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2644 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.141 ms 0 /classes/Cart.php:1430
465
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2623) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
1.139 ms 1 /classes/stock/StockAvailable.php:453
4391
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 53) LIMIT 1
1.138 ms 1 /src/Adapter/EntityMapper.php:71
2918
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 8420 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.136 ms 10 Yes /classes/SpecificPrice.php:576
3961
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5296
ORDER BY `position`
1.136 ms 2 Yes /classes/Product.php:3545
1439
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2892 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2892 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.136 ms 0 /classes/Cart.php:1430
4122
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 8392) AND (b.`id_shop` = 1) LIMIT 1
1.135 ms 1 /src/Adapter/EntityMapper.php:71
4681
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (5972) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.134 ms 1 Yes Yes /classes/Product.php:4524
201
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 5146 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 5146 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.133 ms 0 /classes/Cart.php:1430
2575
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 6188 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.132 ms 10 Yes /classes/SpecificPrice.php:576
93
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 0 LIMIT 1
1.131 ms 1 /classes/SpecificPrice.php:426
1903
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3777
ORDER BY f.position ASC
1.131 ms 5 Yes /classes/Product.php:6021
1070
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3477)
1.129 ms 1 /classes/Product.php:3860
2691
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 7938 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 7938 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.127 ms 0 /classes/Cart.php:1430
4196
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 9688) AND (b.`id_shop` = 1) LIMIT 1
1.127 ms 1 /src/Adapter/EntityMapper.php:71
4594
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3256) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.127 ms 1 Yes Yes /classes/Product.php:4524
1267
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2646 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.125 ms 10 Yes /classes/SpecificPrice.php:576
1478
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3327 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.124 ms 10 Yes /classes/SpecificPrice.php:576
1589
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3557)
1.124 ms 1 /classes/Product.php:3860
2310
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 5970 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.124 ms 10 Yes /classes/SpecificPrice.php:576
3846
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3755) AND (b.`id_shop` = 1) LIMIT 1
1.121 ms 1 /src/Adapter/EntityMapper.php:71
1875
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3775 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.120 ms 10 Yes /classes/SpecificPrice.php:576
152
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 7539)
1.115 ms 1 /classes/Product.php:3860
3946
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5267
ORDER BY `position`
1.113 ms 1 Yes /classes/Product.php:3545
4253
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 10299) AND (b.`id_shop` = 1) LIMIT 1
1.112 ms 1 /src/Adapter/EntityMapper.php:71
571
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2765
ORDER BY `id_specific_price_priority` DESC LIMIT 1
1.110 ms 0 /classes/SpecificPrice.php:259
4011
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 6129) AND (b.`id_shop` = 1) LIMIT 1
1.110 ms 1 /src/Adapter/EntityMapper.php:71
4748
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (9686) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.107 ms 1 Yes Yes /classes/Product.php:4524
3861
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3765) AND (b.`id_shop` = 1) LIMIT 1
1.107 ms 1 /src/Adapter/EntityMapper.php:71
223
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 5144 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 5144 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.106 ms 0 /classes/Cart.php:1430
289
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 5138 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 5138 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.105 ms 0 /classes/Cart.php:1430
798
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2794 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2794 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.105 ms 0 /classes/Cart.php:1430
1317
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2644
ORDER BY f.position ASC
1.103 ms 5 Yes /classes/Product.php:6021
2803
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 7773
ORDER BY f.position ASC
1.101 ms 5 Yes /classes/Product.php:6021
241
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 5142)
1.099 ms 1 /classes/Product.php:3860
2421
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 6173 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.099 ms 10 Yes /classes/SpecificPrice.php:576
2366
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 6106 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.098 ms 10 Yes /classes/SpecificPrice.php:576
723
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2798
AND image_shop.`cover` = 1 LIMIT 1
1.097 ms 1 /classes/Product.php:3570
1423
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2818 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.097 ms 10 Yes /classes/SpecificPrice.php:576
1511
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2733 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.097 ms 10 Yes /classes/SpecificPrice.php:576
1555
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3455 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.095 ms 10 Yes /classes/SpecificPrice.php:576
600
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2690
ORDER BY f.position ASC
1.095 ms 5 Yes /classes/Product.php:6021
1931
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3806 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.095 ms 10 Yes /classes/SpecificPrice.php:576
147
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 7539
AND image_shop.`cover` = 1 LIMIT 1
1.094 ms 1 /classes/Product.php:3570
502
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2770
AND image_shop.`cover` = 1 LIMIT 1
1.093 ms 1 /classes/Product.php:3570
618
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2692 AND id_shop=1 LIMIT 1
1.092 ms 1 /classes/Product.php:6876
1727
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3750
AND image_shop.`cover` = 1 LIMIT 1
1.091 ms 1 /classes/Product.php:3570
2752
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 7945 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.091 ms 10 Yes /classes/SpecificPrice.php:576
1953
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3808 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.088 ms 10 Yes /classes/SpecificPrice.php:576
2394
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 6108
ORDER BY f.position ASC
1.088 ms 5 Yes /classes/Product.php:6021
311
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 5136 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 5136 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.088 ms 0 /classes/Cart.php:1430
444
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2652 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2652 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.086 ms 0 /classes/Cart.php:1430
1289
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2643 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.086 ms 10 Yes /classes/SpecificPrice.php:576
2132
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 5265 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.086 ms 10 Yes /classes/SpecificPrice.php:576
2321
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 5971 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.086 ms 10 Yes /classes/SpecificPrice.php:576
4258
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 10302
1.086 ms 1 /classes/Product.php:2902
2907
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 8419 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.085 ms 10 Yes /classes/SpecificPrice.php:576
2109
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4965 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.083 ms 10 Yes /classes/SpecificPrice.php:576
2763
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 7946 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.082 ms 10 Yes /classes/SpecificPrice.php:576
155
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 7539) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
1.079 ms 1 /classes/stock/StockAvailable.php:453
3516
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2765) AND (b.`id_shop` = 1) LIMIT 1
1.078 ms 1 /src/Adapter/EntityMapper.php:71
4364
SELECT SQL_NO_CACHE c.*, cl.*
FROM `hgt78_category` c
INNER JOIN hgt78_category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1)
LEFT JOIN `hgt78_category_lang` cl ON c.`id_category` = cl.`id_category` AND cl.id_shop = 1 
LEFT JOIN `hgt78_category_group` cg ON c.`id_category` = cg.`id_category`
RIGHT JOIN `hgt78_category` c2 ON c2.`id_category` = 199 AND c.`nleft` >= c2.`nleft` AND c.`nright` <= c2.`nright`
WHERE 1  AND `id_lang` = 1
AND c.`active` = 1
AND cg.`id_group` IN (1)
GROUP BY c.`id_category`
ORDER BY c.`level_depth` ASC
, category_shop.`position` ASC
1.076 ms 13 Yes Yes /classes/Category.php:799
1357
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3255)
1.075 ms 1 /classes/Product.php:3860
2708
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 7941 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.074 ms 10 Yes /classes/SpecificPrice.php:576
300
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 5137 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 5137 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.072 ms 0 /classes/Cart.php:1430
1043
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2629
AND image_shop.`cover` = 1 LIMIT 1
1.072 ms 1 /classes/Product.php:3570
987
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2782
ORDER BY f.position ASC
1.071 ms 5 Yes /classes/Product.php:6021
158
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 6727
AND image_shop.`cover` = 1 LIMIT 1
1.070 ms 1 /classes/Product.php:3570
442
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2652 AND `id_group` = 1 LIMIT 1
1.068 ms 0 /classes/GroupReduction.php:156
1080
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2620 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.067 ms 10 Yes /classes/SpecificPrice.php:576
652
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2738 AND id_shop=1 LIMIT 1
1.065 ms 1 /classes/Product.php:6876
2929
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 8975 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.065 ms 16 Yes /classes/SpecificPrice.php:576
4193
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 9686) AND (b.`id_shop` = 1) LIMIT 1
1.065 ms 1 /src/Adapter/EntityMapper.php:71
4357
SELECT SQL_NO_CACHE c.*, cl.*
FROM `hgt78_category` c
INNER JOIN hgt78_category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1)
LEFT JOIN `hgt78_category_lang` cl ON c.`id_category` = cl.`id_category` AND cl.id_shop = 1 
LEFT JOIN `hgt78_category_group` cg ON c.`id_category` = cg.`id_category`
RIGHT JOIN `hgt78_category` c2 ON c2.`id_category` = 64 AND c.`nleft` >= c2.`nleft` AND c.`nright` <= c2.`nright`
WHERE 1  AND `id_lang` = 1
AND c.`active` = 1
AND cg.`id_group` IN (1)
GROUP BY c.`id_category`
ORDER BY c.`level_depth` ASC
, category_shop.`position` ASC
1.064 ms 10 Yes Yes /classes/Category.php:799
1082
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2620 AND id_shop=1 LIMIT 1
1.063 ms 1 /classes/Product.php:6876
691
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 182 LIMIT 1
1.063 ms 1 /classes/Product.php:5659
2159
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 5267 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 5267 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.062 ms 0 /classes/Cart.php:1430
1588
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3557 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.061 ms 10 Yes /classes/SpecificPrice.php:576
1652
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3639 LIMIT 1
1.061 ms 10 /classes/SpecificPrice.php:435
190
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 5147 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 5147 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.060 ms 0 /classes/Cart.php:1430
2399
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 6129 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.060 ms 10 Yes /classes/SpecificPrice.php:576
2935
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 8975
ORDER BY f.position ASC
1.060 ms 5 Yes /classes/Product.php:6021
3978
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 5591) AND (b.`id_shop` = 1) LIMIT 1
1.060 ms 1 /src/Adapter/EntityMapper.php:71
1278
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2642 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.059 ms 10 Yes /classes/SpecificPrice.php:576
1510
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2733
ORDER BY `id_specific_price_priority` DESC LIMIT 1
1.059 ms 0 /classes/SpecificPrice.php:259
4546
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3179) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.059 ms 1 Yes Yes /classes/Product.php:4524
1014
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2638 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.057 ms 10 Yes /classes/SpecificPrice.php:576
1621
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3584 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.055 ms 10 Yes /classes/SpecificPrice.php:576
71
SELECT SQL_NO_CACHE *
FROM `hgt78_shop_url` a0
1.053 ms 1 /classes/PrestaShopCollection.php:383
3330
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 10303
ORDER BY f.position ASC
1.052 ms 5 Yes /classes/Product.php:6021
3678
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2640) AND (b.`id_shop` = 1) LIMIT 1
1.052 ms 1 /src/Adapter/EntityMapper.php:71
4358
SELECT SQL_NO_CACHE c.*, cl.*
FROM `hgt78_category` c
INNER JOIN hgt78_category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1)
LEFT JOIN `hgt78_category_lang` cl ON c.`id_category` = cl.`id_category` AND cl.id_shop = 1 
LEFT JOIN `hgt78_category_group` cg ON c.`id_category` = cg.`id_category`
RIGHT JOIN `hgt78_category` c2 ON c2.`id_category` = 70 AND c.`nleft` >= c2.`nleft` AND c.`nright` <= c2.`nright`
WHERE 1  AND `id_lang` = 1
AND c.`active` = 1
AND cg.`id_group` IN (1)
GROUP BY c.`id_category`
ORDER BY c.`level_depth` ASC
, category_shop.`position` ASC
1.052 ms 11 Yes Yes /classes/Category.php:799
665
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2764) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
1.051 ms 1 /classes/stock/StockAvailable.php:453
959
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2633)
1.051 ms 1 /classes/Product.php:3860
4605
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2490) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.051 ms 1 Yes Yes /classes/Product.php:4524
782
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3176 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.049 ms 10 Yes /classes/SpecificPrice.php:576
760
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3178 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.048 ms 10 Yes /classes/SpecificPrice.php:576
1791
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3755 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3755 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.048 ms 0 /classes/Cart.php:1430
406
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2893)
1.047 ms 1 /classes/Product.php:3860
1305
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2655 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2655 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.047 ms 0 /classes/Cart.php:1430
156
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 7539 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 7539 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.047 ms 0 /classes/Cart.php:1430
2221
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 5335 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.046 ms 10 Yes /classes/SpecificPrice.php:576
2719
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 7942 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.046 ms 10 Yes /classes/SpecificPrice.php:576
1604
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3558 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3558 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.045 ms 0 /classes/Cart.php:1430
3888
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3807) AND (b.`id_shop` = 1) LIMIT 1
1.045 ms 1 /src/Adapter/EntityMapper.php:71
1647
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3586) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
1.044 ms 1 /classes/stock/StockAvailable.php:453
144
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 7540) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
1.043 ms 1 /classes/stock/StockAvailable.php:453
357
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3743
AND image_shop.`cover` = 1 LIMIT 1
1.043 ms 1 /classes/Product.php:3570
4592
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3254) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.043 ms 1 Yes Yes /classes/Product.php:4524
512
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2770
ORDER BY f.position ASC
1.042 ms 5 Yes /classes/Product.php:6021
1390
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3265)
1.042 ms 1 /classes/Product.php:3860
1039
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2630 AND `id_group` = 1 LIMIT 1
1.042 ms 0 /classes/GroupReduction.php:156
51
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 40) AND (b.`id_shop` = 1) LIMIT 1
1.041 ms 1 /src/Adapter/EntityMapper.php:71
1356
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3255 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.041 ms 10 Yes /classes/SpecificPrice.php:576
2149
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 5266
ORDER BY f.position ASC
1.041 ms 5 Yes /classes/Product.php:6021
4604
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3327) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.041 ms 1 Yes Yes /classes/Product.php:4524
1880
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3775 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3775 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.039 ms 0 /classes/Cart.php:1430
914
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2659 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.036 ms 10 Yes /classes/SpecificPrice.php:576
170
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `hgt78_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 309 LIMIT 1
1.035 ms 1 /classes/Category.php:1378
1239
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2649 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2649 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.035 ms 0 /classes/Cart.php:1430
148
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 185 LIMIT 1
1.034 ms 1 /classes/Product.php:5659
4628
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3751) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.033 ms 1 Yes Yes /classes/Product.php:4524
1378
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3264 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.032 ms 10 Yes /classes/SpecificPrice.php:576
1659
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3639 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3639 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.032 ms 0 /classes/Cart.php:1430
2416
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 6172
ORDER BY f.position ASC
1.031 ms 5 Yes /classes/Product.php:6021
3030
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 9596 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.031 ms 10 Yes /classes/SpecificPrice.php:576
251
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 5141 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.031 ms 10 Yes /classes/SpecificPrice.php:576
4044
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 6183) AND (b.`id_shop` = 1) LIMIT 1
1.031 ms 1 /src/Adapter/EntityMapper.php:71
787
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3176 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3176 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.029 ms 0 /classes/Cart.php:1430
2437
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 6174 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 6174 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.028 ms 0 /classes/Cart.php:1430
3765
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2490) AND (b.`id_shop` = 1) LIMIT 1
1.028 ms 1 /src/Adapter/EntityMapper.php:71
4182
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 9596) AND (b.`id_shop` = 1) LIMIT 1
1.028 ms 1 /src/Adapter/EntityMapper.php:71
2939
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 8976
ORDER BY `id_specific_price_priority` DESC LIMIT 1
1.027 ms 0 /classes/SpecificPrice.php:259
107
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 7543 AND `id_group` = 1 LIMIT 1
1.023 ms 0 /classes/GroupReduction.php:156
546
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2776
AND image_shop.`cover` = 1 LIMIT 1
1.023 ms 1 /classes/Product.php:3570
910
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2659
AND image_shop.`cover` = 1 LIMIT 1
1.023 ms 1 /classes/Product.php:3570
1225
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3456 AND id_shop=1 LIMIT 1
1.023 ms 1 /classes/Product.php:6876
2098
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4964 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.021 ms 10 Yes /classes/SpecificPrice.php:576
3460
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3743
ORDER BY `position`
1.021 ms 1 Yes /classes/Product.php:3545
1914
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3804 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3804 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.020 ms 0 /classes/Cart.php:1430
601
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2691
AND image_shop.`cover` = 1 LIMIT 1
1.018 ms 1 /classes/Product.php:3570
2120
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4966 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.017 ms 10 Yes /classes/SpecificPrice.php:576
517
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2773 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.016 ms 10 Yes /classes/SpecificPrice.php:576
1146
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2626 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.016 ms 10 Yes /classes/SpecificPrice.php:576
4598
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3155) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.016 ms 1 Yes Yes /classes/Product.php:4524
1638
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3585
ORDER BY f.position ASC
1.015 ms 5 Yes /classes/Product.php:6021
872
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2790 AND id_shop=1 LIMIT 1
1.014 ms 1 /classes/Product.php:6876
4005
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 6107) AND (b.`id_shop` = 1) LIMIT 1
1.014 ms 1 /src/Adapter/EntityMapper.php:71
1645
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3586 AND id_shop=1 LIMIT 1
1.009 ms 1 /classes/Product.php:6876
133
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 7541) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
1.008 ms 1 /classes/stock/StockAvailable.php:453
1942
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3807 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.008 ms 10 Yes /classes/SpecificPrice.php:576
3936
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4966) AND (b.`id_shop` = 1) LIMIT 1
1.008 ms 1 /src/Adapter/EntityMapper.php:71
3931
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4964
ORDER BY `position`
1.008 ms 1 Yes /classes/Product.php:3545
1655
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3639)
1.007 ms 1 /classes/Product.php:3860
738
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2799 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.007 ms 10 Yes /classes/SpecificPrice.php:576
3991
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5971
ORDER BY `position`
1.007 ms 1 Yes /classes/Product.php:3545
2830
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 8394 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.005 ms 3 Yes /classes/SpecificPrice.php:576
245
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 5142 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 5142 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.003 ms 0 /classes/Cart.php:1430
1329
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3252
AND image_shop.`cover` = 1 LIMIT 1
1.003 ms 1 /classes/Product.php:3570
2087
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4963 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.003 ms 10 Yes /classes/SpecificPrice.php:576
1025
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2639 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.002 ms 10 Yes /classes/SpecificPrice.php:576
661
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2764 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.999 ms 10 Yes /classes/SpecificPrice.php:576
1681
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3745 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3745 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.999 ms 0 /classes/Cart.php:1430
90
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `hgt78_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 185 LIMIT 1
0.998 ms 1 /classes/Category.php:1378
3234
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 10071 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.998 ms 10 Yes /classes/SpecificPrice.php:576
3972
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 5589) AND (b.`id_shop` = 1) LIMIT 1
0.998 ms 1 /src/Adapter/EntityMapper.php:71
4622
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3745) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.998 ms 1 Yes Yes /classes/Product.php:4524
505
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2770
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.997 ms 0 /classes/SpecificPrice.php:259
207
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 5145 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.996 ms 10 Yes /classes/SpecificPrice.php:576
2004
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4932
AND image_shop.`cover` = 1 LIMIT 1
0.996 ms 1 /classes/Product.php:3570
2498
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 6181 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.996 ms 10 Yes /classes/SpecificPrice.php:576
3993
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 5972) AND (b.`id_shop` = 1) LIMIT 1
0.996 ms 1 /src/Adapter/EntityMapper.php:71
377
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3741 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3741 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.995 ms 0 /classes/Cart.php:1430
409
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2893) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.995 ms 1 /classes/stock/StockAvailable.php:453
1660
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3639
ORDER BY f.position ASC
0.995 ms 5 Yes /classes/Product.php:6021
1869
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3771 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3771 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.995 ms 0 /classes/Cart.php:1430
1086
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2620
ORDER BY f.position ASC
0.995 ms 5 Yes /classes/Product.php:6021
2608
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 6192 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.995 ms 10 Yes /classes/SpecificPrice.php:576
3768
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2621) AND (b.`id_shop` = 1) LIMIT 1
0.995 ms 1 /src/Adapter/EntityMapper.php:71
3885
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3806) AND (b.`id_shop` = 1) LIMIT 1
0.995 ms 1 /src/Adapter/EntityMapper.php:71
890
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2792 LIMIT 1
0.994 ms 10 /classes/SpecificPrice.php:435
4256
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 10302) AND (b.`id_shop` = 1) LIMIT 1
0.994 ms 1 /src/Adapter/EntityMapper.php:71
1549
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3454 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3454 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.992 ms 0 /classes/Cart.php:1430
797
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2794) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.991 ms 1 /classes/stock/StockAvailable.php:453
3950
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 5282
0.990 ms 1 /classes/Product.php:2902
3941
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 5265
0.989 ms 1 /classes/Product.php:2902
650
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2738 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.988 ms 11 Yes /classes/SpecificPrice.php:576
1615
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3559 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3559 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.988 ms 0 /classes/Cart.php:1430
2958
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 9055
ORDER BY f.position ASC
0.988 ms 5 Yes /classes/Product.php:6021
4029
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 6178) AND (b.`id_shop` = 1) LIMIT 1
0.988 ms 1 /src/Adapter/EntityMapper.php:71
1797
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3756 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.987 ms 10 Yes /classes/SpecificPrice.php:576
3491
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2767
0.986 ms 1 /classes/Product.php:2902
4261
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 10303
0.986 ms 1 /classes/Product.php:2902
881
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2791 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.984 ms 10 Yes /classes/SpecificPrice.php:576
2355
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 6047 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.983 ms 10 Yes /classes/SpecificPrice.php:576
2901
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 8418 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 8418 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.983 ms 0 /classes/Cart.php:1430
1019
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2638 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2638 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.982 ms 0 /classes/Cart.php:1430
2432
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 6174 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.981 ms 10 Yes /classes/SpecificPrice.php:576
3957
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 5293) AND (b.`id_shop` = 1) LIMIT 1
0.981 ms 1 /src/Adapter/EntityMapper.php:71
3008
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 9325 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.980 ms 10 Yes /classes/SpecificPrice.php:576
3185
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 10067
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.980 ms 1 /classes/SpecificPrice.php:259
44
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 36) AND (b.`id_shop` = 1) LIMIT 1
0.979 ms 1 /src/Adapter/EntityMapper.php:71
229
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 5143 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.979 ms 10 Yes /classes/SpecificPrice.php:576
998
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2636
ORDER BY f.position ASC
0.978 ms 5 Yes /classes/Product.php:6021
2295
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 5774
AND image_shop.`cover` = 1 LIMIT 1
0.978 ms 1 /classes/Product.php:3570
4671
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (5335) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.977 ms 1 Yes Yes /classes/Product.php:4524
1339
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3252 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3252 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.977 ms 0 /classes/Cart.php:1430
4173
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 9324) AND (b.`id_shop` = 1) LIMIT 1
0.977 ms 1 /src/Adapter/EntityMapper.php:71
429
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2660)
0.976 ms 1 /classes/Product.php:3860
1577
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3556 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.976 ms 10 Yes /classes/SpecificPrice.php:576
4180
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 9535
ORDER BY `position`
0.976 ms 1 Yes /classes/Product.php:3545
99
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 7543 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.974 ms 9 Yes /classes/SpecificPrice.php:576
1742
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3751 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.974 ms 10 Yes /classes/SpecificPrice.php:576
3313
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 10302 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.973 ms 10 Yes /classes/SpecificPrice.php:576
3346
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 10305 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.973 ms 10 Yes /classes/SpecificPrice.php:576
2459
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 6177 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 6177 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.972 ms 0 /classes/Cart.php:1430
299
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 5137) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.971 ms 1 /classes/stock/StockAvailable.php:453
2381
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 6107) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.968 ms 1 /classes/stock/StockAvailable.php:453
3552
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2795) AND (b.`id_shop` = 1) LIMIT 1
0.968 ms 1 /src/Adapter/EntityMapper.php:71
3445
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5136
ORDER BY `position`
0.967 ms 1 Yes /classes/Product.php:3545
1905
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `hgt78_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 184 LIMIT 1
0.966 ms 1 /classes/Category.php:1378
119
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 7542)
0.966 ms 1 /classes/Product.php:3860
3858
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3764) AND (b.`id_shop` = 1) LIMIT 1
0.966 ms 1 /src/Adapter/EntityMapper.php:71
1003
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2637 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.964 ms 10 Yes /classes/SpecificPrice.php:576
2885
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 8417 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.964 ms 10 Yes /classes/SpecificPrice.php:576
2002
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4575 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4575 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.963 ms 0 /classes/Cart.php:1430
176
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 5148 AND id_shop=1 LIMIT 1
0.963 ms 1 /classes/Product.php:6876
1047
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2629 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.963 ms 10 Yes /classes/SpecificPrice.php:576
2031
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4935 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.963 ms 10 Yes /classes/SpecificPrice.php:576
2697
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 7940 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.963 ms 10 Yes /classes/SpecificPrice.php:576
3152
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 9694 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.963 ms 11 Yes /classes/SpecificPrice.php:576
1026
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2639)
0.962 ms 1 /classes/Product.php:3860
1891
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3776 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3776 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.960 ms 0 /classes/Cart.php:1430
4053
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 6186) AND (b.`id_shop` = 1) LIMIT 1
0.960 ms 1 /src/Adapter/EntityMapper.php:71
848
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2788 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.960 ms 10 Yes /classes/SpecificPrice.php:576
3990
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 5971) AND (b.`id_shop` = 1) LIMIT 1
0.959 ms 1 /src/Adapter/EntityMapper.php:71
461
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2623 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.959 ms 10 Yes /classes/SpecificPrice.php:576
4036
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 6180
ORDER BY `position`
0.958 ms 1 Yes /classes/Product.php:3545
836
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3179
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.957 ms 0 /classes/SpecificPrice.php:259
1626
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3584 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3584 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.957 ms 0 /classes/Cart.php:1430
2492
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 6180 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 6180 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.957 ms 0 /classes/Cart.php:1430
339
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 5133 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.955 ms 10 Yes /classes/SpecificPrice.php:576
2354
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 6047
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.955 ms 0 /classes/SpecificPrice.php:259
2652
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 6499 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.954 ms 10 Yes /classes/SpecificPrice.php:576
2266
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 5590 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.954 ms 10 Yes /classes/SpecificPrice.php:576
4176
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 9325) AND (b.`id_shop` = 1) LIMIT 1
0.954 ms 1 /src/Adapter/EntityMapper.php:71
997
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2636 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2636 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.952 ms 0 /classes/Cart.php:1430
3667
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2624
ORDER BY `position`
0.952 ms 1 Yes /classes/Product.php:3545
333
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 5134 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 5134 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.950 ms 0 /classes/Cart.php:1430
1533
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2654 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.950 ms 10 Yes /classes/SpecificPrice.php:576
2531
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 6184 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.949 ms 10 Yes /classes/SpecificPrice.php:576
483
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2768
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.947 ms 0 /classes/SpecificPrice.php:259
2299
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 5774 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.947 ms 10 Yes /classes/SpecificPrice.php:576
2641
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 6195 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.947 ms 10 Yes /classes/SpecificPrice.php:576
2975
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 9321 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.945 ms 10 Yes /classes/SpecificPrice.php:576
657
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2764
AND image_shop.`cover` = 1 LIMIT 1
0.944 ms 1 /classes/Product.php:3570
1997
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4575 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.944 ms 10 Yes /classes/SpecificPrice.php:576
1479
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3327)
0.943 ms 1 /classes/Product.php:3860
1108
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2622
ORDER BY f.position ASC
0.942 ms 5 Yes /classes/Product.php:6021
2941
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 8976)
0.942 ms 1 /classes/Product.php:3860
3324
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 10303 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.942 ms 10 Yes /classes/SpecificPrice.php:576
3780
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3454) AND (b.`id_shop` = 1) LIMIT 1
0.942 ms 1 /src/Adapter/EntityMapper.php:71
3966
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 5350) AND (b.`id_shop` = 1) LIMIT 1
0.942 ms 1 /src/Adapter/EntityMapper.php:71
558
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 182 LIMIT 1
0.941 ms 1 /classes/Product.php:5659
4606
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2621) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.941 ms 1 Yes Yes /classes/Product.php:4524
925
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2635 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.939 ms 10 Yes /classes/SpecificPrice.php:576
1601
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3558 AND id_shop=1 LIMIT 1
0.939 ms 1 /classes/Product.php:6876
4348
SELECT SQL_NO_CACHE c.*, cl.*
FROM `hgt78_category` c
INNER JOIN hgt78_category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1)
LEFT JOIN `hgt78_category_lang` cl ON c.`id_category` = cl.`id_category` AND cl.id_shop = 1 
LEFT JOIN `hgt78_category_group` cg ON c.`id_category` = cg.`id_category`
RIGHT JOIN `hgt78_category` c2 ON c2.`id_category` = 45 AND c.`nleft` >= c2.`nleft` AND c.`nright` <= c2.`nright`
WHERE 1  AND `id_lang` = 1
AND c.`active` = 1
AND cg.`id_group` IN (1)
GROUP BY c.`id_category`
ORDER BY c.`level_depth` ASC
, category_shop.`position` ASC
0.939 ms 8 Yes Yes /classes/Category.php:799
1020
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2638
ORDER BY f.position ASC
0.938 ms 5 Yes /classes/Product.php:6021
870
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2790 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.937 ms 10 Yes /classes/SpecificPrice.php:576
2944
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 8976) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.937 ms 1 /classes/stock/StockAvailable.php:453
1326
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2645) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.935 ms 1 /classes/stock/StockAvailable.php:453
3052
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 9598 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.934 ms 10 Yes /classes/SpecificPrice.php:576
267
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 5140 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 5140 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.933 ms 0 /classes/Cart.php:1430
901
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3177 LIMIT 1
0.932 ms 10 /classes/SpecificPrice.php:435
2332
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 5972 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.932 ms 10 Yes /classes/SpecificPrice.php:576
572
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2765 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.931 ms 10 Yes /classes/SpecificPrice.php:576
2997
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 9324 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.931 ms 10 Yes /classes/SpecificPrice.php:576
3511
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2776
ORDER BY `position`
0.931 ms 1 Yes /classes/Product.php:3545
1365
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3256 LIMIT 1
0.931 ms 10 /classes/SpecificPrice.php:435
3894
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3936) AND (b.`id_shop` = 1) LIMIT 1
0.931 ms 1 /src/Adapter/EntityMapper.php:71
426
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2660 LIMIT 1
0.930 ms 10 /classes/SpecificPrice.php:435
1180
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2641)
0.930 ms 1 /classes/Product.php:3860
3450
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 5134) AND (b.`id_shop` = 1) LIMIT 1
0.929 ms 1 /src/Adapter/EntityMapper.php:71
1864
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3771 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.929 ms 10 Yes /classes/SpecificPrice.php:576
4597
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3326) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.928 ms 1 Yes Yes /classes/Product.php:4524
521
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2773) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.927 ms 1 /classes/stock/StockAvailable.php:453
1090
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3459
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.927 ms 0 /classes/SpecificPrice.php:259
3075
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 9686 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.927 ms 11 Yes /classes/SpecificPrice.php:576
2134
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 5265 AND id_shop=1 LIMIT 1
0.926 ms 1 /classes/Product.php:6876
2564
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 6187 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.926 ms 10 Yes /classes/SpecificPrice.php:576
3732
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3256) AND (b.`id_shop` = 1) LIMIT 1
0.926 ms 1 /src/Adapter/EntityMapper.php:71
1643
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3586 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.924 ms 10 Yes /classes/SpecificPrice.php:576
2455
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 6177)
0.924 ms 1 /classes/Product.php:3860
202
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 5146
ORDER BY f.position ASC
0.923 ms 5 Yes /classes/Product.php:6021
1075
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3477
ORDER BY f.position ASC
0.923 ms 5 Yes /classes/Product.php:6021
4038
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 6181) AND (b.`id_shop` = 1) LIMIT 1
0.923 ms 1 /src/Adapter/EntityMapper.php:71
710
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2795 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2795 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.922 ms 0 /classes/Cart.php:1430
2076
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4962 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.922 ms 10 Yes /classes/SpecificPrice.php:576
4050
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 6185) AND (b.`id_shop` = 1) LIMIT 1
0.922 ms 1 /src/Adapter/EntityMapper.php:71
4623
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3746) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.922 ms 1 Yes Yes /classes/Product.php:4524
1284
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2642
ORDER BY f.position ASC
0.921 ms 5 Yes /classes/Product.php:6021
4361
SELECT SQL_NO_CACHE c.*, cl.*
FROM `hgt78_category` c
INNER JOIN hgt78_category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1)
LEFT JOIN `hgt78_category_lang` cl ON c.`id_category` = cl.`id_category` AND cl.id_shop = 1 
LEFT JOIN `hgt78_category_group` cg ON c.`id_category` = cg.`id_category`
RIGHT JOIN `hgt78_category` c2 ON c2.`id_category` = 78 AND c.`nleft` >= c2.`nleft` AND c.`nright` <= c2.`nright`
WHERE 1  AND `id_lang` = 1
AND c.`active` = 1
AND cg.`id_group` IN (1)
GROUP BY c.`id_category`
ORDER BY c.`level_depth` ASC
, category_shop.`position` ASC
0.920 ms 12 Yes Yes /classes/Category.php:799
2735
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 7943 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 7943 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.919 ms 0 /classes/Cart.php:1430
3280
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 10297 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.919 ms 10 Yes /classes/SpecificPrice.php:576
3369
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 12551 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.919 ms 11 Yes /classes/SpecificPrice.php:576
2465
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 6178 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.917 ms 10 Yes /classes/SpecificPrice.php:576
4624
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3747) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.915 ms 1 Yes Yes /classes/Product.php:4524
293
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 5137 LIMIT 1
0.914 ms 10 /classes/SpecificPrice.php:435
2674
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 6501 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.914 ms 10 Yes /classes/SpecificPrice.php:576
3855
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3763) AND (b.`id_shop` = 1) LIMIT 1
0.914 ms 1 /src/Adapter/EntityMapper.php:71
1632
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3585 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.912 ms 10 Yes /classes/SpecificPrice.php:576
2553
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 6186 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.912 ms 10 Yes /classes/SpecificPrice.php:576
1753
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3752 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.910 ms 10 Yes /classes/SpecificPrice.php:576
2114
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4965 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4965 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.910 ms 0 /classes/Cart.php:1430
3174
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 9697 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.910 ms 11 Yes /classes/SpecificPrice.php:576
4204
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 9690
0.910 ms 1 /classes/Product.php:2902
1181
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2641 AND id_shop=1 LIMIT 1
0.910 ms 1 /classes/Product.php:6876
2940
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 8976 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.909 ms 16 Yes /classes/SpecificPrice.php:576
4719
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (7945) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.908 ms 1 Yes Yes /classes/Product.php:4524
2808
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 8392 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.908 ms 10 Yes /classes/SpecificPrice.php:576
146
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 7540
ORDER BY f.position ASC
0.907 ms 5 Yes /classes/Product.php:6021
2775
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 7769 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.906 ms 10 Yes /classes/SpecificPrice.php:576
4235
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 10071) AND (b.`id_shop` = 1) LIMIT 1
0.906 ms 1 /src/Adapter/EntityMapper.php:71
1964
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3936 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.905 ms 10 Yes /classes/SpecificPrice.php:576
4367
SELECT SQL_NO_CACHE c.*, cl.*
FROM `hgt78_category` c
INNER JOIN hgt78_category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1)
LEFT JOIN `hgt78_category_lang` cl ON c.`id_category` = cl.`id_category` AND cl.id_shop = 1 
LEFT JOIN `hgt78_category_group` cg ON c.`id_category` = cg.`id_category`
RIGHT JOIN `hgt78_category` c2 ON c2.`id_category` = 200 AND c.`nleft` >= c2.`nleft` AND c.`nright` <= c2.`nright`
WHERE 1  AND `id_lang` = 1
AND c.`active` = 1
AND cg.`id_group` IN (1)
GROUP BY c.`id_category`
ORDER BY c.`level_depth` ASC
, category_shop.`position` ASC
0.905 ms 14 Yes Yes /classes/Category.php:799
610
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2691 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2691 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.905 ms 0 /classes/Cart.php:1430
1522
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2650 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.904 ms 10 Yes /classes/SpecificPrice.php:576
2852
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 8396 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.904 ms 10 Yes /classes/SpecificPrice.php:576
3784
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3455
ORDER BY `position`
0.903 ms 1 Yes /classes/Product.php:3545
3130
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 9692 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.902 ms 11 Yes /classes/SpecificPrice.php:576
3198
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 10068 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.902 ms 10 Yes /classes/SpecificPrice.php:576
118
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 7542 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.901 ms 10 Yes /classes/SpecificPrice.php:576
3064
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 9687 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.901 ms 11 Yes /classes/SpecificPrice.php:576
3086
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 9688 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.901 ms 11 Yes /classes/SpecificPrice.php:576
4042
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 6182
ORDER BY `position`
0.901 ms 1 Yes /classes/Product.php:3545
950
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2632 AND `id_group` = 1 LIMIT 1
0.900 ms 0 /classes/GroupReduction.php:156
1445
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3099 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.900 ms 10 Yes /classes/SpecificPrice.php:576
397
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3587 AND `id_group` = 1 LIMIT 1
0.899 ms 0 /classes/GroupReduction.php:156
3019
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 9535 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.899 ms 10 Yes /classes/SpecificPrice.php:576
3774
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2650) AND (b.`id_shop` = 1) LIMIT 1
0.899 ms 1 /src/Adapter/EntityMapper.php:71
3951
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 5283) AND (b.`id_shop` = 1) LIMIT 1
0.898 ms 1 /src/Adapter/EntityMapper.php:71
3302
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 10299 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.897 ms 10 Yes /classes/SpecificPrice.php:576
2757
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 7945 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 7945 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.897 ms 0 /classes/Cart.php:1430
3783
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3455) AND (b.`id_shop` = 1) LIMIT 1
0.897 ms 1 /src/Adapter/EntityMapper.php:71
2288
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 5592 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.896 ms 10 Yes /classes/SpecificPrice.php:576
2520
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 6183 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.896 ms 10 Yes /classes/SpecificPrice.php:576
4669
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (5293) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.896 ms 1 Yes Yes /classes/Product.php:4524
634
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2771
AND image_shop.`cover` = 1 LIMIT 1
0.895 ms 2 /classes/Product.php:3570
2686
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 7938 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.895 ms 10 Yes /classes/SpecificPrice.php:576
2386
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 6108 LIMIT 1
0.894 ms 10 /classes/SpecificPrice.php:435
666
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2764 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2764 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.893 ms 0 /classes/Cart.php:1430
4674
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (5589) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.893 ms 1 Yes Yes /classes/Product.php:4524
1312
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2644)
0.893 ms 1 /classes/Product.php:3860
1516
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2733 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2733 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.893 ms 0 /classes/Cart.php:1430
2448
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 6176 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 6176 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.893 ms 0 /classes/Cart.php:1430
2740
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 7944
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.893 ms 0 /classes/SpecificPrice.php:259
4179
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 9535) AND (b.`id_shop` = 1) LIMIT 1
0.893 ms 1 /src/Adapter/EntityMapper.php:71
4035
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 6180) AND (b.`id_shop` = 1) LIMIT 1
0.892 ms 1 /src/Adapter/EntityMapper.php:71
4461
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 47 AND `id_shop` = 1
0.892 ms 6 /src/Adapter/EntityMapper.php:79
3141
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 9693 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.892 ms 11 Yes /classes/SpecificPrice.php:576
4354
SELECT SQL_NO_CACHE c.*, cl.*
FROM `hgt78_category` c
INNER JOIN hgt78_category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1)
LEFT JOIN `hgt78_category_lang` cl ON c.`id_category` = cl.`id_category` AND cl.id_shop = 1 
LEFT JOIN `hgt78_category_group` cg ON c.`id_category` = cg.`id_category`
RIGHT JOIN `hgt78_category` c2 ON c2.`id_category` = 54 AND c.`nleft` >= c2.`nleft` AND c.`nright` <= c2.`nright`
WHERE 1  AND `id_lang` = 1
AND c.`active` = 1
AND cg.`id_group` IN (1)
GROUP BY c.`id_category`
ORDER BY c.`level_depth` ASC
, category_shop.`position` ASC
0.891 ms 10 Yes Yes /classes/Category.php:799
2337
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 5972 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 5972 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.890 ms 0 /classes/Cart.php:1430
2054
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4943 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.889 ms 10 Yes /classes/SpecificPrice.php:576
2243
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 5093 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.889 ms 9 Yes /classes/SpecificPrice.php:576
4561
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2637) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.889 ms 1 Yes Yes /classes/Product.php:4524
2343
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 5973 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.889 ms 10 Yes /classes/SpecificPrice.php:576
2863
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 8397 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.889 ms 10 Yes /classes/SpecificPrice.php:576
511
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2770 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2770 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.888 ms 0 /classes/Cart.php:1430
1892
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3776
ORDER BY f.position ASC
0.888 ms 5 Yes /classes/Product.php:6021
2103
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4964 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4964 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.888 ms 0 /classes/Cart.php:1430
2841
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 8395 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.888 ms 10 Yes /classes/SpecificPrice.php:576
1920
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3805 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.888 ms 10 Yes /classes/SpecificPrice.php:576
1008
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2637 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2637 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.887 ms 0 /classes/Cart.php:1430
2663
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 6500 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.887 ms 10 Yes /classes/SpecificPrice.php:576
3358
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 12552 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.887 ms 11 Yes /classes/SpecificPrice.php:576
317
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 5135 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.886 ms 10 Yes /classes/SpecificPrice.php:576
4190
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 9687) AND (b.`id_shop` = 1) LIMIT 1
0.886 ms 1 /src/Adapter/EntityMapper.php:71
1887
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3776)
0.885 ms 1 /classes/Product.php:3860
2730
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 7943 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.884 ms 10 Yes /classes/SpecificPrice.php:576
4198
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 9688
0.883 ms 1 /classes/Product.php:2902
2277
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 5591 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.882 ms 10 Yes /classes/SpecificPrice.php:576
1610
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3559 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.880 ms 10 Yes /classes/SpecificPrice.php:576
2065
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4944 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.879 ms 10 Yes /classes/SpecificPrice.php:576
886
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2791 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2791 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.879 ms 0 /classes/Cart.php:1430
1294
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2643 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2643 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.878 ms 0 /classes/Cart.php:1430
3725
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3252
0.878 ms 1 /classes/Product.php:2902
4381
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 192) LIMIT 1
0.878 ms 1 /src/Adapter/EntityMapper.php:71
3801
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3584) AND (b.`id_shop` = 1) LIMIT 1
0.877 ms 1 /src/Adapter/EntityMapper.php:71
1808
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3757 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.877 ms 10 Yes /classes/SpecificPrice.php:576
2874
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 8401 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.877 ms 10 Yes /classes/SpecificPrice.php:576
3215
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 10069 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 10069 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.877 ms 0 /classes/Cart.php:1430
1787
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3755)
0.876 ms 1 /classes/Product.php:3860
2509
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 6182 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.876 ms 10 Yes /classes/SpecificPrice.php:576
4054
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 6186
ORDER BY `position`
0.876 ms 1 Yes /classes/Product.php:3545
4385
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 37) AND (b.`id_shop` = 1) LIMIT 1
0.876 ms 1 /src/Adapter/EntityMapper.php:71
36
SELECT SQL_NO_CACHE *
FROM `hgt78_group_lang`
WHERE `id_group` = 1
0.875 ms 6 /src/Adapter/EntityMapper.php:79
1456
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3107 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.875 ms 10 Yes /classes/SpecificPrice.php:576
2824
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 8393 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 8393 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.874 ms 0 /classes/Cart.php:1430
4691
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (6176) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.874 ms 1 Yes Yes /classes/Product.php:4524
1121
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 182 LIMIT 1
0.873 ms 1 /classes/Product.php:5659
3163
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 9695 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.873 ms 11 Yes /classes/SpecificPrice.php:576
2347
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 5973) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.872 ms 1 /classes/stock/StockAvailable.php:453
1847
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3765 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3765 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.870 ms 0 /classes/Cart.php:1430
1227
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3456) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.869 ms 1 /classes/stock/StockAvailable.php:453
3687
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2648) AND (b.`id_shop` = 1) LIMIT 1
0.869 ms 1 /src/Adapter/EntityMapper.php:71
3852
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3757) AND (b.`id_shop` = 1) LIMIT 1
0.869 ms 1 /src/Adapter/EntityMapper.php:71
324
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 5134
AND image_shop.`cover` = 1 LIMIT 1
0.869 ms 1 /classes/Product.php:3570
1379
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3264)
0.868 ms 1 /classes/Product.php:3860
4612
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3484) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.868 ms 1 Yes Yes /classes/Product.php:4524
2797
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 7773 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.867 ms 10 Yes /classes/SpecificPrice.php:576
3291
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 10298 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.867 ms 10 Yes /classes/SpecificPrice.php:576
352
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4902 AND id_shop=1 LIMIT 1
0.866 ms 1 /classes/Product.php:6876
416
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2694 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.866 ms 10 Yes /classes/SpecificPrice.php:576
3104
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 9690
AND image_shop.`cover` = 1 LIMIT 1
0.866 ms 1 /classes/Product.php:3570
3108
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 9690 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.866 ms 11 Yes /classes/SpecificPrice.php:576
1261
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2647 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2647 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.865 ms 0 /classes/Cart.php:1430
2176
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 5283 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.865 ms 9 Yes /classes/SpecificPrice.php:576
2410
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 6172 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.865 ms 10 Yes /classes/SpecificPrice.php:576
73
SELECT SQL_NO_CACHE `name`
FROM `hgt78_hook`
WHERE `id_hook` = 746 LIMIT 1
0.864 ms 1 /classes/Hook.php:247
1853
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3766 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.864 ms 11 Yes /classes/SpecificPrice.php:576
3380
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 11001 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.864 ms 10 Yes /classes/SpecificPrice.php:576
4587
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2643) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.864 ms 1 Yes Yes /classes/Product.php:4524
4727
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (8395) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.863 ms 1 Yes Yes /classes/Product.php:4524
3786
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3484) AND (b.`id_shop` = 1) LIMIT 1
0.863 ms 1 /src/Adapter/EntityMapper.php:71
126
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 185 LIMIT 1
0.862 ms 1 /classes/Product.php:5659
2819
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 8393 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.862 ms 10 Yes /classes/SpecificPrice.php:576
3408
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 5147) AND (b.`id_shop` = 1) LIMIT 1
0.862 ms 1 /src/Adapter/EntityMapper.php:71
3864
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3766) AND (b.`id_shop` = 1) LIMIT 1
0.862 ms 1 /src/Adapter/EntityMapper.php:71
2043
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4942 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.861 ms 10 Yes /classes/SpecificPrice.php:576
3307
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 10299 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 10299 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.861 ms 0 /classes/Cart.php:1430
4616
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3559) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.861 ms 1 Yes Yes /classes/Product.php:4524
4625
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3748) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.861 ms 1 Yes Yes /classes/Product.php:4524
522
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2773 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2773 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.860 ms 0 /classes/Cart.php:1430
310
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 5136) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.860 ms 1 /classes/stock/StockAvailable.php:453
1221
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3456 LIMIT 1
0.860 ms 10 /classes/SpecificPrice.php:435
3258
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 10073 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.860 ms 10 Yes /classes/SpecificPrice.php:576
1223
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3456 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.859 ms 10 Yes /classes/SpecificPrice.php:576
3891
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3808) AND (b.`id_shop` = 1) LIMIT 1
0.858 ms 1 /src/Adapter/EntityMapper.php:71
4141
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 8401
ORDER BY `position`
0.858 ms 1 Yes /classes/Product.php:3545
3146
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 9693 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 9693 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.857 ms 0 /classes/Cart.php:1430
4197
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 9688
ORDER BY `position`
0.857 ms 1 Yes /classes/Product.php:3545
4205
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 9691) AND (b.`id_shop` = 1) LIMIT 1
0.857 ms 1 /src/Adapter/EntityMapper.php:71
1913
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3804) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.857 ms 1 /classes/stock/StockAvailable.php:453
2232
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 5350 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.856 ms 10 Yes /classes/SpecificPrice.php:576
4636
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3764) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.856 ms 1 Yes Yes /classes/Product.php:4524
2187
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 5284 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.855 ms 9 Yes /classes/SpecificPrice.php:576
3879
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3804) AND (b.`id_shop` = 1) LIMIT 1
0.854 ms 1 /src/Adapter/EntityMapper.php:71
4389
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 48) LIMIT 1
0.853 ms 1 /src/Adapter/EntityMapper.php:71
1536
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2654 AND `id_group` = 1 LIMIT 1
0.853 ms 0 /classes/GroupReduction.php:156
1925
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3805 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3805 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.853 ms 0 /classes/Cart.php:1430
500
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2769 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2769 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.852 ms 0 /classes/Cart.php:1430
1401
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3326)
0.852 ms 1 /classes/Product.php:3860
1836
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3764 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3764 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.852 ms 0 /classes/Cart.php:1430
2542
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 6185 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.852 ms 10 Yes /classes/SpecificPrice.php:576
1596
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.852 ms 1 /classes/Product.php:5659
3804
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3585) AND (b.`id_shop` = 1) LIMIT 1
0.852 ms 1 /src/Adapter/EntityMapper.php:71
4351
SELECT SQL_NO_CACHE c.*, cl.*
FROM `hgt78_category` c
INNER JOIN hgt78_category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1)
LEFT JOIN `hgt78_category_lang` cl ON c.`id_category` = cl.`id_category` AND cl.id_shop = 1 
LEFT JOIN `hgt78_category_group` cg ON c.`id_category` = cg.`id_category`
RIGHT JOIN `hgt78_category` c2 ON c2.`id_category` = 46 AND c.`nleft` >= c2.`nleft` AND c.`nright` <= c2.`nright`
WHERE 1  AND `id_lang` = 1
AND c.`active` = 1
AND cg.`id_group` IN (1)
GROUP BY c.`id_category`
ORDER BY c.`level_depth` ASC
, category_shop.`position` ASC
0.852 ms 9 Yes Yes /classes/Category.php:799
4399
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 162) LIMIT 1
0.852 ms 1 /src/Adapter/EntityMapper.php:71
167
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 6727 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 6727 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.850 ms 0 /classes/Cart.php:1430
57
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 18) AND (b.`id_shop` = 1) LIMIT 1
0.850 ms 1 /src/Adapter/EntityMapper.php:71
470
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 182 LIMIT 1
0.850 ms 1 /classes/Product.php:5659
594
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2690 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.849 ms 10 Yes /classes/SpecificPrice.php:576
1096
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3459 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3459 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.849 ms 0 /classes/Cart.php:1430
2209
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 5296 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.849 ms 11 Yes /classes/SpecificPrice.php:576
717
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2797)
0.847 ms 1 /classes/Product.php:3860
1361
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3255 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3255 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.847 ms 0 /classes/Cart.php:1430
1404
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3326) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.847 ms 1 /classes/stock/StockAvailable.php:453
376
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3741) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.847 ms 1 /classes/stock/StockAvailable.php:453
1947
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3807 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3807 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.846 ms 0 /classes/Cart.php:1430
3222
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 10070 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.846 ms 10 Yes /classes/SpecificPrice.php:576
4649
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4256) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.846 ms 1 Yes Yes /classes/Product.php:4524
257
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 5141
ORDER BY f.position ASC
0.845 ms 5 Yes /classes/Product.php:6021
2857
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 8396 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 8396 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.845 ms 0 /classes/Cart.php:1430
1222
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3456
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.844 ms 0 /classes/SpecificPrice.php:259
842
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3179 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3179 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.842 ms 0 /classes/Cart.php:1430
3659
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3459
0.842 ms 1 /classes/Product.php:2902
3777
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2654) AND (b.`id_shop` = 1) LIMIT 1
0.842 ms 1 /src/Adapter/EntityMapper.php:71
932
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2631
AND image_shop.`cover` = 1 LIMIT 1
0.842 ms 1 /classes/Product.php:3570
1134
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2625
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.842 ms 0 /classes/SpecificPrice.php:259
2934
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 8975 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 8975 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.842 ms 0 /classes/Cart.php:1430
4728
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (8396) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.840 ms 1 Yes Yes /classes/Product.php:4524
3690
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2657) AND (b.`id_shop` = 1) LIMIT 1
0.840 ms 1 /src/Adapter/EntityMapper.php:71
3918
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4943) AND (b.`id_shop` = 1) LIMIT 1
0.840 ms 1 /src/Adapter/EntityMapper.php:71
1764
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3753 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.839 ms 10 Yes /classes/SpecificPrice.php:576
4059
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 6188) AND (b.`id_shop` = 1) LIMIT 1
0.839 ms 1 /src/Adapter/EntityMapper.php:71
4690
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (6174) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.838 ms 1 Yes Yes /classes/Product.php:4524
2125
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4966 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4966 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.838 ms 0 /classes/Cart.php:1430
3763
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3327
ORDER BY `position`
0.838 ms 2 Yes /classes/Product.php:3545
588
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2661 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2661 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.837 ms 0 /classes/Cart.php:1430
3924
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4962) AND (b.`id_shop` = 1) LIMIT 1
0.837 ms 1 /src/Adapter/EntityMapper.php:71
4164
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 9306) AND (b.`id_shop` = 1) LIMIT 1
0.837 ms 1 /src/Adapter/EntityMapper.php:71
630
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2693 AND `id_group` = 1 LIMIT 1
0.836 ms 0 /classes/GroupReduction.php:156
2930
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 8975)
0.836 ms 1 /classes/Product.php:3860
3269
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 10111 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.836 ms 11 Yes /classes/SpecificPrice.php:576
804
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2793 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.836 ms 10 Yes /classes/SpecificPrice.php:576
3041
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 9597 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.836 ms 11 Yes /classes/SpecificPrice.php:576
4714
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (7940) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.835 ms 1 Yes Yes /classes/Product.php:4524
4020
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 6174) AND (b.`id_shop` = 1) LIMIT 1
0.835 ms 1 /src/Adapter/EntityMapper.php:71
833
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3179
AND image_shop.`cover` = 1 LIMIT 1
0.834 ms 1 /classes/Product.php:3570
1383
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3264 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3264 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.834 ms 0 /classes/Cart.php:1430
3900
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4574) AND (b.`id_shop` = 1) LIMIT 1
0.834 ms 1 /src/Adapter/EntityMapper.php:71
4155
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 8975) AND (b.`id_shop` = 1) LIMIT 1
0.834 ms 1 /src/Adapter/EntityMapper.php:71
2503
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 6181 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 6181 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.833 ms 0 /classes/Cart.php:1430
2536
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 6184 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 6184 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.833 ms 0 /classes/Cart.php:1430
4063
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 6189
ORDER BY `position`
0.833 ms 1 Yes /classes/Product.php:3545
4187
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 9597
0.833 ms 1 /classes/Product.php:2902
175
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 5148)
0.833 ms 1 /classes/Product.php:3860
590
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2690
AND image_shop.`cover` = 1 LIMIT 1
0.832 ms 1 /classes/Product.php:3570
4620
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3639) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.832 ms 1 Yes Yes /classes/Product.php:4524
3826
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3748
ORDER BY `position`
0.832 ms 1 Yes /classes/Product.php:3545
3999
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 6047) AND (b.`id_shop` = 1) LIMIT 1
0.831 ms 1 /src/Adapter/EntityMapper.php:71
4045
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 6183
ORDER BY `position`
0.831 ms 1 Yes /classes/Product.php:3545
1467
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3132 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.830 ms 10 Yes /classes/SpecificPrice.php:576
2786
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 7779 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.830 ms 10 Yes /classes/SpecificPrice.php:576
411
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2893
ORDER BY f.position ASC
0.829 ms 5 Yes /classes/Product.php:6021
3727
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3254
ORDER BY `position`
0.829 ms 1 Yes /classes/Product.php:3545
2636
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 6194
ORDER BY f.position ASC
0.828 ms 5 Yes /classes/Product.php:6021
680
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 182 LIMIT 1
0.827 ms 1 /classes/Product.php:5659
3210
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 10069 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.827 ms 10 Yes /classes/SpecificPrice.php:576
4670
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (5296) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.827 ms 1 Yes Yes /classes/Product.php:4524
1190
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2656 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.826 ms 10 Yes /classes/SpecificPrice.php:576
425
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.826 ms 1 /classes/Product.php:5659
4419
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 35) AND (b.`id_shop` = 1) LIMIT 1
0.825 ms 1 /src/Adapter/EntityMapper.php:71
1272
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2646 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2646 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.824 ms 0 /classes/Cart.php:1430
930
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2635 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2635 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.824 ms 0 /classes/Cart.php:1430
4191
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 9687
ORDER BY `position`
0.824 ms 1 Yes /classes/Product.php:3545
0
SELECT SQL_NO_CACHE s.id_shop, CONCAT(su.physical_uri, su.virtual_uri) AS uri, su.domain, su.main
FROM hgt78_shop_url su
LEFT JOIN hgt78_shop s ON (s.id_shop = su.id_shop)
WHERE (su.domain = 'www.encens.fr' OR su.domain_ssl = 'www.encens.fr')
AND s.active = 1
AND s.deleted = 0
ORDER BY LENGTH(CONCAT(su.physical_uri, su.virtual_uri)) DESC
0.823 ms 1 Yes /classes/shop/Shop.php:1364
566
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2766 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2766 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.823 ms 0 /classes/Cart.php:1430
2255
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 5589 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.823 ms 10 Yes /classes/SpecificPrice.php:576
3239
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 10071 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 10071 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.823 ms 0 /classes/Cart.php:1430
4068
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 6192) AND (b.`id_shop` = 1) LIMIT 1
0.823 ms 1 /src/Adapter/EntityMapper.php:71
4128
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 8394) AND (b.`id_shop` = 1) LIMIT 1
0.823 ms 1 /src/Adapter/EntityMapper.php:71
1262
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2647
ORDER BY f.position ASC
0.822 ms 5 Yes /classes/Product.php:6021
4006
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 6107
ORDER BY `position`
0.821 ms 1 Yes /classes/Product.php:3545
1311
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2644 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.821 ms 10 Yes /classes/SpecificPrice.php:576
3762
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3327) AND (b.`id_shop` = 1) LIMIT 1
0.821 ms 1 /src/Adapter/EntityMapper.php:71
2348
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 5973 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 5973 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.820 ms 0 /classes/Cart.php:1430
1295
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2643
ORDER BY f.position ASC
0.819 ms 5 Yes /classes/Product.php:6021
2198
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 5293 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.819 ms 10 Yes /classes/SpecificPrice.php:576
2986
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 9323 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.819 ms 10 Yes /classes/SpecificPrice.php:576
2020
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4934 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.818 ms 10 Yes /classes/SpecificPrice.php:576
1582
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3556 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3556 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.817 ms 0 /classes/Cart.php:1430
3227
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 10070 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 10070 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.816 ms 0 /classes/Cart.php:1430
3859
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3764
ORDER BY `position`
0.815 ms 1 Yes /classes/Product.php:3545
120
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 7542 AND id_shop=1 LIMIT 1
0.813 ms 1 /classes/Product.php:6876
450
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2651 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.813 ms 10 Yes /classes/SpecificPrice.php:576
3119
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 9691 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.812 ms 11 Yes /classes/SpecificPrice.php:576
3251
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 10072 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 10072 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.812 ms 0 /classes/Cart.php:1430
820
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2780 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2780 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.811 ms 0 /classes/Cart.php:1430
3813
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3689) AND (b.`id_shop` = 1) LIMIT 1
0.811 ms 1 /src/Adapter/EntityMapper.php:71
398
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3587) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.810 ms 1 /classes/stock/StockAvailable.php:453
3789
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3556) AND (b.`id_shop` = 1) LIMIT 1
0.810 ms 1 /src/Adapter/EntityMapper.php:71
142
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 7540 AND id_shop=1 LIMIT 1
0.809 ms 1 /classes/Product.php:6876
2969
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 9306
ORDER BY f.position ASC
0.809 ms 5 Yes /classes/Product.php:6021
3246
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 10072 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.808 ms 10 Yes /classes/SpecificPrice.php:576
141
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 7540)
0.807 ms 1 /classes/Product.php:3860
1986
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4574 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.807 ms 10 Yes /classes/SpecificPrice.php:576
3597
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2790) AND (b.`id_shop` = 1) LIMIT 1
0.806 ms 1 /src/Adapter/EntityMapper.php:71
4250
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 10298) AND (b.`id_shop` = 1) LIMIT 1
0.806 ms 1 /src/Adapter/EntityMapper.php:71
4271
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 12551) AND (b.`id_shop` = 1) LIMIT 1
0.806 ms 1 /src/Adapter/EntityMapper.php:71
371
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3741
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.806 ms 0 /classes/SpecificPrice.php:259
1571
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3484 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3484 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.806 ms 0 /classes/Cart.php:1430
3742
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3326
ORDER BY `position`
0.805 ms 2 Yes /classes/Product.php:3545
3744
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3155) AND (b.`id_shop` = 1) LIMIT 1
0.804 ms 1 /src/Adapter/EntityMapper.php:71
2879
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 8401 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 8401 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.804 ms 0 /classes/Cart.php:1430
4238
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 10072) AND (b.`id_shop` = 1) LIMIT 1
0.804 ms 1 /src/Adapter/EntityMapper.php:71
3787
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3484
ORDER BY `position`
0.803 ms 1 Yes /classes/Product.php:3545
4188
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 9598) AND (b.`id_shop` = 1) LIMIT 1
0.803 ms 1 /src/Adapter/EntityMapper.php:71
1345
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3254 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.802 ms 10 Yes /classes/SpecificPrice.php:576
2282
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 5591 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 5591 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.802 ms 0 /classes/Cart.php:1430
2493
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 6180
ORDER BY f.position ASC
0.802 ms 5 Yes /classes/Product.php:6021
4676
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (5591) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.802 ms 1 Yes Yes /classes/Product.php:4524
4747
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (9687) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.802 ms 1 Yes Yes /classes/Product.php:4524
278
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 5139 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 5139 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.801 ms 0 /classes/Cart.php:1430
3870
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3775) AND (b.`id_shop` = 1) LIMIT 1
0.801 ms 1 /src/Adapter/EntityMapper.php:71
1670
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3689 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3689 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.800 ms 0 /classes/Cart.php:1430
18
SELECT SQL_NO_CACHE name, alias FROM `hgt78_hook_alias`
0.799 ms 88 /classes/Hook.php:342
1726
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3749
ORDER BY f.position ASC
0.797 ms 5 Yes /classes/Product.php:6021
1858
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3766 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3766 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.796 ms 0 /classes/Cart.php:1430
3102
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 9689 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 9689 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.796 ms 0 /classes/Cart.php:1430
3897
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4256) AND (b.`id_shop` = 1) LIMIT 1
0.796 ms 1 /src/Adapter/EntityMapper.php:71
3792
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3557) AND (b.`id_shop` = 1) LIMIT 1
0.795 ms 1 /src/Adapter/EntityMapper.php:71
4632
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3755) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.795 ms 1 Yes Yes /classes/Product.php:4524
813
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2780 LIMIT 1
0.795 ms 10 /classes/SpecificPrice.php:435
1100
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2622 LIMIT 1
0.794 ms 10 /classes/SpecificPrice.php:435
1594
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3557
ORDER BY f.position ASC
0.794 ms 5 Yes /classes/Product.php:6021
4125
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 8393) AND (b.`id_shop` = 1) LIMIT 1
0.794 ms 1 /src/Adapter/EntityMapper.php:71
3603
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2792) AND (b.`id_shop` = 1) LIMIT 1
0.793 ms 1 /src/Adapter/EntityMapper.php:71
134
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 7541 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 7541 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.793 ms 0 /classes/Cart.php:1430
1030
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2639 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2639 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.793 ms 0 /classes/Cart.php:1430
3930
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4964) AND (b.`id_shop` = 1) LIMIT 1
0.793 ms 1 /src/Adapter/EntityMapper.php:71
1250
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2658 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2658 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.792 ms 0 /classes/Cart.php:1430
2009
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4932 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.792 ms 10 Yes /classes/SpecificPrice.php:576
2092
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4963 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4963 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.792 ms 0 /classes/Cart.php:1430
3730
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3255
ORDER BY `position`
0.792 ms 1 Yes /classes/Product.php:3545
4688
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (6172) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.792 ms 1 Yes Yes /classes/Product.php:4524
644
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2771
ORDER BY f.position ASC
0.791 ms 5 Yes /classes/Product.php:6021
4380
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 56 AND `id_shop` = 1
0.791 ms 6 /src/Adapter/EntityMapper.php:79
4679
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (5970) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.791 ms 1 Yes Yes /classes/Product.php:4524
3399
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 7539) AND (b.`id_shop` = 1) LIMIT 1
0.791 ms 1 /src/Adapter/EntityMapper.php:71
3948
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 5282) AND (b.`id_shop` = 1) LIMIT 1
0.791 ms 1 /src/Adapter/EntityMapper.php:71
4232
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 10070) AND (b.`id_shop` = 1) LIMIT 1
0.791 ms 1 /src/Adapter/EntityMapper.php:71
153
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 7539 AND id_shop=1 LIMIT 1
0.790 ms 1 /classes/Product.php:6876
1926
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3805
ORDER BY f.position ASC
0.789 ms 5 Yes /classes/Product.php:6021
125
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 7541
AND image_shop.`cover` = 1 LIMIT 1
0.789 ms 1 /classes/Product.php:3570
3998
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 5973
0.789 ms 1 /classes/Product.php:2902
3735
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3264) AND (b.`id_shop` = 1) LIMIT 1
0.788 ms 1 /src/Adapter/EntityMapper.php:71
3002
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 9324 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 9324 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.787 ms 0 /classes/Cart.php:1430
3385
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 11001 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 11001 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.787 ms 0 /classes/Cart.php:1430
2138
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 5265
ORDER BY f.position ASC
0.785 ms 5 Yes /classes/Product.php:6021
2890
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 8417 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 8417 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.785 ms 0 /classes/Cart.php:1430
4293
SELECT SQL_NO_CACHE `id_module` FROM `hgt78_module_shop` WHERE `id_module` = 27 AND `id_shop` = 1 LIMIT 1
0.785 ms 1 /classes/module/Module.php:2137
4562
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2638) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.785 ms 1 Yes Yes /classes/Product.php:4524
4631
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3754) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.785 ms 1 Yes Yes /classes/Product.php:4524
1461
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3107 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3107 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.784 ms 0 /classes/Cart.php:1430
4614
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3557) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.784 ms 1 Yes Yes /classes/Product.php:4524
4085
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 6500
0.783 ms 1 /classes/Product.php:2902
189
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 5147) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.782 ms 1 /classes/stock/StockAvailable.php:453
2912
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 8419 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 8419 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.782 ms 0 /classes/Cart.php:1430
4041
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 6182) AND (b.`id_shop` = 1) LIMIT 1
0.782 ms 1 /src/Adapter/EntityMapper.php:71
4223
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 10067) AND (b.`id_shop` = 1) LIMIT 1
0.782 ms 1 /src/Adapter/EntityMapper.php:71
934
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2631 LIMIT 1
0.781 ms 10 /classes/SpecificPrice.php:435
3720
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2645) AND (b.`id_shop` = 1) LIMIT 1
0.781 ms 1 /src/Adapter/EntityMapper.php:71
4287
SELECT SQL_NO_CACHE * FROM `hgt78_cart_rule` cr
LEFT JOIN `hgt78_cart_rule_lang` crl 
ON (cr.`id_cart_rule` = crl.`id_cart_rule` AND crl.`id_lang` = 0) WHERE (cr.`id_customer` = 0) AND NOW() BETWEEN cr.date_from AND cr.date_to
AND cr.`active` = 1
AND cr.`quantity` > 0 AND highlight = 1 AND code NOT LIKE "BO_ORDER_%"
0.781 ms 1 /classes/CartRule.php:423
555
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2776 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2776 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.780 ms 0 /classes/Cart.php:1430
3274
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 10111 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 10111 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.780 ms 0 /classes/Cart.php:1430
4158
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 8976) AND (b.`id_shop` = 1) LIMIT 1
0.780 ms 1 /src/Adapter/EntityMapper.php:71
306
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 5136 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.780 ms 10 Yes /classes/SpecificPrice.php:576
4018
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 6173
ORDER BY `position`
0.779 ms 1 Yes /classes/Product.php:3545
4229
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 10069) AND (b.`id_shop` = 1) LIMIT 1
0.779 ms 1 /src/Adapter/EntityMapper.php:71
2304
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 5774 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 5774 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.778 ms 0 /classes/Cart.php:1430
128
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 7541
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.777 ms 0 /classes/SpecificPrice.php:259
688
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2778 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2778 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.777 ms 0 /classes/Cart.php:1430
2868
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 8397 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 8397 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.777 ms 0 /classes/Cart.php:1430
709
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2795) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.777 ms 1 /classes/stock/StockAvailable.php:453
1859
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3766
ORDER BY f.position ASC
0.776 ms 5 Yes /classes/Product.php:6021
2135
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 5265 AND `id_group` = 1 LIMIT 1
0.776 ms 0 /classes/GroupReduction.php:156
3738
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3265) AND (b.`id_shop` = 1) LIMIT 1
0.776 ms 1 /src/Adapter/EntityMapper.php:71
47
SELECT SQL_NO_CACHE state FROM hgt78_feature_flag WHERE name = 'multiple_image_format' LIMIT 1
0.775 ms 1 /classes/FeatureFlag.php:105
2991
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 9323 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 9323 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.775 ms 0 /classes/Cart.php:1430
4252
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 10298
0.774 ms 1 /classes/Product.php:2902
2316
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 5970
ORDER BY f.position ASC
0.774 ms 5 Yes /classes/Product.php:6021
743
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2799 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2799 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.773 ms 0 /classes/Cart.php:1430
2928
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 8975
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.773 ms 0 /classes/SpecificPrice.php:259
3588
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3179) AND (b.`id_shop` = 1) LIMIT 1
0.773 ms 1 /src/Adapter/EntityMapper.php:71
4397
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 161) LIMIT 1
0.773 ms 1 /src/Adapter/EntityMapper.php:71
919
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2659 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2659 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.772 ms 0 /classes/Cart.php:1430
4217
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 9695) AND (b.`id_shop` = 1) LIMIT 1
0.772 ms 1 /src/Adapter/EntityMapper.php:71
2514
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 6182 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 6182 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.771 ms 0 /classes/Cart.php:1430
4665
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (5267) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.771 ms 1 Yes Yes /classes/Product.php:4524
4773
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (12552) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.771 ms 1 Yes Yes /classes/Product.php:4524
4008
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 6108) AND (b.`id_shop` = 1) LIMIT 1
0.770 ms 1 /src/Adapter/EntityMapper.php:71
4286
SELECT SQL_NO_CACHE 1 FROM `hgt78_cart_rule` WHERE ((date_to >= "2025-05-01 00:00:00" AND date_to <= "2025-05-01 23:59:59") OR (date_from >= "2025-05-01 00:00:00" AND date_from <= "2025-05-01 23:59:59") OR (date_from < "2025-05-01 00:00:00" AND date_to > "2025-05-01 23:59:59")) AND `id_customer` IN (0,0) LIMIT 1
0.770 ms 29 /classes/CartRule.php:357
366
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3743 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3743 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.769 ms 0 /classes/Cart.php:1430
2558
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 6186 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 6186 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.769 ms 0 /classes/Cart.php:1430
2923
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 8420 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 8420 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.768 ms 0 /classes/Cart.php:1430
3610
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2659
ORDER BY `position`
0.768 ms 1 Yes /classes/Product.php:3545
4496
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (5138) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.768 ms 1 Yes Yes /classes/Product.php:4524
599
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2690 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2690 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.767 ms 0 /classes/Cart.php:1430
1813
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3757 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3757 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.767 ms 0 /classes/Cart.php:1430
2525
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 6183 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 6183 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.767 ms 0 /classes/Cart.php:1430
2835
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 8394 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 8394 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.767 ms 0 /classes/Cart.php:1430
3374
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 12551 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 12551 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.767 ms 0 /classes/Cart.php:1430
4308
SELECT SQL_NO_CACHE c.id_cms, cl.link_rewrite, cl.meta_title
FROM hgt78_cms c
LEFT JOIN hgt78_cms_lang cl ON (c.id_cms = cl.id_cms AND cl.id_lang = 1 AND cl.id_shop = 1)
INNER JOIN hgt78_cms_shop cms_shop
ON (cms_shop.id_cms = c.id_cms AND cms_shop.id_shop = 1)
WHERE 1
AND c.id_cms IN (17) AND c.`active` = 1 GROUP BY c.id_cms
ORDER BY c.`position`
0.767 ms 1 Yes /classes/CMS.php:151
751
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2800 AND id_shop=1 LIMIT 1
0.766 ms 1 /classes/Product.php:6876
1179
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2641 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.766 ms 10 Yes /classes/SpecificPrice.php:576
2846
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 8395 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 8395 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.766 ms 0 /classes/Cart.php:1430
3091
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 9688 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 9688 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.766 ms 0 /classes/Cart.php:1430
3816
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3745) AND (b.`id_shop` = 1) LIMIT 1
0.766 ms 1 /src/Adapter/EntityMapper.php:71
3954
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 5284) AND (b.`id_shop` = 1) LIMIT 1
0.766 ms 1 /src/Adapter/EntityMapper.php:71
4170
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 9323) AND (b.`id_shop` = 1) LIMIT 1
0.766 ms 1 /src/Adapter/EntityMapper.php:71
963
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2633 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2633 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.765 ms 0 /classes/Cart.php:1430
3482
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2652
0.765 ms 1 /classes/Product.php:2902
4633
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3756) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.765 ms 1 Yes Yes /classes/Product.php:4524
1825
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3763 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3763 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.764 ms 0 /classes/Cart.php:1430
1975
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4256 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.764 ms 10 Yes /classes/SpecificPrice.php:576
3711
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2643) AND (b.`id_shop` = 1) LIMIT 1
0.764 ms 1 /src/Adapter/EntityMapper.php:71
2613
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 6192 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 6192 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.763 ms 0 /classes/Cart.php:1430
2813
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 8392 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 8392 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.763 ms 0 /classes/Cart.php:1430
3837
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3752) AND (b.`id_shop` = 1) LIMIT 1
0.763 ms 1 /src/Adapter/EntityMapper.php:71
3937
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4966
ORDER BY `position`
0.763 ms 1 Yes /classes/Product.php:3545
4203
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 9690
ORDER BY `position`
0.763 ms 1 Yes /classes/Product.php:3545
87
SELECT SQL_NO_CACHE data FROM hgt78_layered_filter_block WHERE hash="5b6bbc76d81a1d16ff2598f8dc78ac1a" LIMIT 1
0.762 ms 1 /modules/ps_facetedsearch/src/Filters/Block.php:186
1205
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2648) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.762 ms 1 /classes/stock/StockAvailable.php:453
1396
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3326
AND image_shop.`cover` = 1 LIMIT 1
0.762 ms 2 /classes/Product.php:3570
2980
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 9321 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 9321 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.762 ms 0 /classes/Cart.php:1430
4613
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3556) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.762 ms 1 Yes Yes /classes/Product.php:4524
4662
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4966) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.762 ms 1 Yes Yes /classes/Product.php:4524
4152
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 8420) AND (b.`id_shop` = 1) LIMIT 1
0.761 ms 1 /src/Adapter/EntityMapper.php:71
3555
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2797) AND (b.`id_shop` = 1) LIMIT 1
0.761 ms 1 /src/Adapter/EntityMapper.php:71
179
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 5148 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 5148 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.760 ms 0 /classes/Cart.php:1430
3843
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3754) AND (b.`id_shop` = 1) LIMIT 1
0.760 ms 1 /src/Adapter/EntityMapper.php:71
3933
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4965) AND (b.`id_shop` = 1) LIMIT 1
0.760 ms 1 /src/Adapter/EntityMapper.php:71
4609
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2654) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.760 ms 1 Yes Yes /classes/Product.php:4524
355
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4902 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4902 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.759 ms 0 /classes/Cart.php:1430
3046
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 9597 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 9597 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.759 ms 0 /classes/Cart.php:1430
3069
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 9687 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 9687 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.759 ms 0 /classes/Cart.php:1430
4678
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (5774) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.759 ms 1 Yes Yes /classes/Product.php:4524
1472
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3132 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3132 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.758 ms 0 /classes/Cart.php:1430
1958
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3808 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3808 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.757 ms 0 /classes/Cart.php:1430
4032
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 6179) AND (b.`id_shop` = 1) LIMIT 1
0.757 ms 1 /src/Adapter/EntityMapper.php:71
2547
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 6185 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 6185 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.756 ms 0 /classes/Cart.php:1430
420
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2694) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.756 ms 1 /classes/stock/StockAvailable.php:453
1503
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2621 AND `id_group` = 1 LIMIT 1
0.755 ms 0 /classes/GroupReduction.php:156
4274
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 11001) AND (b.`id_shop` = 1) LIMIT 1
0.755 ms 1 /src/Adapter/EntityMapper.php:71
4120
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 7773
ORDER BY `position`
0.754 ms 1 Yes /classes/Product.php:3545
4617
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3584) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.754 ms 1 Yes Yes /classes/Product.php:4524
227
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 5143 LIMIT 1
0.753 ms 10 /classes/SpecificPrice.php:435
3523
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2690
ORDER BY `position`
0.753 ms 1 Yes /classes/Product.php:3545
4214
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 9694) AND (b.`id_shop` = 1) LIMIT 1
0.753 ms 1 /src/Adapter/EntityMapper.php:71
4074
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 6194) AND (b.`id_shop` = 1) LIMIT 1
0.752 ms 1 /src/Adapter/EntityMapper.php:71
969
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2634 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.752 ms 10 Yes /classes/SpecificPrice.php:576
1584
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3557
AND image_shop.`cover` = 1 LIMIT 1
0.752 ms 1 /classes/Product.php:3570
2646
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 6195 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 6195 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.752 ms 0 /classes/Cart.php:1430
2945
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 8976 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 8976 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.752 ms 0 /classes/Cart.php:1430
3906
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4932) AND (b.`id_shop` = 1) LIMIT 1
0.752 ms 1 /src/Adapter/EntityMapper.php:71
4071
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 6193) AND (b.`id_shop` = 1) LIMIT 1
0.752 ms 1 /src/Adapter/EntityMapper.php:71
1483
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3327 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3327 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.751 ms 0 /classes/Cart.php:1430
1820
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3763 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.751 ms 11 Yes /classes/SpecificPrice.php:576
3753
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3099) AND (b.`id_shop` = 1) LIMIT 1
0.751 ms 1 /src/Adapter/EntityMapper.php:71
4737
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (9055) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.751 ms 1 Yes Yes /classes/Product.php:4524
3903
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4575) AND (b.`id_shop` = 1) LIMIT 1
0.751 ms 1 /src/Adapter/EntityMapper.php:71
3024
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 9535 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 9535 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.750 ms 0 /classes/Cart.php:1430
3157
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 9694 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 9694 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.750 ms 0 /classes/Cart.php:1430
3834
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3751) AND (b.`id_shop` = 1) LIMIT 1
0.750 ms 1 /src/Adapter/EntityMapper.php:71
4012
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 6129
ORDER BY `position`
0.750 ms 1 Yes /classes/Product.php:3545
3909
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4934) AND (b.`id_shop` = 1) LIMIT 1
0.750 ms 1 /src/Adapter/EntityMapper.php:71
66
SELECT SQL_NO_CACHE *
FROM `hgt78_country` a
LEFT JOIN `hgt78_country_shop` `c` ON a.`id_country` = c.`id_country` AND c.`id_shop` = 1
WHERE (a.`id_country` = 8) LIMIT 1
0.749 ms 1 /src/Adapter/EntityMapper.php:71
2953
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 9055)
0.749 ms 1 /classes/Product.php:3860
4511
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2651) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.749 ms 1 Yes Yes /classes/Product.php:4524
1693
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3746
ORDER BY f.position ASC
0.749 ms 5 Yes /classes/Product.php:6021
4257
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 10302
ORDER BY `position`
0.748 ms 1 Yes /classes/Product.php:3545
4626
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3749) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.748 ms 1 Yes Yes /classes/Product.php:4524
2048
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4942 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4942 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.747 ms 0 /classes/Cart.php:1430
2443
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 6176 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.747 ms 10 Yes /classes/SpecificPrice.php:576
3807
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3586) AND (b.`id_shop` = 1) LIMIT 1
0.747 ms 1 /src/Adapter/EntityMapper.php:71
1637
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3585 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3585 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.746 ms 0 /classes/Cart.php:1430
2341
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 5973 LIMIT 1
0.746 ms 10 /classes/SpecificPrice.php:435
2780
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 7769 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 7769 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.746 ms 0 /classes/Cart.php:1430
3013
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 9325 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 9325 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.746 ms 0 /classes/Cart.php:1430
4161
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 9055) AND (b.`id_shop` = 1) LIMIT 1
0.746 ms 1 /src/Adapter/EntityMapper.php:71
4247
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 10297) AND (b.`id_shop` = 1) LIMIT 1
0.746 ms 1 /src/Adapter/EntityMapper.php:71
1876
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3775)
0.745 ms 1 /classes/Product.php:3860
3035
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 9596 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 9596 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.745 ms 0 /classes/Cart.php:1430
1779
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3754) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.744 ms 1 /classes/stock/StockAvailable.php:453
2214
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 5296 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 5296 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.744 ms 0 /classes/Cart.php:1430
2271
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 5590 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 5590 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.744 ms 0 /classes/Cart.php:1430
3585
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2781) AND (b.`id_shop` = 1) LIMIT 1
0.744 ms 1 /src/Adapter/EntityMapper.php:71
327
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 5134
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.744 ms 0 /classes/SpecificPrice.php:259
899
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3177
AND image_shop.`cover` = 1 LIMIT 1
0.744 ms 1 /classes/Product.php:3570
2657
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 6499 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 6499 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.744 ms 0 /classes/Cart.php:1430
4641
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3776) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.743 ms 1 Yes Yes /classes/Product.php:4524
577
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2765 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2765 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.742 ms 0 /classes/Cart.php:1430
1405
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3326 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3326 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.742 ms 0 /classes/Cart.php:1430
3168
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 9695 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 9695 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.742 ms 0 /classes/Cart.php:1430
699
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2779 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2779 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.741 ms 0 /classes/Cart.php:1430
1151
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2626 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2626 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.741 ms 0 /classes/Cart.php:1430
4675
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (5590) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.741 ms 1 Yes Yes /classes/Product.php:4524
2791
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 7779 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 7779 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.739 ms 0 /classes/Cart.php:1430
3296
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 10298 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 10298 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.739 ms 0 /classes/Cart.php:1430
3822
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3747) AND (b.`id_shop` = 1) LIMIT 1
0.739 ms 1 /src/Adapter/EntityMapper.php:71
4146
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 8418) AND (b.`id_shop` = 1) LIMIT 1
0.739 ms 1 /src/Adapter/EntityMapper.php:71
2248
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 5093 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 5093 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.738 ms 0 /classes/Cart.php:1430
3080
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 9686 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 9686 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.738 ms 0 /classes/Cart.php:1430
3594
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2789) AND (b.`id_shop` = 1) LIMIT 1
0.738 ms 1 /src/Adapter/EntityMapper.php:71
4596
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3265) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.738 ms 1 Yes Yes /classes/Product.php:4524
4512
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2623) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.737 ms 1 Yes Yes /classes/Product.php:4524
4700
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (6185) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.737 ms 1 Yes Yes /classes/Product.php:4524
4551
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2792) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.736 ms 1 Yes Yes /classes/Product.php:4524
3591
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2788) AND (b.`id_shop` = 1) LIMIT 1
0.735 ms 1 /src/Adapter/EntityMapper.php:71
4621
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3689) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.735 ms 1 Yes Yes /classes/Product.php:4524
2703
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 7940
ORDER BY f.position ASC
0.735 ms 5 Yes /classes/Product.php:6021
4608
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2650) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.734 ms 1 Yes Yes /classes/Product.php:4524
173
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 5148
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.734 ms 0 /classes/SpecificPrice.php:259
3405
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 5148) AND (b.`id_shop` = 1) LIMIT 1
0.734 ms 1 /src/Adapter/EntityMapper.php:71
3600
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2791) AND (b.`id_shop` = 1) LIMIT 1
0.734 ms 1 /src/Adapter/EntityMapper.php:71
4483
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (7540) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.734 ms 1 Yes Yes /classes/Product.php:4524
953
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2632
ORDER BY f.position ASC
0.733 ms 5 Yes /classes/Product.php:6021
3549
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2779) AND (b.`id_shop` = 1) LIMIT 1
0.733 ms 1 /src/Adapter/EntityMapper.php:71
4586
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2642) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.733 ms 1 Yes Yes /classes/Product.php:4524
3945
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 5267) AND (b.`id_shop` = 1) LIMIT 1
0.733 ms 1 /src/Adapter/EntityMapper.php:71
2371
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 6106 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 6106 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.732 ms 0 /classes/Cart.php:1430
431
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2660 AND `id_group` = 1 LIMIT 1
0.732 ms 0 /classes/GroupReduction.php:156
624
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.732 ms 1 /classes/Product.php:5659
3203
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 10068 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 10068 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.732 ms 0 /classes/Cart.php:1430
3795
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3558) AND (b.`id_shop` = 1) LIMIT 1
0.732 ms 1 /src/Adapter/EntityMapper.php:71
985
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2782) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.731 ms 1 /classes/stock/StockAvailable.php:453
3340
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 10304 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 10304 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.731 ms 0 /classes/Cart.php:1430
3579
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2793) AND (b.`id_shop` = 1) LIMIT 1
0.731 ms 1 /src/Adapter/EntityMapper.php:71
3733
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3256
ORDER BY `position`
0.731 ms 1 Yes /classes/Product.php:3545
4199
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 9689) AND (b.`id_shop` = 1) LIMIT 1
0.731 ms 1 /src/Adapter/EntityMapper.php:71
2014
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4932 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4932 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.730 ms 0 /classes/Cart.php:1430
2036
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4935 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4935 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.730 ms 0 /classes/Cart.php:1430
2580
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 6188 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 6188 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.730 ms 0 /classes/Cart.php:1430
4654
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4935) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.730 ms 1 Yes Yes /classes/Product.php:4524
4547
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2788) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.730 ms 1 Yes Yes /classes/Product.php:4524
183
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 5147 LIMIT 1
0.729 ms 10 /classes/SpecificPrice.php:435
2192
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 5284 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 5284 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.729 ms 0 /classes/Cart.php:1430
1733
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3750 AND id_shop=1 LIMIT 1
0.728 ms 1 /classes/Product.php:6876
2170
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 5282 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 5282 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.728 ms 0 /classes/Cart.php:1430
3781
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3454
ORDER BY `position`
0.728 ms 1 Yes /classes/Product.php:3545
3882
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3805) AND (b.`id_shop` = 1) LIMIT 1
0.728 ms 1 /src/Adapter/EntityMapper.php:71
4528
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2771) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.728 ms 1 Yes Yes /classes/Product.php:4524
3609
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2659) AND (b.`id_shop` = 1) LIMIT 1
0.728 ms 1 /src/Adapter/EntityMapper.php:71
3606
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3177) AND (b.`id_shop` = 1) LIMIT 1
0.727 ms 1 /src/Adapter/EntityMapper.php:71
3825
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3748) AND (b.`id_shop` = 1) LIMIT 1
0.727 ms 1 /src/Adapter/EntityMapper.php:71
1124
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2624 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.727 ms 10 Yes /classes/SpecificPrice.php:576
3363
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 12552 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 12552 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.727 ms 0 /classes/Cart.php:1430
733
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2798
ORDER BY f.position ASC
0.726 ms 5 Yes /classes/Product.php:6021
1129
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2624 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2624 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.726 ms 0 /classes/Cart.php:1430
2679
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 6501 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 6501 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.726 ms 0 /classes/Cart.php:1430
4630
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3753) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.726 ms 1 Yes Yes /classes/Product.php:4524
1527
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2650 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2650 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.725 ms 0 /classes/Cart.php:1430
3329
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 10303 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 10303 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.725 ms 0 /classes/Cart.php:1430
3988
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5970
ORDER BY `position`
0.725 ms 1 Yes /classes/Product.php:3545
4746
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (9598) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.725 ms 1 Yes Yes /classes/Product.php:4524
1736
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3750 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3750 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.724 ms 0 /classes/Cart.php:1430
4697
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (6182) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.724 ms 1 Yes Yes /classes/Product.php:4524
2059
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4943 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4943 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.723 ms 0 /classes/Cart.php:1430
216
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 5144 LIMIT 1
0.723 ms 10 /classes/SpecificPrice.php:435
892
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2792 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.723 ms 10 Yes /classes/SpecificPrice.php:576
4092
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 7940) AND (b.`id_shop` = 1) LIMIT 1
0.723 ms 1 /src/Adapter/EntityMapper.php:71
2415
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 6172 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 6172 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.722 ms 0 /classes/Cart.php:1430
4745
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (9597) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.722 ms 1 Yes Yes /classes/Product.php:4524
4769
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (10302) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.721 ms 1 Yes Yes /classes/Product.php:4524
3561
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2799) AND (b.`id_shop` = 1) LIMIT 1
0.721 ms 1 /src/Adapter/EntityMapper.php:71
2635
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 6194 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 6194 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.720 ms 0 /classes/Cart.php:1430
4615
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3558) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.720 ms 1 Yes Yes /classes/Product.php:4524
2260
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 5589 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 5589 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.719 ms 0 /classes/Cart.php:1430
2591
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 6189 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 6189 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.719 ms 0 /classes/Cart.php:1430
3967
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5350
ORDER BY `position`
0.719 ms 1 Yes /classes/Product.php:3545
2070
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4944 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4944 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.719 ms 0 /classes/Cart.php:1430
3981
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 5592) AND (b.`id_shop` = 1) LIMIT 1
0.719 ms 1 /src/Adapter/EntityMapper.php:71
1881
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3775
ORDER BY f.position ASC
0.717 ms 5 Yes /classes/Product.php:6021
3573
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3176) AND (b.`id_shop` = 1) LIMIT 1
0.717 ms 1 /src/Adapter/EntityMapper.php:71
1838
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3765
AND image_shop.`cover` = 1 LIMIT 1
0.715 ms 1 /classes/Product.php:3570
3534
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2771) AND (b.`id_shop` = 1) LIMIT 1
0.715 ms 1 /src/Adapter/EntityMapper.php:71
3546
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2778) AND (b.`id_shop` = 1) LIMIT 1
0.715 ms 1 /src/Adapter/EntityMapper.php:71
453
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2651 AND `id_group` = 1 LIMIT 1
0.715 ms 0 /classes/GroupReduction.php:156
3912
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4935) AND (b.`id_shop` = 1) LIMIT 1
0.715 ms 1 /src/Adapter/EntityMapper.php:71
1055
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.714 ms 1 /classes/Product.php:5659
3390
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 7542) AND (b.`id_shop` = 1) LIMIT 1
0.714 ms 1 /src/Adapter/EntityMapper.php:71
3681
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2641) AND (b.`id_shop` = 1) LIMIT 1
0.714 ms 1 /src/Adapter/EntityMapper.php:71
2724
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 7942 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 7942 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.713 ms 0 /classes/Cart.php:1430
4387
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 37) LIMIT 1
0.713 ms 1 /src/Adapter/EntityMapper.php:71
851
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2788 AND `id_group` = 1 LIMIT 1
0.713 ms 0 /classes/GroupReduction.php:156
3576
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2794) AND (b.`id_shop` = 1) LIMIT 1
0.712 ms 1 /src/Adapter/EntityMapper.php:71
3769
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2621
ORDER BY `position`
0.712 ms 1 Yes /classes/Product.php:3545
4089
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 7938) AND (b.`id_shop` = 1) LIMIT 1
0.712 ms 1 /src/Adapter/EntityMapper.php:71
3661
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2622
ORDER BY `position`
0.711 ms 1 Yes /classes/Product.php:3545
1493
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2490) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.711 ms 1 /classes/stock/StockAvailable.php:453
4139
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 8397
0.711 ms 1 /classes/Product.php:2902
2382
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 6107 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 6107 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.710 ms 0 /classes/Cart.php:1430
4602
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3107) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.710 ms 1 Yes Yes /classes/Product.php:4524
4694
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (6179) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.710 ms 1 Yes Yes /classes/Product.php:4524
1672
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3745
AND image_shop.`cover` = 1 LIMIT 1
0.709 ms 1 /classes/Product.php:3570
1758
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3752 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3752 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.709 ms 0 /classes/Cart.php:1430
2025
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4934 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4934 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.709 ms 0 /classes/Cart.php:1430
3057
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 9598 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 9598 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.709 ms 0 /classes/Cart.php:1430
4540
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3075) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.709 ms 1 Yes Yes /classes/Product.php:4524
4548
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2789) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.709 ms 1 Yes Yes /classes/Product.php:4524
3759
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3132) AND (b.`id_shop` = 1) LIMIT 1
0.708 ms 1 /src/Adapter/EntityMapper.php:71
4226
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 10068) AND (b.`id_shop` = 1) LIMIT 1
0.708 ms 1 /src/Adapter/EntityMapper.php:71
3191
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 10067 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 10067 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.708 ms 0 /classes/Cart.php:1430
4668
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (5284) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.708 ms 1 Yes Yes /classes/Product.php:4524
2586
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 6189 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.707 ms 10 Yes /classes/SpecificPrice.php:576
3113
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 9690 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 9690 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.707 ms 0 /classes/Cart.php:1430
1991
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4574 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4574 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.707 ms 0 /classes/Cart.php:1430
2081
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4962 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4962 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.707 ms 0 /classes/Cart.php:1430
3124
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 9691 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 9691 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.707 ms 0 /classes/Cart.php:1430
3402
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 6727) AND (b.`id_shop` = 1) LIMIT 1
0.707 ms 1 /src/Adapter/EntityMapper.php:71
3406
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5148
ORDER BY `position`
0.707 ms 1 Yes /classes/Product.php:3545
285
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 5138)
0.706 ms 1 /classes/Product.php:3860
399
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3587 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3587 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.706 ms 0 /classes/Cart.php:1430
3910
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4934
ORDER BY `position`
0.706 ms 1 Yes /classes/Product.php:3545
4530
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2764) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.706 ms 1 Yes Yes /classes/Product.php:4524
4701
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (6186) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.706 ms 1 Yes Yes /classes/Product.php:4524
164
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 6727 AND id_shop=1 LIMIT 1
0.705 ms 1 /classes/Product.php:6876
964
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2633
ORDER BY f.position ASC
0.705 ms 5 Yes /classes/Product.php:6021
3840
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3753) AND (b.`id_shop` = 1) LIMIT 1
0.705 ms 1 /src/Adapter/EntityMapper.php:71
952
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2632 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2632 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.704 ms 0 /classes/Cart.php:1430
1416
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3155 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3155 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.704 ms 0 /classes/Cart.php:1430
4159
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 8976
ORDER BY `position`
0.704 ms 1 Yes /classes/Product.php:3545
4749
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (9688) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.704 ms 1 Yes Yes /classes/Product.php:4524
98
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 7543
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.703 ms 0 /classes/SpecificPrice.php:259
3669
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2625) AND (b.`id_shop` = 1) LIMIT 1
0.703 ms 1 /src/Adapter/EntityMapper.php:71
4774
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (12551) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.703 ms 1 Yes Yes /classes/Product.php:4524
3986
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 5774
0.702 ms 1 /classes/Product.php:2902
1152
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2626
ORDER BY f.position ASC
0.702 ms 5 Yes /classes/Product.php:6021
3876
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3777) AND (b.`id_shop` = 1) LIMIT 1
0.702 ms 1 /src/Adapter/EntityMapper.php:71
3420
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 5144) AND (b.`id_shop` = 1) LIMIT 1
0.701 ms 1 /src/Adapter/EntityMapper.php:71
2919
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 8420)
0.701 ms 1 /classes/Product.php:3860
2237
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 5350 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 5350 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.700 ms 0 /classes/Cart.php:1430
3612
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2635) AND (b.`id_shop` = 1) LIMIT 1
0.700 ms 1 /src/Adapter/EntityMapper.php:71
4629
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3752) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.700 ms 1 Yes Yes /classes/Product.php:4524
4756
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (9695) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.700 ms 1 Yes Yes /classes/Product.php:4524
122
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 7542) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.699 ms 1 /classes/stock/StockAvailable.php:453
1041
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2630 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2630 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.699 ms 0 /classes/Cart.php:1430
1627
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3584
ORDER BY f.position ASC
0.699 ms 5 Yes /classes/Product.php:6021
3636
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2638) AND (b.`id_shop` = 1) LIMIT 1
0.699 ms 1 /src/Adapter/EntityMapper.php:71
58
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 19) AND (b.`id_shop` = 1) LIMIT 1
0.698 ms 1 /src/Adapter/EntityMapper.php:71
935
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2631
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.698 ms 0 /classes/SpecificPrice.php:259
1837
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3764
ORDER BY f.position ASC
0.698 ms 5 Yes /classes/Product.php:6021
1969
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3936 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3936 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.698 ms 0 /classes/Cart.php:1430
2226
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 5335 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 5335 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.698 ms 0 /classes/Cart.php:1430
3263
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 10073 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 10073 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.697 ms 0 /classes/Cart.php:1430
3828
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3749) AND (b.`id_shop` = 1) LIMIT 1
0.697 ms 1 /src/Adapter/EntityMapper.php:71
4435
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 145 AND `id_shop` = 1
0.697 ms 6 /src/Adapter/EntityMapper.php:79
4610
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3454) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.697 ms 1 Yes Yes /classes/Product.php:4524
1952
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3808
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.696 ms 0 /classes/SpecificPrice.php:259
853
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2788 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2788 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.696 ms 0 /classes/Cart.php:1430
1022
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.696 ms 1 /classes/Product.php:5659
2741
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 7944 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.695 ms 10 Yes /classes/SpecificPrice.php:576
3889
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3807
ORDER BY `position`
0.695 ms 1 Yes /classes/Product.php:3545
1682
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3745
ORDER BY f.position ASC
0.694 ms 5 Yes /classes/Product.php:6021
3183
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 10067) AND (b.`id_shop` = 1) LIMIT 1
0.694 ms 1 /src/Adapter/EntityMapper.php:71
4554
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2635) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.694 ms 1 Yes Yes /classes/Product.php:4524
732
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2798 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2798 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.693 ms 0 /classes/Cart.php:1430
1776
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3754)
0.693 ms 1 /classes/Product.php:3860
2433
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 6174)
0.693 ms 1 /classes/Product.php:3860
3582
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2780) AND (b.`id_shop` = 1) LIMIT 1
0.693 ms 1 /src/Adapter/EntityMapper.php:71
3892
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3808
ORDER BY `position`
0.693 ms 1 Yes /classes/Product.php:3545
4490
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (5144) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.693 ms 1 Yes Yes /classes/Product.php:4524
2181
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 5283 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 5283 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.693 ms 0 /classes/Cart.php:1430
3318
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 10302 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 10302 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.693 ms 0 /classes/Cart.php:1430
3396
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 7540) AND (b.`id_shop` = 1) LIMIT 1
0.692 ms 1 /src/Adapter/EntityMapper.php:71
3867
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3771) AND (b.`id_shop` = 1) LIMIT 1
0.692 ms 1 /src/Adapter/EntityMapper.php:71
4545
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2781) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.692 ms 1 Yes Yes /classes/Product.php:4524
4639
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3771) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.692 ms 1 Yes Yes /classes/Product.php:4524
643
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2771 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2771 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.691 ms 0 /classes/Cart.php:1430
3387
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 7543) AND (b.`id_shop` = 1) LIMIT 1
0.691 ms 1 /src/Adapter/EntityMapper.php:71
3351
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 10305 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 10305 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.690 ms 0 /classes/Cart.php:1430
4666
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (5282) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.690 ms 1 Yes Yes /classes/Product.php:4524
4725
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (8393) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.690 ms 1 Yes Yes /classes/Product.php:4524
2144
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 5266)
0.689 ms 1 /classes/Product.php:3860
4589
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2644) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.689 ms 1 Yes Yes /classes/Product.php:4524
1197
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2648
AND image_shop.`cover` = 1 LIMIT 1
0.689 ms 1 /classes/Product.php:3570
1980
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4256 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4256 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.688 ms 0 /classes/Cart.php:1430
2487
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 6180 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.688 ms 10 Yes /classes/SpecificPrice.php:576
3179
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 9697 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 9697 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.688 ms 0 /classes/Cart.php:1430
4021
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 6174
ORDER BY `position`
0.688 ms 1 Yes /classes/Product.php:3545
4611
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3455) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.687 ms 1 Yes Yes /classes/Product.php:4524
1560
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3455 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3455 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.687 ms 0 /classes/Cart.php:1430
2802
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 7773 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 7773 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.687 ms 0 /classes/Cart.php:1430
4764
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (10073) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.687 ms 1 Yes Yes /classes/Product.php:4524
1902
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3777 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3777 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.686 ms 0 /classes/Cart.php:1430
3135
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 9692 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 9692 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.686 ms 0 /classes/Cart.php:1430
4134
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 8396) AND (b.`id_shop` = 1) LIMIT 1
0.686 ms 1 /src/Adapter/EntityMapper.php:71
4607
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2733) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.685 ms 1 Yes Yes /classes/Product.php:4524
1802
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3756 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3756 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.684 ms 0 /classes/Cart.php:1430
4241
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 10073) AND (b.`id_shop` = 1) LIMIT 1
0.684 ms 1 /src/Adapter/EntityMapper.php:71
2946
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 8976
ORDER BY f.position ASC
0.682 ms 5 Yes /classes/Product.php:6021
4762
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (10071) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.682 ms 1 Yes Yes /classes/Product.php:4524
1954
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3808)
0.681 ms 1 /classes/Product.php:3860
1769
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3753 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3753 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.681 ms 0 /classes/Cart.php:1430
2426
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 6173 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 6173 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.681 ms 0 /classes/Cart.php:1430
3714
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2655) AND (b.`id_shop` = 1) LIMIT 1
0.680 ms 1 /src/Adapter/EntityMapper.php:71
391
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 185 LIMIT 1
0.680 ms 1 /classes/Product.php:5659
1087
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3459
AND image_shop.`cover` = 1 LIMIT 1
0.680 ms 1 /classes/Product.php:3570
3750
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2892) AND (b.`id_shop` = 1) LIMIT 1
0.680 ms 1 /src/Adapter/EntityMapper.php:71
4396
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 74 AND `id_shop` = 1
0.680 ms 6 /src/Adapter/EntityMapper.php:79
4484
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (7539) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.680 ms 1 Yes Yes /classes/Product.php:4524
859
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2789 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.679 ms 10 Yes /classes/SpecificPrice.php:576
3927
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4963) AND (b.`id_shop` = 1) LIMIT 1
0.679 ms 1 /src/Adapter/EntityMapper.php:71
4501
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (5133) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.678 ms 1 Yes Yes /classes/Product.php:4524
4567
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3477) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.678 ms 1 Yes Yes /classes/Product.php:4524
4703
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (6188) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.678 ms 1 Yes Yes /classes/Product.php:4524
4716
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (7942) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.678 ms 1 Yes Yes /classes/Product.php:4524
3525
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2691) AND (b.`id_shop` = 1) LIMIT 1
0.678 ms 1 /src/Adapter/EntityMapper.php:71
3756
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3107) AND (b.`id_shop` = 1) LIMIT 1
0.677 ms 1 /src/Adapter/EntityMapper.php:71
3435
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 5139) AND (b.`id_shop` = 1) LIMIT 1
0.677 ms 1 /src/Adapter/EntityMapper.php:71
3558
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2798) AND (b.`id_shop` = 1) LIMIT 1
0.677 ms 1 /src/Adapter/EntityMapper.php:71
4254
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 10299
ORDER BY `position`
0.677 ms 1 Yes /classes/Product.php:3545
150
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 7539
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.675 ms 0 /classes/SpecificPrice.php:259
954
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2633
AND image_shop.`cover` = 1 LIMIT 1
0.675 ms 1 /classes/Product.php:3570
3696
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2649) AND (b.`id_shop` = 1) LIMIT 1
0.675 ms 1 /src/Adapter/EntityMapper.php:71
1506
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2621
ORDER BY f.position ASC
0.674 ms 5 Yes /classes/Product.php:6021
1747
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3751 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3751 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.674 ms 0 /classes/Cart.php:1430
2630
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 6194 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.674 ms 10 Yes /classes/SpecificPrice.php:576
4557
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2633) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.674 ms 1 Yes Yes /classes/Product.php:4524
4285
SELECT SQL_NO_CACHE * FROM `hgt78_cart_rule` cr
LEFT JOIN `hgt78_cart_rule_lang` crl 
ON (cr.`id_cart_rule` = crl.`id_cart_rule` AND crl.`id_lang` = 1) WHERE (cr.`id_customer` = 0) AND NOW() BETWEEN cr.date_from AND cr.date_to
AND cr.`active` = 1
AND free_shipping = 1 AND carrier_restriction = 1
0.673 ms 6 /classes/CartRule.php:423
4486
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (5148) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.673 ms 1 Yes Yes /classes/Product.php:4524
3886
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3806
ORDER BY `position`
0.672 ms 1 Yes /classes/Product.php:3545
1513
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2733 AND id_shop=1 LIMIT 1
0.672 ms 1 /classes/Product.php:6876
344
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 5133 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 5133 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.671 ms 0 /classes/Cart.php:1430
3915
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4942) AND (b.`id_shop` = 1) LIMIT 1
0.671 ms 1 /src/Adapter/EntityMapper.php:71
826
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2781 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.671 ms 10 Yes /classes/SpecificPrice.php:576
3722
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2645
0.671 ms 1 /classes/Product.php:2902
4556
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2632) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.671 ms 1 Yes Yes /classes/Product.php:4524
1059
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2628)
0.670 ms 1 /classes/Product.php:3860
1539
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2654
ORDER BY f.position ASC
0.670 ms 5 Yes /classes/Product.php:6021
2619
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 6193 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.670 ms 10 Yes /classes/SpecificPrice.php:576
2702
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 7940 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 7940 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.670 ms 0 /classes/Cart.php:1430
3493
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2768
ORDER BY `position`
0.670 ms 1 Yes /classes/Product.php:3545
3831
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3750) AND (b.`id_shop` = 1) LIMIT 1
0.670 ms 1 /src/Adapter/EntityMapper.php:71
1671
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3689
ORDER BY f.position ASC
0.669 ms 5 Yes /classes/Product.php:6021
3423
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 5143) AND (b.`id_shop` = 1) LIMIT 1
0.669 ms 1 /src/Adapter/EntityMapper.php:71
3515
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2766
0.669 ms 1 /classes/Product.php:2902
4705
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (6191) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.669 ms 1 Yes Yes /classes/Product.php:4524
830
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2781) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.668 ms 1 /classes/stock/StockAvailable.php:453
3856
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3763
ORDER BY `position`
0.668 ms 1 Yes /classes/Product.php:3545
143
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 7540 AND `id_group` = 1 LIMIT 1
0.668 ms 0 /classes/GroupReduction.php:156
1550
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3454
ORDER BY f.position ASC
0.667 ms 5 Yes /classes/Product.php:6021
1602
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3558 AND `id_group` = 1 LIMIT 1
0.667 ms 0 /classes/GroupReduction.php:156
3873
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3776) AND (b.`id_shop` = 1) LIMIT 1
0.667 ms 1 /src/Adapter/EntityMapper.php:71
4506
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3587) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.667 ms 1 Yes Yes /classes/Product.php:4524
4656
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4943) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.667 ms 1 Yes Yes /classes/Product.php:4524
3615
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2631) AND (b.`id_shop` = 1) LIMIT 1
0.666 ms 1 /src/Adapter/EntityMapper.php:71
4077
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 6195) AND (b.`id_shop` = 1) LIMIT 1
0.665 ms 1 /src/Adapter/EntityMapper.php:71
1666
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3689)
0.665 ms 1 /classes/Product.php:3860
2597
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 6191 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.664 ms 10 Yes /classes/SpecificPrice.php:576
3648
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2628) AND (b.`id_shop` = 1) LIMIT 1
0.664 ms 1 /src/Adapter/EntityMapper.php:71
3850
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3756
ORDER BY `position`
0.664 ms 1 Yes /classes/Product.php:3545
3810
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3639) AND (b.`id_shop` = 1) LIMIT 1
0.663 ms 1 /src/Adapter/EntityMapper.php:71
4549
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2790) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.663 ms 1 Yes Yes /classes/Product.php:4524
4634
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3757) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.663 ms 1 Yes Yes /classes/Product.php:4524
4503
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3743) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.663 ms 1 Yes Yes /classes/Product.php:4524
3393
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 7541) AND (b.`id_shop` = 1) LIMIT 1
0.662 ms 1 /src/Adapter/EntityMapper.php:71
4590
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2645) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.662 ms 1 Yes Yes /classes/Product.php:4524
4534
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2795) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.662 ms 1 Yes Yes /classes/Product.php:4524
3103
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 9689
ORDER BY f.position ASC
0.661 ms 5 Yes /classes/Product.php:6021
4730
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (8401) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.661 ms 1 Yes Yes /classes/Product.php:4524
182
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 309 LIMIT 1
0.661 ms 1 /classes/Product.php:5659
4661
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4965) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.660 ms 1 Yes Yes /classes/Product.php:4524
3741
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3326) AND (b.`id_shop` = 1) LIMIT 1
0.660 ms 1 /src/Adapter/EntityMapper.php:71
2011
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4932 AND id_shop=1 LIMIT 1
0.659 ms 1 /classes/Product.php:6876
2959
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 9306
AND image_shop.`cover` = 1 LIMIT 1
0.659 ms 1 /classes/Product.php:3570
4535
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2797) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.659 ms 1 Yes Yes /classes/Product.php:4524
283
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 5138
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.658 ms 0 /classes/SpecificPrice.php:259
766
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3178
ORDER BY f.position ASC
0.658 ms 5 Yes /classes/Product.php:6021
1656
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3639 AND id_shop=1 LIMIT 1
0.658 ms 1 /classes/Product.php:6876
3728
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3254
0.658 ms 1 /classes/Product.php:2902
4542
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2794) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.658 ms 1 Yes Yes /classes/Product.php:4524
3621
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2633) AND (b.`id_shop` = 1) LIMIT 1
0.657 ms 1 /src/Adapter/EntityMapper.php:71
3708
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2642) AND (b.`id_shop` = 1) LIMIT 1
0.657 ms 1 /src/Adapter/EntityMapper.php:71
4491
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (5143) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.657 ms 1 Yes Yes /classes/Product.php:4524
754
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2800 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2800 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.657 ms 0 /classes/Cart.php:1430
866
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2790
AND image_shop.`cover` = 1 LIMIT 1
0.657 ms 1 /classes/Product.php:3570
534
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2774
ORDER BY f.position ASC
0.656 ms 5 Yes /classes/Product.php:6021
1241
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2658
AND image_shop.`cover` = 1 LIMIT 1
0.656 ms 1 /classes/Product.php:3570
1118
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3458 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3458 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.656 ms 0 /classes/Cart.php:1430
2003
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4575
ORDER BY f.position ASC
0.656 ms 5 Yes /classes/Product.php:6021
3766
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2490
ORDER BY `position`
0.656 ms 1 Yes /classes/Product.php:3545
3895
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3936
ORDER BY `position`
0.656 ms 1 Yes /classes/Product.php:3545
4532
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2778) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.656 ms 1 Yes Yes /classes/Product.php:4524
1540
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3454
AND image_shop.`cover` = 1 LIMIT 1
0.655 ms 1 /classes/Product.php:3570
3455
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 5133
0.655 ms 1 /classes/Product.php:2902
3847
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3755
ORDER BY `position`
0.655 ms 1 Yes /classes/Product.php:3545
3862
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3765
ORDER BY `position`
0.655 ms 1 Yes /classes/Product.php:3545
1286
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.654 ms 1 /classes/Product.php:5659
1648
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3586 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3586 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.654 ms 0 /classes/Cart.php:1430
4558
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2634) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.654 ms 1 Yes Yes /classes/Product.php:4524
3219
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 10070) AND (b.`id_shop` = 1) LIMIT 1
0.653 ms 1 /src/Adapter/EntityMapper.php:71
3772
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2733
ORDER BY `position`
0.653 ms 1 Yes /classes/Product.php:3545
4663
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (5265) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.653 ms 1 Yes Yes /classes/Product.php:4524
786
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3176) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.652 ms 1 /classes/stock/StockAvailable.php:453
4104
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 7944) AND (b.`id_shop` = 1) LIMIT 1
0.652 ms 1 /src/Adapter/EntityMapper.php:71
4699
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (6184) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.652 ms 1 Yes Yes /classes/Product.php:4524
4651
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4575) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.652 ms 1 Yes Yes /classes/Product.php:4524
1009
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2637
ORDER BY f.position ASC
0.651 ms 5 Yes /classes/Product.php:6021
2104
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4964
ORDER BY f.position ASC
0.651 ms 5 Yes /classes/Product.php:6021
3627
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2782) AND (b.`id_shop` = 1) LIMIT 1
0.651 ms 1 /src/Adapter/EntityMapper.php:71
777
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3075
ORDER BY f.position ASC
0.650 ms 5 Yes /classes/Product.php:6021
4504
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3741) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.650 ms 1 Yes Yes /classes/Product.php:4524
4113
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 7769) AND (b.`id_shop` = 1) LIMIT 1
0.650 ms 1 /src/Adapter/EntityMapper.php:71
83
SELECT SQL_NO_CACHE c.*, cl.*
FROM `hgt78_category` c
LEFT JOIN `hgt78_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 )
WHERE `name` = 'Luminaires'
AND c.`id_category` != 2
AND c.`id_parent` = 2 LIMIT 1
0.649 ms 7 /classes/Category.php:1500
235
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 5143
ORDER BY f.position ASC
0.649 ms 5 Yes /classes/Product.php:6021
3747
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2818) AND (b.`id_shop` = 1) LIMIT 1
0.649 ms 1 /src/Adapter/EntityMapper.php:71
3853
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3757
ORDER BY `position`
0.649 ms 1 Yes /classes/Product.php:3545
10
SELECT SQL_NO_CACHE id_shop
FROM `hgt78_lang_shop`
WHERE `id_lang` = 1
AND id_shop = 1 LIMIT 1
0.648 ms 1 /classes/ObjectModel.php:1729
3718
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2644
ORDER BY `position`
0.648 ms 1 Yes /classes/Product.php:3545
4412
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 264 AND `id_shop` = 1
0.648 ms 6 /src/Adapter/EntityMapper.php:79
1362
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3255
ORDER BY f.position ASC
0.647 ms 5 Yes /classes/Product.php:6021
3207
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 10069) AND (b.`id_shop` = 1) LIMIT 1
0.647 ms 1 /src/Adapter/EntityMapper.php:71
4552
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3177) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.647 ms 1 Yes Yes /classes/Product.php:4524
381
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3740 LIMIT 1
0.647 ms 10 /classes/SpecificPrice.php:435
1449
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3099) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.647 ms 1 /classes/stock/StockAvailable.php:453
4640
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3775) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.647 ms 1 Yes Yes /classes/Product.php:4524
2452
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 6177 LIMIT 1
0.646 ms 10 /classes/SpecificPrice.php:435
4658
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4962) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.646 ms 1 Yes Yes /classes/Product.php:4524
1
SELECT SQL_NO_CACHE gs.*, s.*, gs.name AS group_name, s.name AS shop_name, s.active, su.domain, su.domain_ssl, su.physical_uri, su.virtual_uri
FROM hgt78_shop_group gs
LEFT JOIN hgt78_shop s
ON s.id_shop_group = gs.id_shop_group
LEFT JOIN hgt78_shop_url su
ON s.id_shop = su.id_shop AND su.main = 1
WHERE s.deleted = 0
AND gs.deleted = 0
ORDER BY gs.name, s.name
0.646 ms 1 Yes /classes/shop/Shop.php:715
727
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2798 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.645 ms 10 Yes /classes/SpecificPrice.php:576
903
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3177 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.645 ms 10 Yes /classes/SpecificPrice.php:576
4244
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 10111) AND (b.`id_shop` = 1) LIMIT 1
0.645 ms 1 /src/Adapter/EntityMapper.php:71
4382
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 192 AND `id_shop` = 1
0.645 ms 6 /src/Adapter/EntityMapper.php:79
4537
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2799) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.645 ms 1 Yes Yes /classes/Product.php:4524
4601
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3099) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.645 ms 1 Yes Yes /classes/Product.php:4524
4779
SELECT SQL_NO_CACHE DISTINCT c.*
FROM `hgt78_category` c
LEFT JOIN `hgt78_category_lang` cl ON (c.`id_category` = cl.`id_category` AND cl.`id_lang` = 1)
WHERE `level_depth` = 1
0.645 ms 21 /classes/Category.php:2242
53
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 319) AND (b.`id_shop` = 1) LIMIT 1
0.644 ms 1 /src/Adapter/EntityMapper.php:71
888
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2792
AND image_shop.`cover` = 1 LIMIT 1
0.644 ms 1 /classes/Product.php:3570
4517
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2773) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.644 ms 1 Yes Yes /classes/Product.php:4524
4526
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2692) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.644 ms 1 Yes Yes /classes/Product.php:4524
4573
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2625) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.644 ms 1 Yes Yes /classes/Product.php:4524
3651
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3477) AND (b.`id_shop` = 1) LIMIT 1
0.643 ms 1 /src/Adapter/EntityMapper.php:71
4578
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2656) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.643 ms 1 Yes Yes /classes/Product.php:4524
4752
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (9691) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.643 ms 1 Yes Yes /classes/Product.php:4524
1004
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2637)
0.642 ms 1 /classes/Product.php:3860
3630
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2636) AND (b.`id_shop` = 1) LIMIT 1
0.642 ms 1 /src/Adapter/EntityMapper.php:71
4753
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (9692) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.642 ms 1 Yes Yes /classes/Product.php:4524
437
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2652 LIMIT 1
0.641 ms 10 /classes/SpecificPrice.php:435
3429
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 5141) AND (b.`id_shop` = 1) LIMIT 1
0.641 ms 1 /src/Adapter/EntityMapper.php:71
1865
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3771)
0.640 ms 1 /classes/Product.php:3860
4149
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 8419) AND (b.`id_shop` = 1) LIMIT 1
0.640 ms 1 /src/Adapter/EntityMapper.php:71
628
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2693)
0.640 ms 1 /classes/Product.php:3860
1498
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2621 LIMIT 1
0.640 ms 11 /classes/SpecificPrice.php:435
3528
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2692) AND (b.`id_shop` = 1) LIMIT 1
0.640 ms 1 /src/Adapter/EntityMapper.php:71
2115
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4965
ORDER BY f.position ASC
0.639 ms 5 Yes /classes/Product.php:6021
4174
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 9324
ORDER BY `position`
0.639 ms 1 Yes /classes/Product.php:3545
4406
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 261 AND `id_shop` = 1
0.639 ms 6 /src/Adapter/EntityMapper.php:79
4657
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4944) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.638 ms 1 Yes Yes /classes/Product.php:4524
731
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2798) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.637 ms 1 /classes/stock/StockAvailable.php:453
1283
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2642 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2642 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.637 ms 0 /classes/Cart.php:1430
3255
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 10073) AND (b.`id_shop` = 1) LIMIT 1
0.637 ms 1 /src/Adapter/EntityMapper.php:71
4167
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 9321) AND (b.`id_shop` = 1) LIMIT 1
0.637 ms 1 /src/Adapter/EntityMapper.php:71
4514
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2768) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.637 ms 1 Yes Yes /classes/Product.php:4524
4539
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3178) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.637 ms 1 Yes Yes /classes/Product.php:4524
4707
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (6193) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.637 ms 1 Yes Yes /classes/Product.php:4524
535
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2775
AND image_shop.`cover` = 1 LIMIT 1
0.637 ms 1 /classes/Product.php:3570
4521
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2766) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.636 ms 1 Yes Yes /classes/Product.php:4524
4527
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2693) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.636 ms 1 Yes Yes /classes/Product.php:4524
4711
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (6500) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.636 ms 1 Yes Yes /classes/Product.php:4524
778
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3176
AND image_shop.`cover` = 1 LIMIT 1
0.635 ms 1 /classes/Product.php:3570
1085
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2620 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2620 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.635 ms 0 /classes/Cart.php:1430
1084
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2620) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.635 ms 1 /classes/stock/StockAvailable.php:453
3633
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2637) AND (b.`id_shop` = 1) LIMIT 1
0.635 ms 1 /src/Adapter/EntityMapper.php:71
1347
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3254 AND id_shop=1 LIMIT 1
0.634 ms 1 /classes/Product.php:6876
3642
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2630) AND (b.`id_shop` = 1) LIMIT 1
0.634 ms 1 /src/Adapter/EntityMapper.php:71
4493
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (5141) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.634 ms 1 Yes Yes /classes/Product.php:4524
35
SELECT SQL_NO_CACHE *
FROM `hgt78_group` a
LEFT JOIN `hgt78_group_shop` `c` ON a.`id_group` = c.`id_group` AND c.`id_shop` = 1
WHERE (a.`id_group` = 1) LIMIT 1
0.633 ms 1 /src/Adapter/EntityMapper.php:71
4027
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 6177
ORDER BY `position`
0.633 ms 1 Yes /classes/Product.php:3545
4515
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2769) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.633 ms 1 Yes Yes /classes/Product.php:4524
4533
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2779) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.633 ms 1 Yes Yes /classes/Product.php:4524
4563
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2639) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.633 ms 1 Yes Yes /classes/Product.php:4524
191
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 5147
ORDER BY f.position ASC
0.632 ms 5 Yes /classes/Product.php:6021
413
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 185 LIMIT 1
0.632 ms 1 /classes/Product.php:5659
3432
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 5140) AND (b.`id_shop` = 1) LIMIT 1
0.632 ms 1 /src/Adapter/EntityMapper.php:71
3624
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2634) AND (b.`id_shop` = 1) LIMIT 1
0.632 ms 1 /src/Adapter/EntityMapper.php:71
4492
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (5142) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.632 ms 1 Yes Yes /classes/Product.php:4524
4642
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3777) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.632 ms 1 Yes Yes /classes/Product.php:4524
909
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3177
ORDER BY f.position ASC
0.631 ms 5 Yes /classes/Product.php:6021
3240
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 10071
ORDER BY f.position ASC
0.631 ms 5 Yes /classes/Product.php:6021
3798
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3559) AND (b.`id_shop` = 1) LIMIT 1
0.631 ms 1 /src/Adapter/EntityMapper.php:71
4101
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 7943) AND (b.`id_shop` = 1) LIMIT 1
0.631 ms 1 /src/Adapter/EntityMapper.php:71
1371
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3256) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.631 ms 1 /classes/stock/StockAvailable.php:453
4538
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2800) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.631 ms 1 Yes Yes /classes/Product.php:4524
3426
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 5142) AND (b.`id_shop` = 1) LIMIT 1
0.630 ms 1 /src/Adapter/EntityMapper.php:71
1103
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2622)
0.630 ms 1 /classes/Product.php:3860
1199
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2648 LIMIT 1
0.630 ms 10 /classes/SpecificPrice.php:435
407
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2893 AND id_shop=1 LIMIT 1
0.629 ms 1 /classes/Product.php:6876
3520
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2661
ORDER BY `position`
0.629 ms 1 Yes /classes/Product.php:3545
4525
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2691) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.629 ms 1 Yes Yes /classes/Product.php:4524
4487
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (5147) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.628 ms 1 Yes Yes /classes/Product.php:4524
4583
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2658) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.628 ms 1 Yes Yes /classes/Product.php:4524
4513
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2767) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.627 ms 1 Yes Yes /classes/Product.php:4524
4519
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2775) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.627 ms 1 Yes Yes /classes/Product.php:4524
3949
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5282
ORDER BY `position`
0.626 ms 1 Yes /classes/Product.php:3545
4510
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2652) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.626 ms 1 Yes Yes /classes/Product.php:4524
4618
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3585) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.626 ms 1 Yes Yes /classes/Product.php:4524
3693
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3456) AND (b.`id_shop` = 1) LIMIT 1
0.626 ms 1 /src/Adapter/EntityMapper.php:71
3243
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 10072) AND (b.`id_shop` = 1) LIMIT 1
0.624 ms 1 /src/Adapter/EntityMapper.php:71
1870
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3771
ORDER BY f.position ASC
0.624 ms 5 Yes /classes/Product.php:6021
3231
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 10071) AND (b.`id_shop` = 1) LIMIT 1
0.624 ms 1 /src/Adapter/EntityMapper.php:71
4755
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (9694) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.624 ms 1 Yes Yes /classes/Product.php:4524
976
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2782
AND image_shop.`cover` = 1 LIMIT 1
0.623 ms 1 /classes/Product.php:3570
1119
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3458
ORDER BY f.position ASC
0.623 ms 5 Yes /classes/Product.php:6021
1848
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3765
ORDER BY f.position ASC
0.623 ms 5 Yes /classes/Product.php:6021
2155
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 5267)
0.623 ms 1 /classes/Product.php:3860
2569
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 6187 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 6187 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.622 ms 0 /classes/Cart.php:1430
4584
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2647) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.622 ms 1 Yes Yes /classes/Product.php:4524
4706
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (6192) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.622 ms 1 Yes Yes /classes/Product.php:4524
4731
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (8417) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.622 ms 1 Yes Yes /classes/Product.php:4524
3660
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2622) AND (b.`id_shop` = 1) LIMIT 1
0.621 ms 1 /src/Adapter/EntityMapper.php:71
4497
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (5137) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.621 ms 1 Yes Yes /classes/Product.php:4524
4499
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (5135) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.621 ms 1 Yes Yes /classes/Product.php:4524
2203
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 5293 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 5293 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.621 ms 0 /classes/Cart.php:1430
4509
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2660) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.620 ms 1 Yes Yes /classes/Product.php:4524
4564
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2630) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.620 ms 1 Yes Yes /classes/Product.php:4524
4568
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2620) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.619 ms 1 Yes Yes /classes/Product.php:4524
4724
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (8392) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.619 ms 1 Yes Yes /classes/Product.php:4524
3928
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4963
ORDER BY `position`
0.618 ms 1 Yes /classes/Product.php:3545
481
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 182 LIMIT 1
0.618 ms 1 /classes/Product.php:5659
549
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2776
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.618 ms 0 /classes/SpecificPrice.php:259
1699
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3747)
0.618 ms 1 /classes/Product.php:3860
1826
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3763
ORDER BY f.position ASC
0.618 ms 5 Yes /classes/Product.php:6021
4553
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2659) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.618 ms 1 Yes Yes /classes/Product.php:4524
4581
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3456) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.618 ms 1 Yes Yes /classes/Product.php:4524
4652
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4932) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.618 ms 1 Yes Yes /classes/Product.php:4524
4721
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (7769) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.618 ms 1 Yes Yes /classes/Product.php:4524
4775
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (11001) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.618 ms 1 Yes Yes /classes/Product.php:4524
4110
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 7946) AND (b.`id_shop` = 1) LIMIT 1
0.617 ms 1 /src/Adapter/EntityMapper.php:71
4580
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2657) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.617 ms 1 Yes Yes /classes/Product.php:4524
221
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 5144 AND `id_group` = 1 LIMIT 1
0.616 ms 0 /classes/GroupReduction.php:156
4560
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2636) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.616 ms 1 Yes Yes /classes/Product.php:4524
4720
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (7946) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.616 ms 1 Yes Yes /classes/Product.php:4524
1208
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2657
AND image_shop.`cover` = 1 LIMIT 1
0.616 ms 1 /classes/Product.php:3570
3618
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2632) AND (b.`id_shop` = 1) LIMIT 1
0.616 ms 1 /src/Adapter/EntityMapper.php:71
3639
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2639) AND (b.`id_shop` = 1) LIMIT 1
0.615 ms 1 /src/Adapter/EntityMapper.php:71
4516
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2770) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.615 ms 1 Yes Yes /classes/Product.php:4524
1081
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2620)
0.615 ms 1 /classes/Product.php:3860
2758
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 7945
ORDER BY f.position ASC
0.615 ms 5 Yes /classes/Product.php:6021
4522
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2765) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.615 ms 1 Yes Yes /classes/Product.php:4524
433
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2660 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2660 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.614 ms 0 /classes/Cart.php:1430
69
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a0
LEFT JOIN `hgt78_category_lang` `a1` ON (a0.`id_category` = a1.`id_category`)
WHERE (a0.`nleft` < 2) AND (a0.`nright` > 577) AND (a1.`id_lang` = 1) AND (a1.`id_shop` = 1)
ORDER BY a0.`nleft` asc
0.614 ms 1 /classes/PrestaShopCollection.php:383
286
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 5138 AND id_shop=1 LIMIT 1
0.614 ms 1 /classes/Product.php:6876
3195
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 10068) AND (b.`id_shop` = 1) LIMIT 1
0.614 ms 1 /src/Adapter/EntityMapper.php:71
3512
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2776
0.613 ms 1 /classes/Product.php:2902
4508
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2694) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.613 ms 1 Yes Yes /classes/Product.php:4524
4644
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3805) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.613 ms 1 Yes Yes /classes/Product.php:4524
4704
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (6189) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.613 ms 1 Yes Yes /classes/Product.php:4524
3417
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 5145) AND (b.`id_shop` = 1) LIMIT 1
0.612 ms 1 /src/Adapter/EntityMapper.php:71
4555
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2631) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.612 ms 1 Yes Yes /classes/Product.php:4524
4566
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2628) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.612 ms 1 Yes Yes /classes/Product.php:4524
4579
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2648) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.612 ms 1 Yes Yes /classes/Product.php:4524
4708
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (6194) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.612 ms 1 Yes Yes /classes/Product.php:4524
1731
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3750 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.610 ms 10 Yes /classes/SpecificPrice.php:576
3835
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3751
ORDER BY `position`
0.610 ms 1 Yes /classes/Product.php:3545
4529
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2738) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.610 ms 1 Yes Yes /classes/Product.php:4524
4744
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (9596) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.610 ms 1 Yes Yes /classes/Product.php:4524
4751
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (9690) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.610 ms 1 Yes Yes /classes/Product.php:4524
4768
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (10299) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.609 ms 1 Yes Yes /classes/Product.php:4524
724
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.609 ms 1 /classes/Product.php:5659
931
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2635
ORDER BY f.position ASC
0.609 ms 5 Yes /classes/Product.php:6021
1943
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3807)
0.609 ms 1 /classes/Product.php:3860
4131
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 8395) AND (b.`id_shop` = 1) LIMIT 1
0.609 ms 1 /src/Adapter/EntityMapper.php:71
4208
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 9692) AND (b.`id_shop` = 1) LIMIT 1
0.609 ms 1 /src/Adapter/EntityMapper.php:71
809
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2793 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2793 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.608 ms 0 /classes/Cart.php:1430
3868
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3771
ORDER BY `position`
0.608 ms 1 Yes /classes/Product.php:3545
4095
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 7941) AND (b.`id_shop` = 1) LIMIT 1
0.608 ms 1 /src/Adapter/EntityMapper.php:71
2481
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 6179 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 6179 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.607 ms 0 /classes/Cart.php:1430
2804
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 8392
AND image_shop.`cover` = 1 LIMIT 1
0.607 ms 1 /classes/Product.php:3570
4119
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 7773) AND (b.`id_shop` = 1) LIMIT 1
0.607 ms 1 /src/Adapter/EntityMapper.php:71
4453
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 191 AND `id_shop` = 1
0.607 ms 6 /src/Adapter/EntityMapper.php:79
4650
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4574) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.607 ms 1 Yes Yes /classes/Product.php:4524
1168
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2640 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.606 ms 10 Yes /classes/SpecificPrice.php:576
2414
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 6172) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.606 ms 1 /classes/stock/StockAvailable.php:453
4137
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 8397) AND (b.`id_shop` = 1) LIMIT 1
0.606 ms 1 /src/Adapter/EntityMapper.php:71
281
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 309 LIMIT 1
0.605 ms 1 /classes/Product.php:5659
2668
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 6500 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 6500 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.605 ms 0 /classes/Cart.php:1430
736
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2799 LIMIT 1
0.605 ms 10 /classes/SpecificPrice.php:435
3645
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2629) AND (b.`id_shop` = 1) LIMIT 1
0.605 ms 1 /src/Adapter/EntityMapper.php:71
4495
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (5139) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.605 ms 1 Yes Yes /classes/Product.php:4524
4488
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (5146) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.604 ms 1 Yes Yes /classes/Product.php:4524
4718
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (7944) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.604 ms 1 Yes Yes /classes/Product.php:4524
68
SELECT SQL_NO_CACHE id_required_field, object_name, field_name
FROM hgt78_required_field
0.604 ms 2 /classes/ObjectModel.php:1592
510
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2770) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.604 ms 1 /classes/stock/StockAvailable.php:453
4771
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (10304) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.604 ms 1 Yes Yes /classes/Product.php:4524
711
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2795
ORDER BY f.position ASC
0.603 ms 5 Yes /classes/Product.php:6021
230
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 5143)
0.602 ms 1 /classes/Product.php:3860
3778
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2654
ORDER BY `position`
0.602 ms 1 Yes /classes/Product.php:3545
4550
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2791) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.602 ms 1 Yes Yes /classes/Product.php:4524
268
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 5140
ORDER BY f.position ASC
0.601 ms 5 Yes /classes/Product.php:6021
2438
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 6174
ORDER BY f.position ASC
0.601 ms 5 Yes /classes/Product.php:6021
1720
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3749 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.601 ms 10 Yes /classes/SpecificPrice.php:576
4518
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2774) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.601 ms 1 Yes Yes /classes/Product.php:4524
908
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3177 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3177 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.600 ms 0 /classes/Cart.php:1430
2746
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 7944 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 7944 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.600 ms 0 /classes/Cart.php:1430
4757
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (9697) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.600 ms 1 Yes Yes /classes/Product.php:4524
2902
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 8418
ORDER BY f.position ASC
0.600 ms 5 Yes /classes/Product.php:6021
4715
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (7941) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.600 ms 1 Yes Yes /classes/Product.php:4524
1296
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2655
AND image_shop.`cover` = 1 LIMIT 1
0.599 ms 1 /classes/Product.php:3570
2658
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 6499
ORDER BY f.position ASC
0.599 ms 5 Yes /classes/Product.php:6021
3003
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 9324
ORDER BY f.position ASC
0.599 ms 5 Yes /classes/Product.php:6021
548
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2776 LIMIT 1
0.599 ms 10 /classes/SpecificPrice.php:435
2402
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 6129 AND `id_group` = 1 LIMIT 1
0.599 ms 0 /classes/GroupReduction.php:156
2444
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 6176)
0.599 ms 1 /classes/Product.php:3860
3743
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3326
0.599 ms 1 /classes/Product.php:2902
3865
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3766
ORDER BY `position`
0.599 ms 1 Yes /classes/Product.php:3545
1274
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2642
AND image_shop.`cover` = 1 LIMIT 1
0.598 ms 1 /classes/Product.php:3570
4494
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (5140) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.598 ms 1 Yes Yes /classes/Product.php:4524
4502
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4902) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.598 ms 1 Yes Yes /classes/Product.php:4524
604
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2691
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.597 ms 0 /classes/SpecificPrice.php:259
1114
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3458)
0.597 ms 1 /classes/Product.php:3860
1374
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3264
AND image_shop.`cover` = 1 LIMIT 1
0.597 ms 1 /classes/Product.php:3570
3958
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5293
ORDER BY `position`
0.597 ms 2 Yes /classes/Product.php:3545
4024
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 6176
ORDER BY `position`
0.597 ms 1 Yes /classes/Product.php:3545
4033
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 6179
ORDER BY `position`
0.597 ms 1 Yes /classes/Product.php:3545
4194
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 9686
ORDER BY `position`
0.597 ms 1 Yes /classes/Product.php:3545
4177
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 9325
ORDER BY `position`
0.596 ms 1 Yes /classes/Product.php:3545
4743
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (9535) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.596 ms 1 Yes Yes /classes/Product.php:4524
2294
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 5592
ORDER BY f.position ASC
0.595 ms 5 Yes /classes/Product.php:6021
4667
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (5283) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.595 ms 1 Yes Yes /classes/Product.php:4524
4574
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2626) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.594 ms 1 Yes Yes /classes/Product.php:4524
3979
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5591
ORDER BY `position`
0.593 ms 2 Yes /classes/Product.php:3545
4660
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4964) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.593 ms 1 Yes Yes /classes/Product.php:4524
4765
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (10111) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.593 ms 1 Yes Yes /classes/Product.php:4524
4760
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (10069) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.592 ms 1 Yes Yes /classes/Product.php:4524
26
SELECT SQL_NO_CACHE *
FROM `hgt78_currency` a
LEFT JOIN `hgt78_currency_lang` `b` ON a.`id_currency` = b.`id_currency` AND b.`id_lang` = 1
LEFT JOIN `hgt78_currency_shop` `c` ON a.`id_currency` = c.`id_currency` AND c.`id_shop` = 1
WHERE (a.`id_currency` = 1) LIMIT 1
0.591 ms 1 /src/Adapter/EntityMapper.php:71
492
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 182 LIMIT 1
0.591 ms 1 /classes/Product.php:5659
4523
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2661) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.591 ms 1 Yes Yes /classes/Product.php:4524
4723
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (7773) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.591 ms 1 Yes Yes /classes/Product.php:4524
95
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE `id_product` != 0 LIMIT 1
0.589 ms 22288 /classes/SpecificPrice.php:297
3919
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4943
ORDER BY `position`
0.589 ms 1 Yes /classes/Product.php:3545
4717
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (7943) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.589 ms 1 Yes Yes /classes/Product.php:4524
4750
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (9689) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.589 ms 1 Yes Yes /classes/Product.php:4524
4418
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 307 AND `id_shop` = 1
0.588 ms 6 /src/Adapter/EntityMapper.php:79
226
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 309 LIMIT 1
0.588 ms 1 /classes/Product.php:5659
3832
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3750
ORDER BY `position`
0.588 ms 1 Yes /classes/Product.php:3545
4098
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 7942) AND (b.`id_shop` = 1) LIMIT 1
0.588 ms 1 /src/Adapter/EntityMapper.php:71
4123
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 8392
ORDER BY `position`
0.586 ms 1 Yes /classes/Product.php:3545
4424
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 60) LIMIT 1
0.586 ms 1 /src/Adapter/EntityMapper.php:71
4726
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (8394) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.586 ms 1 Yes Yes /classes/Product.php:4524
1301
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2655)
0.585 ms 1 /classes/Product.php:3860
2126
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4966
ORDER BY f.position ASC
0.585 ms 5 Yes /classes/Product.php:6021
4772
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (10305) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.585 ms 1 Yes Yes /classes/Product.php:4524
417
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2694)
0.585 ms 1 /classes/Product.php:3860
4739
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (9321) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.584 ms 1 Yes Yes /classes/Product.php:4524
1441
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3099
AND image_shop.`cover` = 1 LIMIT 1
0.584 ms 1 /classes/Product.php:3570
23
SELECT SQL_NO_CACHE * FROM `hgt78_currency` c ORDER BY `iso_code` ASC
0.583 ms 2 Yes /classes/Currency.php:709
463
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2623 AND id_shop=1 LIMIT 1
0.583 ms 1 /classes/Product.php:6876
1007
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2637) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.583 ms 1 /classes/stock/StockAvailable.php:453
1060
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2628 AND id_shop=1 LIMIT 1
0.582 ms 1 /classes/Product.php:6876
1319
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.582 ms 1 /classes/Product.php:5659
1528
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2650
ORDER BY f.position ASC
0.582 ms 5 Yes /classes/Product.php:6021
1507
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2733
AND image_shop.`cover` = 1 LIMIT 1
0.581 ms 1 /classes/Product.php:3570
2515
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 6182
ORDER BY f.position ASC
0.581 ms 5 Yes /classes/Product.php:6021
4230
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 10069
ORDER BY `position`
0.581 ms 1 Yes /classes/Product.php:3545
4770
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (10303) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.581 ms 1 Yes Yes /classes/Product.php:4524
1937
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3806
ORDER BY f.position ASC
0.580 ms 5 Yes /classes/Product.php:6021
2300
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 5774)
0.580 ms 1 /classes/Product.php:3860
3505
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2774
ORDER BY `position`
0.580 ms 1 Yes /classes/Product.php:3545
1388
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3265
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.579 ms 0 /classes/SpecificPrice.php:259
4498
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (5136) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.579 ms 1 Yes Yes /classes/Product.php:4524
4448
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 79) LIMIT 1
0.579 ms 1 /src/Adapter/EntityMapper.php:71
76
SELECT SQL_NO_CACHE *
FROM `hgt78_carrier_lang`
WHERE `id_carrier` = 282 AND `id_shop` = 1
0.578 ms 198 /src/Adapter/EntityMapper.php:79
2093
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4963
ORDER BY f.position ASC
0.578 ms 5 Yes /classes/Product.php:6021
4759
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (10068) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.578 ms 1 Yes Yes /classes/Product.php:4524
507
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2770)
0.576 ms 1 /classes/Product.php:3860
889
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.576 ms 1 /classes/Product.php:5659
1785
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3755
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.576 ms 0 /classes/SpecificPrice.php:259
4043
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 6182
0.576 ms 1 /classes/Product.php:2902
4648
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3936) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.576 ms 1 Yes Yes /classes/Product.php:4524
1517
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2733
ORDER BY f.position ASC
0.575 ms 5 Yes /classes/Product.php:6021
1585
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.575 ms 1 /classes/Product.php:5659
3790
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3556
ORDER BY `position`
0.575 ms 1 Yes /classes/Product.php:3545
3827
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3748
0.575 ms 1 /classes/Product.php:2902
4761
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (10070) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.575 ms 1 Yes Yes /classes/Product.php:4524
1290
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2643)
0.575 ms 1 /classes/Product.php:3860
3699
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2658) AND (b.`id_shop` = 1) LIMIT 1
0.575 ms 1 /src/Adapter/EntityMapper.php:71
4003
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 6106
ORDER BY `position`
0.575 ms 1 Yes /classes/Product.php:3545
4126
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 8393
ORDER BY `position`
0.574 ms 1 Yes /classes/Product.php:3545
4582
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2649) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.574 ms 1 Yes Yes /classes/Product.php:4524
4734
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (8420) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.574 ms 1 Yes Yes /classes/Product.php:4524
4637
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3765) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.574 ms 1 Yes Yes /classes/Product.php:4524
4647
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3808) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.574 ms 1 Yes Yes /classes/Product.php:4524
4742
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (9325) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.574 ms 1 Yes Yes /classes/Product.php:4524
1066
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.573 ms 1 /classes/Product.php:5659
1451
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3099
ORDER BY f.position ASC
0.573 ms 5 Yes /classes/Product.php:6021
3975
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 5590) AND (b.`id_shop` = 1) LIMIT 1
0.573 ms 1 /src/Adapter/EntityMapper.php:71
401
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2893
AND image_shop.`cover` = 1 LIMIT 1
0.573 ms 1 /classes/Product.php:3570
1595
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3558
AND image_shop.`cover` = 1 LIMIT 1
0.573 ms 1 /classes/Product.php:3570
4030
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 6178
ORDER BY `position`
0.573 ms 1 Yes /classes/Product.php:3545
4107
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 7945) AND (b.`id_shop` = 1) LIMIT 1
0.573 ms 1 /src/Adapter/EntityMapper.php:71
219
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 5144)
0.572 ms 1 /classes/Product.php:3860
1147
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2626)
0.572 ms 1 /classes/Product.php:3860
1600
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3558)
0.572 ms 1 /classes/Product.php:3860
4272
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 12551
ORDER BY `position`
0.572 ms 1 Yes /classes/Product.php:3545
4585
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2646) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.572 ms 1 Yes Yes /classes/Product.php:4524
4645
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3806) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.572 ms 1 Yes Yes /classes/Product.php:4524
4754
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (9693) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.572 ms 1 Yes Yes /classes/Product.php:4524
1140
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2625 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2625 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.571 ms 0 /classes/Cart.php:1430
2992
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 9323
ORDER BY f.position ASC
0.571 ms 5 Yes /classes/Product.php:6021
3308
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 10299
ORDER BY f.position ASC
0.571 ms 5 Yes /classes/Product.php:6021
3472
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2893
ORDER BY `position`
0.571 ms 1 Yes /classes/Product.php:3545
4138
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 8397
ORDER BY `position`
0.571 ms 1 Yes /classes/Product.php:3545
4507
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2893) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.571 ms 1 Yes Yes /classes/Product.php:4524
4646
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3807) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.571 ms 1 Yes Yes /classes/Product.php:4524
4729
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (8397) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.571 ms 1 Yes Yes /classes/Product.php:4524
1840
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3765 LIMIT 1
0.570 ms 10 /classes/SpecificPrice.php:435
3844
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3754
ORDER BY `position`
0.570 ms 1 Yes /classes/Product.php:3545
2858
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 8396
ORDER BY f.position ASC
0.569 ms 5 Yes /classes/Product.php:6021
4722
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (7779) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.569 ms 1 Yes Yes /classes/Product.php:4524
3898
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4256
ORDER BY `position`
0.569 ms 1 Yes /classes/Product.php:3545
3976
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5590
ORDER BY `position`
0.569 ms 2 Yes /classes/Product.php:3545
2361
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 6047
ORDER BY f.position ASC
0.568 ms 5 Yes /classes/Product.php:6021
4405
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 261) LIMIT 1
0.568 ms 1 /src/Adapter/EntityMapper.php:71
4735
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (8975) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.568 ms 1 Yes Yes /classes/Product.php:4524
1135
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2625 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.568 ms 10 Yes /classes/SpecificPrice.php:576
4763
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (10072) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.568 ms 1 Yes Yes /classes/Product.php:4524
4767
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (10298) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.568 ms 1 Yes Yes /classes/Product.php:4524
1384
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3264
ORDER BY f.position ASC
0.567 ms 5 Yes /classes/Product.php:6021
2692
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 7938
ORDER BY f.position ASC
0.567 ms 5 Yes /classes/Product.php:6021
3524
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2690
0.567 ms 1 /classes/Product.php:2902
4520
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2776) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.566 ms 1 Yes Yes /classes/Product.php:4524
4575
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2627) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.565 ms 1 Yes Yes /classes/Product.php:4524
3570
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3075) AND (b.`id_shop` = 1) LIMIT 1
0.565 ms 1 /src/Adapter/EntityMapper.php:71
4664
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (5266) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.565 ms 1 Yes Yes /classes/Product.php:4524
4485
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (6727) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.564 ms 1 Yes Yes /classes/Product.php:4524
4758
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (10067) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.564 ms 1 Yes Yes /classes/Product.php:4524
1273
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2646
ORDER BY f.position ASC
0.564 ms 5 Yes /classes/Product.php:6021
3136
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 9692
ORDER BY f.position ASC
0.563 ms 5 Yes /classes/Product.php:6021
3286
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 10297
ORDER BY f.position ASC
0.563 ms 5 Yes /classes/Product.php:6021
864
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2789 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2789 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.562 ms 0 /classes/Cart.php:1430
3319
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 10302
ORDER BY f.position ASC
0.562 ms 5 Yes /classes/Product.php:6021
246
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 5142
ORDER BY f.position ASC
0.561 ms 5 Yes /classes/Product.php:6021
2624
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 6193 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 6193 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.561 ms 0 /classes/Cart.php:1430
4733
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (8419) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.561 ms 1 Yes Yes /classes/Product.php:4524
2880
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 8401
ORDER BY f.position ASC
0.560 ms 5 Yes /classes/Product.php:6021
4710
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (6499) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.560 ms 1 Yes Yes /classes/Product.php:4524
2769
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 7946
ORDER BY f.position ASC
0.559 ms 5 Yes /classes/Product.php:6021
4165
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 9306
ORDER BY `position`
0.559 ms 1 Yes /classes/Product.php:3545
4712
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (6501) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.559 ms 1 Yes Yes /classes/Product.php:4524
2150
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 5267
AND image_shop.`cover` = 1 LIMIT 1
0.558 ms 1 /classes/Product.php:3570
4401
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 163) LIMIT 1
0.558 ms 1 /src/Adapter/EntityMapper.php:71
3401
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 7539
0.558 ms 1 /classes/Product.php:2902
4411
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 264) LIMIT 1
0.558 ms 1 /src/Adapter/EntityMapper.php:71
4445
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 61 AND `id_shop` = 1
0.558 ms 6 /src/Adapter/EntityMapper.php:79
3841
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3753
ORDER BY `position`
0.557 ms 1 Yes /classes/Product.php:3545
3705
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2646) AND (b.`id_shop` = 1) LIMIT 1
0.556 ms 1 /src/Adapter/EntityMapper.php:71
4065
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 6191) AND (b.`id_shop` = 1) LIMIT 1
0.556 ms 1 /src/Adapter/EntityMapper.php:71
1709
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3748 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.556 ms 10 Yes /classes/SpecificPrice.php:576
1738
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3751
AND image_shop.`cover` = 1 LIMIT 1
0.556 ms 1 /classes/Product.php:3570
1854
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3766)
0.556 ms 1 /classes/Product.php:3860
3691
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2657
ORDER BY `position`
0.556 ms 1 Yes /classes/Product.php:3545
4231
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 10069
0.556 ms 1 /classes/Product.php:2902
1246
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2658)
0.555 ms 1 /classes/Product.php:3860
4531
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2777) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.555 ms 1 Yes Yes /classes/Product.php:4524
4500
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (5134) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.555 ms 1 Yes Yes /classes/Product.php:4524
1616
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3559
ORDER BY f.position ASC
0.554 ms 5 Yes /classes/Product.php:6021
2947
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 9055
AND image_shop.`cover` = 1 LIMIT 1
0.554 ms 1 /classes/Product.php:3570
3204
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 10068
ORDER BY f.position ASC
0.553 ms 5 Yes /classes/Product.php:6021
955
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.552 ms 1 /classes/Product.php:5659
2770
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 7769
AND image_shop.`cover` = 1 LIMIT 1
0.552 ms 1 /classes/Product.php:3570
2981
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 9321
ORDER BY f.position ASC
0.552 ms 5 Yes /classes/Product.php:6021
3252
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 10072
ORDER BY f.position ASC
0.552 ms 5 Yes /classes/Product.php:6021
3702
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2647) AND (b.`id_shop` = 1) LIMIT 1
0.552 ms 1 /src/Adapter/EntityMapper.php:71
4284
SELECT SQL_NO_CACHE 1 FROM `hgt78_cart_rule` WHERE ((date_to >= "2025-05-01 00:00:00" AND date_to <= "2025-05-01 23:59:59") OR (date_from >= "2025-05-01 00:00:00" AND date_from <= "2025-05-01 23:59:59") OR (date_from < "2025-05-01 00:00:00" AND date_to > "2025-05-01 23:59:59")) AND `id_customer` IN (0,0) LIMIT 1
0.552 ms 29 /classes/CartRule.php:357
529
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2774)
0.551 ms 1 /classes/Product.php:3860
1843
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3765)
0.551 ms 1 /classes/Product.php:3860
4269
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 12552
ORDER BY `position`
0.551 ms 1 Yes /classes/Product.php:3545
4643
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3804) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.551 ms 1 Yes Yes /classes/Product.php:4524
2869
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 8397
ORDER BY f.position ASC
0.550 ms 5 Yes /classes/Product.php:6021
4066
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 6191
ORDER BY `position`
0.550 ms 1 Yes /classes/Product.php:3545
1915
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3804
ORDER BY f.position ASC
0.550 ms 5 Yes /classes/Product.php:6021
873
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2790 AND `id_group` = 1 LIMIT 1
0.549 ms 0 /classes/GroupReduction.php:156
1363
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3256
AND image_shop.`cover` = 1 LIMIT 1
0.549 ms 1 /classes/Product.php:3570
1487
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2490 LIMIT 1
0.549 ms 10 /classes/SpecificPrice.php:435
2261
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 5589
ORDER BY f.position ASC
0.549 ms 5 Yes /classes/Product.php:6021
2925
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 8975
AND image_shop.`cover` = 1 LIMIT 1
0.549 ms 1 /classes/Product.php:3570
1442
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.549 ms 1 /classes/Product.php:5659
1674
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3745 LIMIT 1
0.548 ms 10 /classes/SpecificPrice.php:435
1818
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3763 LIMIT 1
0.548 ms 11 /classes/SpecificPrice.php:435
4442
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 33) LIMIT 1
0.548 ms 1 /src/Adapter/EntityMapper.php:71
4709
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (6195) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.548 ms 1 Yes Yes /classes/Product.php:4524
2026
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4934
ORDER BY f.position ASC
0.547 ms 5 Yes /classes/Product.php:6021
4740
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (9323) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.547 ms 1 Yes Yes /classes/Product.php:4524
1587
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3557
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.546 ms 0 /classes/SpecificPrice.php:259
1832
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3764)
0.546 ms 1 /classes/Product.php:3860
1921
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3805)
0.546 ms 1 /classes/Product.php:3860
4156
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 8975
ORDER BY `position`
0.546 ms 1 Yes /classes/Product.php:3545
1688
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3746)
0.545 ms 1 /classes/Product.php:3860
4736
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (8976) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.545 ms 1 Yes Yes /classes/Product.php:4524
2836
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 8394
ORDER BY f.position ASC
0.544 ms 5 Yes /classes/Product.php:6021
1573
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3556
AND image_shop.`cover` = 1 LIMIT 1
0.543 ms 1 /classes/Product.php:3570
1130
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2624
ORDER BY f.position ASC
0.543 ms 5 Yes /classes/Product.php:6021
2825
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 8393
ORDER BY f.position ASC
0.542 ms 5 Yes /classes/Product.php:6021
2899
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 8418 AND `id_group` = 1 LIMIT 1
0.542 ms 0 /classes/GroupReduction.php:156
2082
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4962
ORDER BY f.position ASC
0.542 ms 5 Yes /classes/Product.php:6021
2924
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 8420
ORDER BY f.position ASC
0.542 ms 5 Yes /classes/Product.php:6021
4215
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 9694
ORDER BY `position`
0.542 ms 1 Yes /classes/Product.php:3545
2451
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 182 LIMIT 1
0.541 ms 1 /classes/Product.php:5659
3058
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 9598
ORDER BY f.position ASC
0.541 ms 5 Yes /classes/Product.php:6021
3553
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2795
ORDER BY `position`
0.541 ms 1 Yes /classes/Product.php:3545
4153
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 8420
ORDER BY `position`
0.541 ms 1 Yes /classes/Product.php:3545
1792
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3755
ORDER BY f.position ASC
0.540 ms 5 Yes /classes/Product.php:6021
3114
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 9690
ORDER BY f.position ASC
0.540 ms 5 Yes /classes/Product.php:6021
3320
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 10303
AND image_shop.`cover` = 1 LIMIT 1
0.540 ms 1 /classes/Product.php:3570
4732
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (8418) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.540 ms 1 Yes Yes /classes/Product.php:4524
611
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2691
ORDER BY f.position ASC
0.539 ms 5 Yes /classes/Product.php:6021
1263
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2646
AND image_shop.`cover` = 1 LIMIT 1
0.539 ms 1 /classes/Product.php:3570
1281
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2642 AND `id_group` = 1 LIMIT 1
0.539 ms 0 /classes/GroupReduction.php:156
2349
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 5973
ORDER BY f.position ASC
0.539 ms 5 Yes /classes/Product.php:6021
2764
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 7946)
0.539 ms 1 /classes/Product.php:3860
3540
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2764) AND (b.`id_shop` = 1) LIMIT 1
0.539 ms 1 /src/Adapter/EntityMapper.php:71
4599
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2818) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.539 ms 1 Yes Yes /classes/Product.php:4524
4741
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (9324) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.539 ms 1 Yes Yes /classes/Product.php:4524
1240
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2649
ORDER BY f.position ASC
0.539 ms 5 Yes /classes/Product.php:6021
3550
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2779
ORDER BY `position`
0.539 ms 1 Yes /classes/Product.php:3545
1382
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3264) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.538 ms 1 /classes/stock/StockAvailable.php:453
4635
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3763) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.538 ms 1 Yes Yes /classes/Product.php:4524
160
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 6727 LIMIT 1
0.537 ms 10 /classes/SpecificPrice.php:435
1377
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3264
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.537 ms 0 /classes/SpecificPrice.php:259
1006
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2637 AND `id_group` = 1 LIMIT 1
0.536 ms 0 /classes/GroupReduction.php:156
2356
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 6047)
0.536 ms 1 /classes/Product.php:3860
3264
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 10073
ORDER BY f.position ASC
0.536 ms 5 Yes /classes/Product.php:6021
4403
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 260) LIMIT 1
0.536 ms 1 /src/Adapter/EntityMapper.php:71
523
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2773
ORDER BY f.position ASC
0.535 ms 5 Yes /classes/Product.php:6021
1462
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3107
ORDER BY f.position ASC
0.535 ms 5 Yes /classes/Product.php:6021
2725
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 7942
ORDER BY f.position ASC
0.535 ms 5 Yes /classes/Product.php:6021
1385
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3265
AND image_shop.`cover` = 1 LIMIT 1
0.534 ms 1 /classes/Product.php:3570
3352
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 10305
ORDER BY f.position ASC
0.533 ms 5 Yes /classes/Product.php:6021
32
SELECT SQL_NO_CACHE *
FROM `hgt78_currency` a
LEFT JOIN `hgt78_currency_shop` `c` ON a.`id_currency` = c.`id_currency` AND c.`id_shop` = 1
WHERE (a.`id_currency` = 1) LIMIT 1
0.532 ms 1 /src/Adapter/EntityMapper.php:71
2581
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 6188
ORDER BY f.position ASC
0.532 ms 5 Yes /classes/Product.php:6021
1233
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2649
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.531 ms 0 /classes/SpecificPrice.php:259
1113
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3458 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.531 ms 10 Yes /classes/SpecificPrice.php:576
2477
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 6179)
0.531 ms 1 /classes/Product.php:3860
2537
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 6184
ORDER BY f.position ASC
0.531 ms 5 Yes /classes/Product.php:6021
648
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2738 LIMIT 1
0.530 ms 11 /classes/SpecificPrice.php:435
1893
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3777
AND image_shop.`cover` = 1 LIMIT 1
0.530 ms 2 /classes/Product.php:3570
3216
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 10069
ORDER BY f.position ASC
0.530 ms 5 Yes /classes/Product.php:6021
3739
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3265
ORDER BY `position`
0.529 ms 1 Yes /classes/Product.php:3545
2412
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 6172 AND id_shop=1 LIMIT 1
0.528 ms 1 /classes/Product.php:6876
2936
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 8976
AND image_shop.`cover` = 1 LIMIT 1
0.528 ms 1 /classes/Product.php:3570
3147
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 9693
ORDER BY f.position ASC
0.528 ms 5 Yes /classes/Product.php:6021
274
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 5139)
0.528 ms 1 /classes/Product.php:3860
1759
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3752
ORDER BY f.position ASC
0.527 ms 5 Yes /classes/Product.php:6021
2504
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 6181
ORDER BY f.position ASC
0.527 ms 5 Yes /classes/Product.php:6021
4565
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2629) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.527 ms 1 Yes Yes /classes/Product.php:4524
1590
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3557 AND id_shop=1 LIMIT 1
0.526 ms 1 /classes/Product.php:6876
3400
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 7539
ORDER BY `position`
0.526 ms 1 Yes /classes/Product.php:3545
1214
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2657 AND id_shop=1 LIMIT 1
0.525 ms 1 /classes/Product.php:6876
1737
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3750
ORDER BY f.position ASC
0.525 ms 5 Yes /classes/Product.php:6021
4162
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 9055
ORDER BY `position`
0.525 ms 1 Yes /classes/Product.php:3545
4766
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (10297) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.525 ms 1 Yes Yes /classes/Product.php:4524
1446
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3099)
0.524 ms 1 /classes/Product.php:3860
3070
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 9687
ORDER BY f.position ASC
0.524 ms 5 Yes /classes/Product.php:6021
1970
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3936
ORDER BY f.position ASC
0.524 ms 5 Yes /classes/Product.php:6021
3448
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5135
ORDER BY `position`
0.523 ms 1 Yes /classes/Product.php:3545
2272
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 5590
ORDER BY f.position ASC
0.523 ms 5 Yes /classes/Product.php:6021
2592
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 6189
ORDER BY f.position ASC
0.522 ms 5 Yes /classes/Product.php:6021
3341
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 10304
ORDER BY f.position ASC
0.522 ms 5 Yes /classes/Product.php:6021
4206
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 9691
ORDER BY `position`
0.522 ms 1 Yes /classes/Product.php:3545
4437
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 196 AND `id_shop` = 1
0.522 ms 6 /src/Adapter/EntityMapper.php:79
3409
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5147
ORDER BY `position`
0.521 ms 1 Yes /classes/Product.php:3545
1714
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3748 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3748 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.521 ms 0 /classes/Cart.php:1430
1821
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3763)
0.521 ms 1 /classes/Product.php:3860
3014
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 9325
ORDER BY f.position ASC
0.521 ms 5 Yes /classes/Product.php:6021
4416
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 266 AND `id_shop` = 1
0.521 ms 6 /src/Adapter/EntityMapper.php:79
975
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2634
ORDER BY f.position ASC
0.520 ms 5 Yes /classes/Product.php:6021
1770
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3753
ORDER BY f.position ASC
0.520 ms 5 Yes /classes/Product.php:6021
2470
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 6178 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 6178 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.520 ms 0 /classes/Cart.php:1430
3586
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2781
ORDER BY `position`
0.520 ms 1 Yes /classes/Product.php:3545
4489
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (5145) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.520 ms 1 Yes Yes /classes/Product.php:4524
74
SELECT SQL_NO_CACHE `id_module` FROM `hgt78_module` WHERE `name` = "colissimo_simplicite" LIMIT 1
0.519 ms 1 /classes/module/Module.php:2664
971
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2634 AND id_shop=1 LIMIT 1
0.519 ms 1 /classes/Product.php:6876
2375
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 6107 LIMIT 1
0.519 ms 10 /classes/SpecificPrice.php:435
3391
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 7542
ORDER BY `position`
0.519 ms 1 Yes /classes/Product.php:3545
4039
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 6181
ORDER BY `position`
0.519 ms 1 Yes /classes/Product.php:3545
370
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3741 LIMIT 1
0.518 ms 10 /classes/SpecificPrice.php:435
1715
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3748
ORDER BY f.position ASC
0.518 ms 5 Yes /classes/Product.php:6021
91
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 185 LIMIT 1
0.518 ms 1 /classes/Product.php:5659
677
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2777 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2777 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.518 ms 0 /classes/Cart.php:1430
860
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2789)
0.518 ms 1 /classes/Product.php:3860
3036
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 9596
ORDER BY f.position ASC
0.517 ms 5 Yes /classes/Product.php:6021
3819
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3746) AND (b.`id_shop` = 1) LIMIT 1
0.517 ms 1 /src/Adapter/EntityMapper.php:71
292
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 309 LIMIT 1
0.517 ms 1 /classes/Product.php:5659
1392
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3265 AND `id_group` = 1 LIMIT 1
0.517 ms 0 /classes/GroupReduction.php:156
3760
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3132
ORDER BY `position`
0.517 ms 1 Yes /classes/Product.php:3545
4275
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 11001
ORDER BY `position`
0.517 ms 3 Yes /classes/Product.php:3545
4129
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 8394
ORDER BY `position`
0.515 ms 1 Yes /classes/Product.php:3545
1206
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2648 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2648 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.515 ms 0 /classes/Cart.php:1430
1444
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3099
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.515 ms 0 /classes/SpecificPrice.php:259
3192
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 10067
ORDER BY f.position ASC
0.515 ms 5 Yes /classes/Product.php:6021
451
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2651)
0.514 ms 1 /classes/Product.php:3860
1486
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.514 ms 1 /classes/Product.php:5659
2327
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 5971
ORDER BY f.position ASC
0.514 ms 5 Yes /classes/Product.php:6021
2814
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 8392
ORDER BY f.position ASC
0.514 ms 5 Yes /classes/Product.php:6021
3907
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4932
ORDER BY `position`
0.514 ms 1 Yes /classes/Product.php:3545
290
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 5138
ORDER BY f.position ASC
0.514 ms 5 Yes /classes/Product.php:6021
1534
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2654)
0.513 ms 1 /classes/Product.php:3860
3442
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5137
ORDER BY `position`
0.513 ms 1 Yes /classes/Product.php:3545
4224
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 10067
ORDER BY `position`
0.513 ms 1 Yes /classes/Product.php:3545
4738
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (9306) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.513 ms 1 Yes Yes /classes/Product.php:4524
2305
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 5774
ORDER BY f.position ASC
0.512 ms 5 Yes /classes/Product.php:6021
1703
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3747 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3747 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.512 ms 0 /classes/Cart.php:1430
3297
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 10298
ORDER BY f.position ASC
0.512 ms 5 Yes /classes/Product.php:6021
3697
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2649
ORDER BY `position`
0.512 ms 1 Yes /classes/Product.php:3545
2037
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4935
ORDER BY f.position ASC
0.511 ms 5 Yes /classes/Product.php:6021
849
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2788)
0.511 ms 1 /classes/Product.php:3860
1803
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3756
ORDER BY f.position ASC
0.511 ms 5 Yes /classes/Product.php:6021
2602
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 6191 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 6191 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.511 ms 0 /classes/Cart.php:1430
296
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 5137)
0.510 ms 1 /classes/Product.php:3860
4267
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 10305
0.510 ms 1 /classes/Product.php:2902
543
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2775) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.509 ms 1 /classes/stock/StockAvailable.php:453
2071
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4944
ORDER BY f.position ASC
0.509 ms 5 Yes /classes/Product.php:6021
2680
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 6501
ORDER BY f.position ASC
0.509 ms 5 Yes /classes/Product.php:6021
1979
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4256) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.509 ms 1 /classes/stock/StockAvailable.php:453
3592
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2788
ORDER BY `position`
0.509 ms 1 Yes /classes/Product.php:3545
1473
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3132
ORDER BY f.position ASC
0.508 ms 5 Yes /classes/Product.php:6021
2110
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4965)
0.508 ms 1 /classes/Product.php:3860
2736
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 7943
ORDER BY f.position ASC
0.508 ms 5 Yes /classes/Product.php:6021
3673
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2626
ORDER BY `position`
0.508 ms 1 Yes /classes/Product.php:3545
3421
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5144
ORDER BY `position`
0.507 ms 1 Yes /classes/Product.php:3545
4060
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 6188
ORDER BY `position`
0.507 ms 1 Yes /classes/Product.php:3545
1710
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3748)
0.507 ms 1 /classes/Product.php:3860
3275
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 10111
ORDER BY f.position ASC
0.507 ms 5 Yes /classes/Product.php:6021
4009
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 6108
ORDER BY `position`
0.507 ms 1 Yes /classes/Product.php:3545
2693
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 7940
AND image_shop.`cover` = 1 LIMIT 1
0.506 ms 1 /classes/Product.php:3570
4220
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 9697) AND (b.`id_shop` = 1) LIMIT 1
0.506 ms 1 /src/Adapter/EntityMapper.php:71
410
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2893 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2893 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.506 ms 0 /classes/Cart.php:1430
1318
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2645
AND image_shop.`cover` = 1 LIMIT 1
0.506 ms 1 /classes/Product.php:3570
1907
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3804 LIMIT 1
0.506 ms 10 /classes/SpecificPrice.php:435
2215
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 5296
ORDER BY f.position ASC
0.506 ms 5 Yes /classes/Product.php:6021
3228
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 10070
ORDER BY f.position ASC
0.506 ms 5 Yes /classes/Product.php:6021
2891
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 8417
ORDER BY f.position ASC
0.505 ms 5 Yes /classes/Product.php:6021
3386
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 11001
ORDER BY f.position ASC
0.505 ms 5 Yes /classes/Product.php:6021
4480
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (7543) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.505 ms 1 Yes Yes /classes/Product.php:4524
440
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2652)
0.504 ms 1 /classes/Product.php:3860
1959
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3808
ORDER BY f.position ASC
0.504 ms 5 Yes /classes/Product.php:6021
2423
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 6173 AND id_shop=1 LIMIT 1
0.504 ms 1 /classes/Product.php:6876
2713
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 7941 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 7941 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.504 ms 0 /classes/Cart.php:1430
3736
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3264
ORDER BY `position`
0.504 ms 1 Yes /classes/Product.php:3545
3820
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3746
ORDER BY `position`
0.504 ms 1 Yes /classes/Product.php:3545
4117
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 7779
ORDER BY `position`
0.504 ms 1 Yes /classes/Product.php:3545
4168
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 9321
ORDER BY `position`
0.504 ms 1 Yes /classes/Product.php:3545
4171
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 9323
ORDER BY `position`
0.504 ms 1 Yes /classes/Product.php:3545
4440
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 33) AND (b.`id_shop` = 1) LIMIT 1
0.504 ms 1 /src/Adapter/EntityMapper.php:71
1395
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3265
ORDER BY f.position ASC
0.503 ms 5 Yes /classes/Product.php:6021
2625
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 6193
ORDER BY f.position ASC
0.503 ms 5 Yes /classes/Product.php:6021
1668
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3689 AND `id_group` = 1 LIMIT 1
0.502 ms 0 /classes/GroupReduction.php:156
4083
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 6500) AND (b.`id_shop` = 1) LIMIT 1
0.502 ms 1 /src/Adapter/EntityMapper.php:71
225
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 5143
AND image_shop.`cover` = 1 LIMIT 1
0.502 ms 1 /classes/Product.php:3570
4147
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 8418
ORDER BY `position`
0.502 ms 1 Yes /classes/Product.php:3545
3092
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 9688
ORDER BY f.position ASC
0.501 ms 5 Yes /classes/Product.php:6021
496
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2769)
0.500 ms 1 /classes/Product.php:3860
1173
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2640 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2640 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.500 ms 0 /classes/Cart.php:1430
1572
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3484
ORDER BY f.position ASC
0.500 ms 5 Yes /classes/Product.php:6021
2647
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 6195
ORDER BY f.position ASC
0.500 ms 5 Yes /classes/Product.php:6021
2753
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 7945)
0.499 ms 1 /classes/Product.php:3860
2938
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 8976 LIMIT 1
0.499 ms 16 /classes/SpecificPrice.php:435
3823
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3747
ORDER BY `position`
0.499 ms 1 Yes /classes/Product.php:3545
1424
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2818)
0.499 ms 1 /classes/Product.php:3860
1251
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2658
ORDER BY f.position ASC
0.498 ms 5 Yes /classes/Product.php:6021
2060
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4943
ORDER BY f.position ASC
0.498 ms 5 Yes /classes/Product.php:6021
3430
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5141
ORDER BY `position`
0.498 ms 1 Yes /classes/Product.php:3545
255
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 5141) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.497 ms 1 /classes/stock/StockAvailable.php:453
995
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2636 AND `id_group` = 1 LIMIT 1
0.497 ms 0 /classes/GroupReduction.php:156
1331
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 95 LIMIT 1
0.497 ms 1 /classes/Product.php:5659
3598
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2790
ORDER BY `position`
0.497 ms 1 Yes /classes/Product.php:3545
1194
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2656) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.497 ms 1 /classes/stock/StockAvailable.php:453
1042
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2630
ORDER BY f.position ASC
0.496 ms 5 Yes /classes/Product.php:6021
2249
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 5093
ORDER BY f.position ASC
0.496 ms 5 Yes /classes/Product.php:6021
3158
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 9694
ORDER BY f.position ASC
0.496 ms 5 Yes /classes/Product.php:6021
3757
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3107
ORDER BY `position`
0.495 ms 1 Yes /classes/Product.php:3545
2870
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 8401
AND image_shop.`cover` = 1 LIMIT 1
0.495 ms 1 /classes/Product.php:3570
3169
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 9695
ORDER BY f.position ASC
0.495 ms 5 Yes /classes/Product.php:6021
2015
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4932
ORDER BY f.position ASC
0.494 ms 5 Yes /classes/Product.php:6021
3503
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2773
0.494 ms 1 /classes/Product.php:2902
379
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3740
AND image_shop.`cover` = 1 LIMIT 1
0.493 ms 1 /classes/Product.php:3570
2133
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 5265)
0.493 ms 1 /classes/Product.php:3860
2781
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 7769
ORDER BY f.position ASC
0.493 ms 5 Yes /classes/Product.php:6021
2311
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 5970)
0.493 ms 1 /classes/Product.php:3860
1349
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3254) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.492 ms 1 /classes/stock/StockAvailable.php:453
1781
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3754
ORDER BY f.position ASC
0.492 ms 5 Yes /classes/Product.php:6021
2049
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4942
ORDER BY f.position ASC
0.492 ms 5 Yes /classes/Product.php:6021
3364
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 12552
ORDER BY f.position ASC
0.492 ms 5 Yes /classes/Product.php:6021
3997
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5973
ORDER BY `position`
0.492 ms 1 Yes /classes/Product.php:3545
1257
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2647)
0.492 ms 1 /classes/Product.php:3860
1292
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2643 AND `id_group` = 1 LIMIT 1
0.492 ms 0 /classes/GroupReduction.php:156
1605
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3558
ORDER BY f.position ASC
0.492 ms 5 Yes /classes/Product.php:6021
3970
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5093
ORDER BY `position`
0.492 ms 4 Yes /classes/Product.php:3545
821
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2780
ORDER BY f.position ASC
0.491 ms 5 Yes /classes/Product.php:6021
3388
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 7543
ORDER BY `position`
0.491 ms 1 Yes /classes/Product.php:3545
4132
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 8395
ORDER BY `position`
0.491 ms 1 Yes /classes/Product.php:3545
308
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 5136 AND id_shop=1 LIMIT 1
0.491 ms 1 /classes/Product.php:6876
3601
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2791
ORDER BY `position`
0.491 ms 1 Yes /classes/Product.php:3545
3871
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3775
ORDER BY `position`
0.491 ms 2 Yes /classes/Product.php:3545
3796
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3558
ORDER BY `position`
0.490 ms 1 Yes /classes/Product.php:3545
2238
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 5350
ORDER BY f.position ASC
0.489 ms 5 Yes /classes/Product.php:6021
2449
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 6176
ORDER BY f.position ASC
0.489 ms 5 Yes /classes/Product.php:6021
2526
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 6183
ORDER BY f.position ASC
0.489 ms 5 Yes /classes/Product.php:6021
3955
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5284
ORDER BY `position`
0.489 ms 2 Yes /classes/Product.php:3545
2792
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 7779
ORDER BY f.position ASC
0.488 ms 5 Yes /classes/Product.php:6021
3047
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 9597
ORDER BY f.position ASC
0.488 ms 5 Yes /classes/Product.php:6021
3838
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3752
ORDER BY `position`
0.488 ms 1 Yes /classes/Product.php:3545
4402
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 163 AND `id_shop` = 1
0.488 ms 6 /src/Adapter/EntityMapper.php:79
4443
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 33 AND `id_shop` = 1
0.488 ms 6 /src/Adapter/EntityMapper.php:79
4524
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2690) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.488 ms 1 Yes Yes /classes/Product.php:4524
130
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 7541)
0.487 ms 1 /classes/Product.php:3860
1583
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3556
ORDER BY f.position ASC
0.487 ms 5 Yes /classes/Product.php:6021
1948
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3807
ORDER BY f.position ASC
0.487 ms 5 Yes /classes/Product.php:6021
3125
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 9691
ORDER BY f.position ASC
0.487 ms 5 Yes /classes/Product.php:6021
3925
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4962
ORDER BY `position`
0.487 ms 1 Yes /classes/Product.php:3545
855
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2789
AND image_shop.`cover` = 1 LIMIT 1
0.487 ms 1 /classes/Product.php:3570
1680
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3745) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.487 ms 1 /classes/stock/StockAvailable.php:453
277
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 5139) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.486 ms 1 /classes/stock/StockAvailable.php:453
1252
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2647
AND image_shop.`cover` = 1 LIMIT 1
0.486 ms 1 /classes/Product.php:3570
1814
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3757
ORDER BY f.position ASC
0.486 ms 5 Yes /classes/Product.php:6021
2639
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 6195 LIMIT 1
0.486 ms 10 /classes/SpecificPrice.php:435
1617
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3584
AND image_shop.`cover` = 1 LIMIT 1
0.485 ms 1 /classes/Product.php:3570
3712
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2643
ORDER BY `position`
0.485 ms 1 Yes /classes/Product.php:3545
4114
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 7769
ORDER BY `position`
0.485 ms 1 Yes /classes/Product.php:3545
5
SELECT SQL_NO_CACHE su.physical_uri, su.virtual_uri, su.domain, su.domain_ssl
FROM hgt78_shop s
LEFT JOIN hgt78_shop_url su ON (s.id_shop = su.id_shop)
WHERE s.id_shop = 1
AND s.active = 1 AND s.deleted = 0 AND su.main = 1 LIMIT 1
0.484 ms 1 /classes/shop/Shop.php:218
2559
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 6186
ORDER BY f.position ASC
0.484 ms 5 Yes /classes/Product.php:6021
3670
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2625
ORDER BY `position`
0.484 ms 1 Yes /classes/Product.php:3545
4211
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 9693) AND (b.`id_shop` = 1) LIMIT 1
0.484 ms 1 /src/Adapter/EntityMapper.php:71
1306
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2655
ORDER BY f.position ASC
0.483 ms 5 Yes /classes/Product.php:6021
2603
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 6191
ORDER BY f.position ASC
0.483 ms 5 Yes /classes/Product.php:6021
1037
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2630)
0.482 ms 1 /classes/Product.php:3860
4184
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 9596
0.482 ms 1 /classes/Product.php:2902
1359
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3255 AND `id_group` = 1 LIMIT 1
0.482 ms 0 /classes/GroupReduction.php:156
2283
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 5591
ORDER BY f.position ASC
0.482 ms 5 Yes /classes/Product.php:6021
3375
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 12551
ORDER BY f.position ASC
0.482 ms 5 Yes /classes/Product.php:6021
689
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2778
ORDER BY f.position ASC
0.481 ms 5 Yes /classes/Product.php:6021
2669
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 6500
ORDER BY f.position ASC
0.481 ms 5 Yes /classes/Product.php:6021
177
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 5148 AND `id_group` = 1 LIMIT 1
0.481 ms 0 /classes/GroupReduction.php:156
3811
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3639
ORDER BY `position`
0.481 ms 1 Yes /classes/Product.php:3545
3904
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4575
ORDER BY `position`
0.481 ms 1 Yes /classes/Product.php:3545
1282
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2642) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.480 ms 1 /classes/stock/StockAvailable.php:453
3580
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2793
ORDER BY `position`
0.480 ms 1 Yes /classes/Product.php:3545
4080
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 6499) AND (b.`id_shop` = 1) LIMIT 1
0.480 ms 1 /src/Adapter/EntityMapper.php:71
1083
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2620 AND `id_group` = 1 LIMIT 1
0.480 ms 0 /classes/GroupReduction.php:156
2193
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 5284
ORDER BY f.position ASC
0.480 ms 5 Yes /classes/Product.php:6021
3509
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2775
0.480 ms 1 /classes/Product.php:2902
4227
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 10068
ORDER BY `position`
0.480 ms 1 Yes /classes/Product.php:3545
518
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2773)
0.479 ms 1 /classes/Product.php:3860
1001
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2637 LIMIT 1
0.479 ms 10 /classes/SpecificPrice.php:435
1683
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3746
AND image_shop.`cover` = 1 LIMIT 1
0.479 ms 1 /classes/Product.php:3570
2411
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 6172)
0.479 ms 1 /classes/Product.php:3860
3616
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2631
ORDER BY `position`
0.479 ms 1 Yes /classes/Product.php:3545
1034
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2630 LIMIT 1
0.478 ms 10 /classes/SpecificPrice.php:435
1641
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3586 LIMIT 1
0.478 ms 10 /classes/SpecificPrice.php:435
1908
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3804
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.478 ms 0 /classes/SpecificPrice.php:259
3473
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2893
0.478 ms 1 /classes/Product.php:2902
3607
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3177
ORDER BY `position`
0.478 ms 1 Yes /classes/Product.php:3545
4571
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3458) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.478 ms 1 Yes Yes /classes/Product.php:4524
2400
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 6129)
0.477 ms 1 /classes/Product.php:3860
2471
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 6178
ORDER BY f.position ASC
0.477 ms 5 Yes /classes/Product.php:6021
2847
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 8395
ORDER BY f.position ASC
0.477 ms 5 Yes /classes/Product.php:6021
3025
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 9535
ORDER BY f.position ASC
0.477 ms 5 Yes /classes/Product.php:6021
3120
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 9691)
0.477 ms 1 /classes/Product.php:3860
1387
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3265 LIMIT 1
0.477 ms 10 /classes/SpecificPrice.php:435
715
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2797
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.476 ms 0 /classes/SpecificPrice.php:259
3793
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3557
ORDER BY `position`
0.476 ms 1 Yes /classes/Product.php:3545
1435
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2892)
0.476 ms 1 /classes/Product.php:3860
1529
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2654
AND image_shop.`cover` = 1 LIMIT 1
0.476 ms 1 /classes/Product.php:3570
1981
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4256
ORDER BY f.position ASC
0.476 ms 5 Yes /classes/Product.php:6021
3684
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2656) AND (b.`id_shop` = 1) LIMIT 1
0.476 ms 1 /src/Adapter/EntityMapper.php:71
65
SELECT SQL_NO_CACHE `need_identification_number`
FROM `hgt78_country`
WHERE `id_country` = 8 LIMIT 1
0.475 ms 1 /classes/Country.php:405
999
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2637
AND image_shop.`cover` = 1 LIMIT 1
0.475 ms 1 /classes/Product.php:3570
1578
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3556)
0.475 ms 1 /classes/Product.php:3860
4245
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 10111
ORDER BY `position`
0.475 ms 2 Yes /classes/Product.php:3545
323
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 5135
ORDER BY f.position ASC
0.474 ms 5 Yes /classes/Product.php:6021
3180
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 9697
ORDER BY f.position ASC
0.474 ms 5 Yes /classes/Product.php:6021
3775
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2650
ORDER BY `position`
0.474 ms 1 Yes /classes/Product.php:3545
1653
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3639
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.473 ms 0 /classes/SpecificPrice.php:259
3658
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3459
ORDER BY `position`
0.473 ms 1 Yes /classes/Product.php:3545
4200
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 9689
ORDER BY `position`
0.472 ms 1 Yes /classes/Product.php:3545
2121
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4966)
0.472 ms 1 /classes/Product.php:3860
4233
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 10070
ORDER BY `position`
0.471 ms 1 Yes /classes/Product.php:3545
1567
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3484)
0.471 ms 1 /classes/Product.php:3860
3490
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2767
ORDER BY `position`
0.471 ms 1 Yes /classes/Product.php:3545
3676
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2627
ORDER BY `position`
0.471 ms 1 Yes /classes/Product.php:3545
1050
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2629 AND `id_group` = 1 LIMIT 1
0.470 ms 0 /classes/GroupReduction.php:156
1748
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3751
ORDER BY f.position ASC
0.470 ms 5 Yes /classes/Product.php:6021
491
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2769
AND image_shop.`cover` = 1 LIMIT 1
0.470 ms 1 /classes/Product.php:3570
3081
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 9686
ORDER BY f.position ASC
0.470 ms 5 Yes /classes/Product.php:6021
3829
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3749
ORDER BY `position`
0.470 ms 1 Yes /classes/Product.php:3545
3564
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2800) AND (b.`id_shop` = 1) LIMIT 1
0.469 ms 1 /src/Adapter/EntityMapper.php:71
280
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 5138
AND image_shop.`cover` = 1 LIMIT 1
0.469 ms 1 /classes/Product.php:3570
939
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2631 AND `id_group` = 1 LIMIT 1
0.469 ms 0 /classes/GroupReduction.php:156
1677
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3745)
0.469 ms 1 /classes/Product.php:3860
2406
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 6172
AND image_shop.`cover` = 1 LIMIT 1
0.469 ms 1 /classes/Product.php:3570
443
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2652) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.468 ms 1 /classes/stock/StockAvailable.php:453
487
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2768 AND `id_group` = 1 LIMIT 1
0.468 ms 0 /classes/GroupReduction.php:156
794
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2794)
0.468 ms 1 /classes/Product.php:3860
977
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `hgt78_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 183 LIMIT 1
0.468 ms 1 /classes/Category.php:1378
3567
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3178) AND (b.`id_shop` = 1) LIMIT 1
0.468 ms 1 /src/Adapter/EntityMapper.php:71
3577
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2794
ORDER BY `position`
0.468 ms 1 Yes /classes/Product.php:3545
3652
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3477
ORDER BY `position`
0.468 ms 1 Yes /classes/Product.php:3545
4423
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 59 AND `id_shop` = 1
0.468 ms 6 /src/Adapter/EntityMapper.php:79
1320
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2645 LIMIT 1
0.467 ms 10 /classes/SpecificPrice.php:435
3913
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4935
ORDER BY `position`
0.467 ms 1 Yes /classes/Product.php:3545
4572
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2624) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.467 ms 1 Yes Yes /classes/Product.php:4524
562
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2766)
0.466 ms 1 /classes/Product.php:3860
360
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3743
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.466 ms 0 /classes/SpecificPrice.php:259
956
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2633 LIMIT 1
0.466 ms 10 /classes/SpecificPrice.php:435
3543
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2777) AND (b.`id_shop` = 1) LIMIT 1
0.466 ms 1 /src/Adapter/EntityMapper.php:71
4087
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 6501
ORDER BY `position`
0.466 ms 1 Yes /classes/Product.php:3545
1088
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.465 ms 1 /classes/Product.php:5659
1633
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3585)
0.465 ms 1 /classes/Product.php:3860
3748
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2818
ORDER BY `position`
0.465 ms 1 Yes /classes/Product.php:3545
37
SELECT SQL_NO_CACHE id_shop
FROM `hgt78_group_shop`
WHERE `id_group` = 1
AND id_shop = 1 LIMIT 1
0.464 ms 1 /classes/ObjectModel.php:1729
3394
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 7541
ORDER BY `position`
0.464 ms 1 Yes /classes/Product.php:3545
3424
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5143
ORDER BY `position`
0.464 ms 1 Yes /classes/Product.php:3545
3583
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2780
ORDER BY `position`
0.464 ms 1 Yes /classes/Product.php:3545
4144
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 8417
ORDER BY `position`
0.464 ms 1 Yes /classes/Product.php:3545
4296
SELECT SQL_NO_CACHE *
FROM `hgt78_currency` c
INNER JOIN hgt78_currency_shop currency_shop
ON (currency_shop.id_currency = c.id_currency AND currency_shop.id_shop = 1)
WHERE c.`deleted` = 0 AND c.`active` = 1 ORDER BY `iso_code` ASC
0.464 ms 2 Yes /classes/Currency.php:694
4318
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 165 AND `id_shop` = 1
0.464 ms 6 /src/Adapter/EntityMapper.php:79
4325
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 50) LIMIT 1
0.464 ms 1 /src/Adapter/EntityMapper.php:71
840
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3179 AND `id_group` = 1 LIMIT 1
0.463 ms 0 /classes/GroupReduction.php:156
1162
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2627 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2627 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.463 ms 0 /classes/Cart.php:1430
1661
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3689
AND image_shop.`cover` = 1 LIMIT 1
0.463 ms 1 /classes/Product.php:3570
1725
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3749 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3749 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.463 ms 0 /classes/Cart.php:1430
2931
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 8975 AND id_shop=1 LIMIT 1
0.463 ms 1 /classes/Product.php:6876
4242
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 10073
ORDER BY `position`
0.463 ms 1 Yes /classes/Product.php:3545
970
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2634)
0.462 ms 1 /classes/Product.php:3860
3436
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5139
ORDER BY `position`
0.462 ms 1 Yes /classes/Product.php:3545
4417
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 307) LIMIT 1
0.462 ms 1 /src/Adapter/EntityMapper.php:71
3799
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3559
ORDER BY `position`
0.462 ms 1 Yes /classes/Product.php:3545
1773
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3754 LIMIT 1
0.461 ms 10 /classes/SpecificPrice.php:435
2171
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 5282
ORDER BY f.position ASC
0.461 ms 5 Yes /classes/Product.php:6021
3403
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 6727
ORDER BY `position`
0.461 ms 1 Yes /classes/Product.php:3545
2548
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 6185
ORDER BY f.position ASC
0.461 ms 5 Yes /classes/Product.php:6021
2842
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 8395)
0.461 ms 1 /classes/Product.php:3860
3397
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 7540
ORDER BY `position`
0.460 ms 1 Yes /classes/Product.php:3545
50
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 39) AND (b.`id_shop` = 1) LIMIT 1
0.459 ms 1 /src/Adapter/EntityMapper.php:71
982
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2782)
0.459 ms 1 /classes/Product.php:3860
3153
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 9694)
0.459 ms 1 /classes/Product.php:3860
373
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3741)
0.458 ms 1 /classes/Product.php:3860
1782
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3755
AND image_shop.`cover` = 1 LIMIT 1
0.458 ms 1 /classes/Product.php:3570
3292
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 10298)
0.458 ms 1 /classes/Product.php:3860
3802
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3584
ORDER BY `position`
0.458 ms 1 Yes /classes/Product.php:3545
11
SELECT SQL_NO_CACHE domain, domain_ssl
FROM hgt78_shop_url
WHERE main = 1
AND id_shop = 1 LIMIT 1
0.457 ms 1 /classes/shop/ShopUrl.php:182
138
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 7540 LIMIT 1
0.457 ms 10 /classes/SpecificPrice.php:435
3532
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2693
ORDER BY `position`
0.457 ms 1 Yes /classes/Product.php:3545
3649
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2628
ORDER BY `position`
0.457 ms 1 Yes /classes/Product.php:3545
3817
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3745
ORDER BY `position`
0.457 ms 1 Yes /classes/Product.php:3545
137
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 185 LIMIT 1
0.457 ms 1 /classes/Product.php:5659
2182
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 5283
ORDER BY f.position ASC
0.457 ms 5 Yes /classes/Product.php:6021
551
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2776)
0.456 ms 1 /classes/Product.php:3860
1845
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3765 AND `id_group` = 1 LIMIT 1
0.456 ms 0 /classes/GroupReduction.php:156
97
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE `to` BETWEEN '2025-05-01 00:00:00' AND '2025-05-01 23:59:59' LIMIT 1
0.456 ms 1 /classes/SpecificPrice.php:381
258
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 5140
AND image_shop.`cover` = 1 LIMIT 1
0.455 ms 1 /classes/Product.php:3570
2353
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 6047 LIMIT 1
0.455 ms 10 /classes/SpecificPrice.php:435
3574
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3176
ORDER BY `position`
0.455 ms 1 Yes /classes/Product.php:3545
3754
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3099
ORDER BY `position`
0.455 ms 1 Yes /classes/Product.php:3545
3808
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3586
ORDER BY `position`
0.454 ms 1 Yes /classes/Product.php:3545
4135
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 8396
ORDER BY `position`
0.454 ms 1 Yes /classes/Product.php:3545
358
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 185 LIMIT 1
0.454 ms 1 /classes/Product.php:5659
2227
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 5335
ORDER BY f.position ASC
0.454 ms 5 Yes /classes/Product.php:6021
3518
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2765
0.454 ms 1 /classes/Product.php:2902
482
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2768 LIMIT 1
0.453 ms 10 /classes/SpecificPrice.php:435
2359
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 6047) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.453 ms 1 /classes/stock/StockAvailable.php:453
3370
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 12551)
0.453 ms 1 /classes/Product.php:3860
4166
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 9306
0.453 ms 1 /classes/Product.php:2902
4505
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3740) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.453 ms 1 Yes Yes /classes/Product.php:4524
2105
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4965
AND image_shop.`cover` = 1 LIMIT 1
0.452 ms 1 /classes/Product.php:3570
2401
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 6129 AND id_shop=1 LIMIT 1
0.452 ms 1 /classes/Product.php:6876
3526
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2691
ORDER BY `position`
0.451 ms 1 Yes /classes/Product.php:3545
3535
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2771
ORDER BY `position`
0.451 ms 2 Yes /classes/Product.php:3545
3770
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2621
0.451 ms 1 /classes/Product.php:2902
1545
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3454)
0.451 ms 1 /classes/Product.php:3860
1694
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3747
AND image_shop.`cover` = 1 LIMIT 1
0.451 ms 1 /classes/Product.php:3570
2322
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 5971)
0.451 ms 1 /classes/Product.php:3860
2350
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 6047
AND image_shop.`cover` = 1 LIMIT 1
0.450 ms 1 /classes/Product.php:3570
1125
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2624)
0.449 ms 1 /classes/Product.php:3860
2127
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 5265
AND image_shop.`cover` = 1 LIMIT 1
0.449 ms 1 /classes/Product.php:3570
3433
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5140
ORDER BY `position`
0.449 ms 1 Yes /classes/Product.php:3545
3628
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2782
ORDER BY `position`
0.449 ms 1 Yes /classes/Product.php:3545
1932
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3806)
0.448 ms 1 /classes/Product.php:3860
2292
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 5592) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.448 ms 1 /classes/stock/StockAvailable.php:453
2495
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 182 LIMIT 1
0.448 ms 1 /classes/Product.php:5659
3418
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5145
ORDER BY `position`
0.448 ms 1 Yes /classes/Product.php:3545
3538
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2738
ORDER BY `position`
0.448 ms 1 Yes /classes/Product.php:3545
4108
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 7945
ORDER BY `position`
0.448 ms 1 Yes /classes/Product.php:3545
1625
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3584) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.447 ms 1 /classes/stock/StockAvailable.php:453
2139
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 5266
AND image_shop.`cover` = 1 LIMIT 1
0.447 ms 1 /classes/Product.php:3570
2731
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 7943)
0.447 ms 1 /classes/Product.php:3860
2948
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `hgt78_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 176 LIMIT 1
0.447 ms 1 /classes/Category.php:1378
3952
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5283
ORDER BY `position`
0.447 ms 2 Yes /classes/Product.php:3545
775
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3075) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.446 ms 1 /classes/stock/StockAvailable.php:453
2044
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4942)
0.446 ms 1 /classes/Product.php:3860
2570
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 6187
ORDER BY f.position ASC
0.446 ms 5 Yes /classes/Product.php:6021
3336
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 10304)
0.446 ms 1 /classes/Product.php:3860
2653
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 6499)
0.445 ms 1 /classes/Product.php:3860
3863
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3765
0.445 ms 1 /classes/Product.php:2902
214
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 5144
AND image_shop.`cover` = 1 LIMIT 1
0.445 ms 1 /classes/Product.php:3570
1662
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.445 ms 1 /classes/Product.php:5659
3314
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 10302)
0.445 ms 1 /classes/Product.php:3860
3751
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2892
ORDER BY `position`
0.445 ms 1 Yes /classes/Product.php:3545
811
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2780
AND image_shop.`cover` = 1 LIMIT 1
0.444 ms 1 /classes/Product.php:3570
1376
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3264 LIMIT 1
0.443 ms 10 /classes/SpecificPrice.php:435
1556
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3455)
0.443 ms 1 /classes/Product.php:3860
2094
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4964
AND image_shop.`cover` = 1 LIMIT 1
0.443 ms 1 /classes/Product.php:3570
3613
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2635
ORDER BY `position`
0.443 ms 1 Yes /classes/Product.php:3545
3646
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2629
ORDER BY `position`
0.443 ms 1 Yes /classes/Product.php:3545
2491
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 6180) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.442 ms 1 /classes/stock/StockAvailable.php:453
3461
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3743
0.442 ms 1 /classes/Product.php:2902
3805
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3585
ORDER BY `position`
0.442 ms 1 Yes /classes/Product.php:3545
2338
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 5972
ORDER BY f.position ASC
0.441 ms 5 Yes /classes/Product.php:6021
4577
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2641) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.441 ms 1 Yes Yes /classes/Product.php:4524
3303
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 10299)
0.441 ms 1 /classes/Product.php:3860
2720
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 7942)
0.440 ms 1 /classes/Product.php:3860
3622
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2633
ORDER BY `position`
0.440 ms 1 Yes /classes/Product.php:3545
3031
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 9596)
0.440 ms 1 /classes/Product.php:3860
3637
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2638
ORDER BY `position`
0.440 ms 1 Yes /classes/Product.php:3545
4600
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2892) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.440 ms 1 Yes Yes /classes/Product.php:4524
2113
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4965) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.439 ms 1 /classes/stock/StockAvailable.php:453
2204
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 5293
ORDER BY f.position ASC
0.439 ms 5 Yes /classes/Product.php:6021
2976
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 9321)
0.439 ms 1 /classes/Product.php:3860
3706
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2646
ORDER BY `position`
0.439 ms 1 Yes /classes/Product.php:3545
2441
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 6176 LIMIT 1
0.438 ms 10 /classes/SpecificPrice.php:435
2543
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 6185)
0.438 ms 1 /classes/Product.php:3860
3634
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2637
ORDER BY `position`
0.438 ms 1 Yes /classes/Product.php:3545
2116
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4966
AND image_shop.`cover` = 1 LIMIT 1
0.437 ms 1 /classes/Product.php:3570
2759
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 7946
AND image_shop.`cover` = 1 LIMIT 1
0.437 ms 1 /classes/Product.php:3570
4004
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 6106
0.437 ms 1 /classes/Product.php:2902
1407
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3155
AND image_shop.`cover` = 1 LIMIT 1
0.437 ms 1 /classes/Product.php:3570
4239
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 10072
ORDER BY `position`
0.437 ms 1 Yes /classes/Product.php:3545
1265
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2646 LIMIT 1
0.436 ms 10 /classes/SpecificPrice.php:435
1501
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2621)
0.436 ms 1 /classes/Product.php:3860
3877
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3777
ORDER BY `position`
0.436 ms 2 Yes /classes/Product.php:3545
2083
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4963
AND image_shop.`cover` = 1 LIMIT 1
0.436 ms 1 /classes/Product.php:3570
4289
SELECT SQL_NO_CACHE `id_module` FROM `hgt78_module` WHERE `name` = "iqithtmlandbanners" LIMIT 1
0.436 ms 1 /classes/module/Module.php:2664
4439
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 197 AND `id_shop` = 1
0.436 ms 6 /src/Adapter/EntityMapper.php:79
4603
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3132) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.436 ms 1 Yes Yes /classes/Product.php:4524
1622
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3584)
0.435 ms 1 /classes/Product.php:3860
3965
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 5335
0.435 ms 1 /classes/Product.php:2902
4334
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 175 AND `id_shop` = 1
0.435 ms 6 /src/Adapter/EntityMapper.php:79
4404
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 260 AND `id_shop` = 1
0.435 ms 6 /src/Adapter/EntityMapper.php:79
3625
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2634
ORDER BY `position`
0.435 ms 1 Yes /classes/Product.php:3545
1287
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2643 LIMIT 1
0.434 ms 10 /classes/SpecificPrice.php:435
3381
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 11001)
0.434 ms 1 /classes/Product.php:3860
1352
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3255
AND image_shop.`cover` = 1 LIMIT 1
0.434 ms 1 /classes/Product.php:3570
1452
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3107
AND image_shop.`cover` = 1 LIMIT 1
0.434 ms 1 /classes/Product.php:3570
2099
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4964)
0.434 ms 1 /classes/Product.php:3860
2897
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 8418)
0.434 ms 1 /classes/Product.php:3860
4481
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (7542) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.434 ms 1 Yes Yes /classes/Product.php:4524
2417
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 6173
AND image_shop.`cover` = 1 LIMIT 1
0.433 ms 1 /classes/Product.php:3570
316
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 5135
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.433 ms 0 /classes/SpecificPrice.php:259
33
SELECT SQL_NO_CACHE *
FROM `hgt78_currency_lang`
WHERE `id_currency` = 1
0.432 ms 6 /src/Adapter/EntityMapper.php:79
3187
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 10067)
0.432 ms 1 /classes/Product.php:3860
3814
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3689
ORDER BY `position`
0.432 ms 1 Yes /classes/Product.php:3545
4319
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 169) LIMIT 1
0.432 ms 1 /src/Adapter/EntityMapper.php:71
4793
SELECT SQL_NO_CACHE *
FROM `hgt78_cms` a
LEFT JOIN `hgt78_cms_lang` `b` ON a.`id_cms` = b.`id_cms` AND b.`id_lang` = 1
LEFT JOIN `hgt78_cms_shop` `c` ON a.`id_cms` = c.`id_cms` AND c.`id_shop` = 1
WHERE (a.`id_cms` = 2) AND (b.`id_shop` = 1) LIMIT 1
0.432 ms 1 /src/Adapter/EntityMapper.php:71
4454
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 36) AND (b.`id_shop` = 1) LIMIT 1
0.432 ms 1 /src/Adapter/EntityMapper.php:71
269
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 5139
AND image_shop.`cover` = 1 LIMIT 1
0.431 ms 1 /classes/Product.php:3570
1457
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3107)
0.431 ms 1 /classes/Product.php:3860
641
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2771 AND `id_group` = 1 LIMIT 1
0.430 ms 0 /classes/GroupReduction.php:156
1386
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.430 ms 1 /classes/Product.php:5659
3595
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2789
ORDER BY `position`
0.430 ms 1 Yes /classes/Product.php:3545
3685
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2656
ORDER BY `position`
0.430 ms 1 Yes /classes/Product.php:3545
1509
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2733 LIMIT 1
0.430 ms 10 /classes/SpecificPrice.php:435
1771
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3754
AND image_shop.`cover` = 1 LIMIT 1
0.429 ms 1 /classes/Product.php:3570
2177
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 5283)
0.429 ms 1 /classes/Product.php:3860
1910
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3804)
0.429 ms 1 /classes/Product.php:3860
3109
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 9690)
0.429 ms 1 /classes/Product.php:3860
4069
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 6192
ORDER BY `position`
0.429 ms 1 Yes /classes/Product.php:3545
2330
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 5972 LIMIT 1
0.428 ms 10 /classes/SpecificPrice.php:435
4111
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 7946
ORDER BY `position`
0.428 ms 1 Yes /classes/Product.php:3545
2147
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 5266) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.427 ms 1 /classes/stock/StockAvailable.php:453
2538
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 6185
AND image_shop.`cover` = 1 LIMIT 1
0.427 ms 1 /classes/Product.php:3570
2809
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 8392)
0.427 ms 1 /classes/Product.php:3860
3098
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 9689)
0.427 ms 1 /classes/Product.php:3860
3547
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2778
ORDER BY `position`
0.427 ms 1 Yes /classes/Product.php:3545
4099
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 7942
ORDER BY `position`
0.427 ms 1 Yes /classes/Product.php:3545
4283
SELECT SQL_NO_CACHE 1 FROM hgt78_cart_product cp INNER JOIN hgt78_product p
ON (p.id_product = cp.id_product) INNER JOIN hgt78_product_shop ps
ON (ps.id_shop = cp.id_shop AND ps.id_product = p.id_product) WHERE cp.id_cart=0 LIMIT 1
0.427 ms 1 /classes/Cart.php:4255
203
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 5145
AND image_shop.`cover` = 1 LIMIT 1
0.426 ms 1 /classes/Product.php:3570
408
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2893 AND `id_group` = 1 LIMIT 1
0.426 ms 0 /classes/GroupReduction.php:156
2826
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 8394
AND image_shop.`cover` = 1 LIMIT 1
0.426 ms 1 /classes/Product.php:3570
2987
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 9323)
0.426 ms 1 /classes/Product.php:3860
3529
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2692
ORDER BY `position`
0.426 ms 1 Yes /classes/Product.php:3545
1992
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4574
ORDER BY f.position ASC
0.426 ms 5 Yes /classes/Product.php:6021
2675
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 6501)
0.425 ms 1 /classes/Product.php:3860
4482
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (7541) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.425 ms 1 Yes Yes /classes/Product.php:4524
4576
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2640) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.425 ms 1 Yes Yes /classes/Product.php:4524
933
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.424 ms 1 /classes/Product.php:5659
3076
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 9686)
0.424 ms 1 /classes/Product.php:3860
4248
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 10297
ORDER BY `position`
0.424 ms 1 Yes /classes/Product.php:3545
3604
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2792
ORDER BY `position`
0.423 ms 1 Yes /classes/Product.php:3545
204
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 309 LIMIT 1
0.423 ms 1 /classes/Product.php:5659
1032
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2630
AND image_shop.`cover` = 1 LIMIT 1
0.423 ms 1 /classes/Product.php:3570
1916
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3805
AND image_shop.`cover` = 1 LIMIT 1
0.423 ms 1 /classes/Product.php:3570
2864
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 8397)
0.423 ms 1 /classes/Product.php:3860
3347
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 10305)
0.423 ms 1 /classes/Product.php:3860
3359
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 12552)
0.423 ms 1 /classes/Product.php:3860
3883
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3805
ORDER BY `position`
0.423 ms 1 Yes /classes/Product.php:3545
767
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3075
AND image_shop.`cover` = 1 LIMIT 1
0.422 ms 1 /classes/Product.php:3570
1045
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2629 LIMIT 1
0.422 ms 10 /classes/SpecificPrice.php:435
1829
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3764 LIMIT 1
0.422 ms 10 /classes/SpecificPrice.php:435
4383
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 195) LIMIT 1
0.422 ms 1 /src/Adapter/EntityMapper.php:71
438
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2652
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.421 ms 0 /classes/SpecificPrice.php:259
1477
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3327
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.421 ms 0 /classes/SpecificPrice.php:259
2344
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 5973)
0.421 ms 1 /classes/Product.php:3860
4078
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 6195
ORDER BY `position`
0.420 ms 1 Yes /classes/Product.php:3545
4452
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 191) LIMIT 1
0.420 ms 1 /src/Adapter/EntityMapper.php:71
1393
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3265) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.420 ms 1 /classes/stock/StockAvailable.php:453
2088
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4963)
0.420 ms 1 /classes/Product.php:3860
2303
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 5774) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.420 ms 1 /classes/stock/StockAvailable.php:453
4570
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2622) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.420 ms 1 Yes Yes /classes/Product.php:4524
3259
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 10073)
0.419 ms 1 /classes/Product.php:3860
3934
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4965
ORDER BY `position`
0.419 ms 1 Yes /classes/Product.php:3545
4311
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 40) LIMIT 1
0.419 ms 1 /src/Adapter/EntityMapper.php:71
2853
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 8396)
0.419 ms 1 /classes/Product.php:3860
3009
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 9325)
0.419 ms 1 /classes/Product.php:3860
387
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3740) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.418 ms 1 /classes/stock/StockAvailable.php:453
3087
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 9688)
0.418 ms 1 /classes/Product.php:3860
4479
SELECT SQL_NO_CACHE *
FROM `hgt78_currency` c
INNER JOIN hgt78_currency_shop currency_shop
ON (currency_shop.id_currency = c.id_currency AND currency_shop.id_shop = 1)
WHERE c.`deleted` = 0 AND c.`active` = 1 ORDER BY `iso_code` ASC
0.418 ms 2 Yes /classes/Currency.php:694
208
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 5145)
0.417 ms 1 /classes/Product.php:3860
1268
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2646)
0.417 ms 1 /classes/Product.php:3860
1898
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3777)
0.417 ms 1 /classes/Product.php:3860
1944
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3807 AND id_shop=1 LIMIT 1
0.417 ms 1 /classes/Product.php:6876
2267
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 5590)
0.417 ms 1 /classes/Product.php:3860
2875
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 8401)
0.417 ms 1 /classes/Product.php:3860
3325
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 10303)
0.417 ms 1 /classes/Product.php:3860
1418
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2818
AND image_shop.`cover` = 1 LIMIT 1
0.416 ms 1 /classes/Product.php:3570
3619
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2632
ORDER BY `position`
0.416 ms 1 Yes /classes/Product.php:3545
3235
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 10071)
0.415 ms 1 /classes/Product.php:3860
3631
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2636
ORDER BY `position`
0.415 ms 1 Yes /classes/Product.php:3545
3973
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5589
ORDER BY `position`
0.415 ms 2 Yes /classes/Product.php:3545
4150
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 8419
ORDER BY `position`
0.415 ms 1 Yes /classes/Product.php:3545
1788
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3755 AND id_shop=1 LIMIT 1
0.415 ms 1 /classes/Product.php:6876
2776
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 7769)
0.415 ms 1 /classes/Product.php:3860
3131
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 9692)
0.415 ms 1 /classes/Product.php:3860
4096
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 7941
ORDER BY `position`
0.415 ms 1 Yes /classes/Product.php:3545
249
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 5141 LIMIT 1
0.414 ms 10 /classes/SpecificPrice.php:435
368
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3741
AND image_shop.`cover` = 1 LIMIT 1
0.414 ms 1 /classes/Product.php:3570
2831
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 8394)
0.414 ms 1 /classes/Product.php:3860
3643
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2630
ORDER BY `position`
0.414 ms 1 Yes /classes/Product.php:3545
3785
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3455
0.414 ms 1 /classes/Product.php:2902
4105
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 7944
ORDER BY `position`
0.414 ms 1 Yes /classes/Product.php:3545
4291
SELECT SQL_NO_CACHE COUNT(DISTINCT c.id_currency) FROM `hgt78_currency` c
LEFT JOIN hgt78_currency_shop cs ON (cs.id_currency = c.id_currency AND cs.id_shop = 1)
WHERE c.`active` = 1 AND c.`deleted` = 0 LIMIT 1
0.414 ms 2 /classes/Currency.php:1136
236
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 5142
AND image_shop.`cover` = 1 LIMIT 1
0.413 ms 1 /classes/Product.php:3570
271
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 5139 LIMIT 1
0.413 ms 10 /classes/SpecificPrice.php:435
2698
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 7940)
0.413 ms 1 /classes/Product.php:3860
3042
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 9597)
0.413 ms 1 /classes/Product.php:3860
1136
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2625)
0.412 ms 1 /classes/Product.php:3860
1561
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3455
ORDER BY f.position ASC
0.412 ms 5 Yes /classes/Product.php:6021
1023
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2639 LIMIT 1
0.411 ms 10 /classes/SpecificPrice.php:435
1827
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3764
AND image_shop.`cover` = 1 LIMIT 1
0.411 ms 1 /classes/Product.php:3570
4075
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 6194
ORDER BY `position`
0.411 ms 1 Yes /classes/Product.php:3545
4279
SELECT SQL_NO_CACHE name, alias FROM `hgt78_hook_alias`
0.411 ms 88 /classes/Hook.php:342
4569
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3459) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.411 ms 1 Yes Yes /classes/Product.php:4524
750
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2800)
0.411 ms 1 /classes/Product.php:3860
2576
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 6188)
0.410 ms 1 /classes/Product.php:3860
2317
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 5971
AND image_shop.`cover` = 1 LIMIT 1
0.410 ms 1 /classes/Product.php:3570
2908
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 8419)
0.410 ms 1 /classes/Product.php:3860
3559
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2798
ORDER BY `position`
0.410 ms 1 Yes /classes/Product.php:3545
4102
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 7943
ORDER BY `position`
0.410 ms 1 Yes /classes/Product.php:3545
1279
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2642)
0.409 ms 1 /classes/Product.php:3860
1586
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3557 LIMIT 1
0.409 ms 10 /classes/SpecificPrice.php:435
1765
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3753)
0.409 ms 1 /classes/Product.php:3860
3065
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 9687)
0.409 ms 1 /classes/Product.php:3860
1774
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3754
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.409 ms 0 /classes/SpecificPrice.php:259
3974
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 5589
0.409 ms 1 /classes/Product.php:2902
2379
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 6107 AND id_shop=1 LIMIT 1
0.408 ms 1 /classes/Product.php:6876
3020
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 9535)
0.408 ms 1 /classes/Product.php:3860
3211
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 10069)
0.408 ms 1 /classes/Product.php:3860
3880
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3804
ORDER BY `position`
0.408 ms 1 Yes /classes/Product.php:3545
2747
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 7944
ORDER BY f.position ASC
0.408 ms 5 Yes /classes/Product.php:6021
3053
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 9598)
0.408 ms 1 /classes/Product.php:3860
3312
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 10302
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.408 ms 1 /classes/SpecificPrice.php:259
2161
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 5282
AND image_shop.`cover` = 1 LIMIT 1
0.407 ms 1 /classes/Product.php:3570
2429
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 182 LIMIT 1
0.407 ms 1 /classes/Product.php:5659
1330
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `hgt78_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 95 LIMIT 1
0.407 ms 1 /classes/Category.php:1378
1490
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2490)
0.407 ms 1 /classes/Product.php:3860
1639
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3586
AND image_shop.`cover` = 1 LIMIT 1
0.407 ms 1 /classes/Product.php:3570
1695
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.407 ms 1 /classes/Product.php:5659
1743
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3751)
0.407 ms 1 /classes/Product.php:3860
2222
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 5335)
0.407 ms 1 /classes/Product.php:3860
2499
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 6181)
0.407 ms 1 /classes/Product.php:3860
3923
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4944
0.407 ms 1 /classes/Product.php:2902
1454
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3107 LIMIT 1
0.406 ms 10 /classes/SpecificPrice.php:435
2709
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 7941)
0.406 ms 1 /classes/Product.php:3860
2798
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 7773)
0.406 ms 1 /classes/Product.php:3860
2914
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 8420
AND image_shop.`cover` = 1 LIMIT 1
0.406 ms 1 /classes/Product.php:3570
3589
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3179
ORDER BY `position`
0.406 ms 1 Yes /classes/Product.php:3545
3980
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 5591
0.406 ms 1 /classes/Product.php:2902
3175
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 9697)
0.406 ms 1 /classes/Product.php:3860
448
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2651 LIMIT 1
0.405 ms 10 /classes/SpecificPrice.php:435
843
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3179
ORDER BY f.position ASC
0.405 ms 5 Yes /classes/Product.php:6021
1631
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3585
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.405 ms 0 /classes/SpecificPrice.php:259
3398
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 7540
0.405 ms 1 /classes/Product.php:2902
1679
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3745 AND `id_group` = 1 LIMIT 1
0.404 ms 0 /classes/GroupReduction.php:156
1798
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3756)
0.404 ms 1 /classes/Product.php:3860
2038
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4942
AND image_shop.`cover` = 1 LIMIT 1
0.404 ms 1 /classes/Product.php:3570
3223
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 10070)
0.404 ms 1 /classes/Product.php:3860
1465
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3132 LIMIT 1
0.404 ms 10 /classes/SpecificPrice.php:435
3860
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3764
0.404 ms 1 /classes/Product.php:2902
136
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 7540
AND image_shop.`cover` = 1 LIMIT 1
0.403 ms 1 /classes/Product.php:3570
1614
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3559) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.403 ms 1 /classes/stock/StockAvailable.php:453
2664
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 6500)
0.403 ms 1 /classes/Product.php:3860
3556
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2797
ORDER BY `position`
0.403 ms 1 Yes /classes/Product.php:3545
2032
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4935)
0.403 ms 1 /classes/Product.php:3860
2854
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 8396 AND id_shop=1 LIMIT 1
0.403 ms 1 /classes/Product.php:6876
3253
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 10073
AND image_shop.`cover` = 1 LIMIT 1
0.403 ms 1 /classes/Product.php:3570
3425
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 5143
0.403 ms 1 /classes/Product.php:2902
4309
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 40) AND (b.`id_shop` = 1) LIMIT 1
0.403 ms 1 /src/Adapter/EntityMapper.php:71
15
SELECT SQL_NO_CACHE `name`, `alias` FROM `hgt78_hook_alias`
0.402 ms 88 /classes/Hook.php:290
282
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 5138 LIMIT 1
0.402 ms 10 /classes/SpecificPrice.php:435
385
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3740 AND id_shop=1 LIMIT 1
0.402 ms 1 /classes/Product.php:6876
962
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2633) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.402 ms 1 /classes/stock/StockAvailable.php:453
2077
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4962)
0.402 ms 1 /classes/Product.php:3860
2998
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 9324)
0.402 ms 1 /classes/Product.php:3860
4339
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 190) LIMIT 1
0.402 ms 1 /src/Adapter/EntityMapper.php:71
2027
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4935
AND image_shop.`cover` = 1 LIMIT 1
0.401 ms 1 /classes/Product.php:3570
2422
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 6173)
0.401 ms 1 /classes/Product.php:3860
2886
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 8417)
0.401 ms 1 /classes/Product.php:3860
3874
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3776
ORDER BY `position`
0.401 ms 2 Yes /classes/Product.php:3545
1883
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.400 ms 1 /classes/Product.php:5659
2289
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 5592)
0.400 ms 1 /classes/Product.php:3860
3571
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3075
ORDER BY `position`
0.399 ms 1 Yes /classes/Product.php:3545
205
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 5145 LIMIT 1
0.399 ms 10 /classes/SpecificPrice.php:435
1406
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3326
ORDER BY f.position ASC
0.399 ms 5 Yes /classes/Product.php:6021
1732
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3750)
0.399 ms 1 /classes/Product.php:3860
2066
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4944)
0.399 ms 1 /classes/Product.php:3860
4031
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 6178
0.399 ms 1 /classes/Product.php:2902
1277
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2642
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.398 ms 0 /classes/SpecificPrice.php:259
2903
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 8419
AND image_shop.`cover` = 1 LIMIT 1
0.398 ms 1 /classes/Product.php:3570
3270
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 10111)
0.398 ms 1 /classes/Product.php:3860
1092
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3459)
0.397 ms 1 /classes/Product.php:3860
1235
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2649)
0.397 ms 1 /classes/Product.php:3860
1735
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3750) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.397 ms 1 /classes/stock/StockAvailable.php:453
2333
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 5972)
0.397 ms 1 /classes/Product.php:3860
3015
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 9535
AND image_shop.`cover` = 1 LIMIT 1
0.397 ms 1 /classes/Product.php:3570
557
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2766
AND image_shop.`cover` = 1 LIMIT 1
0.396 ms 1 /classes/Product.php:3570
1657
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3639 AND `id_group` = 1 LIMIT 1
0.396 ms 0 /classes/GroupReduction.php:156
3004
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 9325
AND image_shop.`cover` = 1 LIMIT 1
0.396 ms 1 /classes/Product.php:3570
4007
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 6107
0.396 ms 1 /classes/Product.php:2902
1249
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2658) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.395 ms 1 /classes/stock/StockAvailable.php:453
3229
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 10071
AND image_shop.`cover` = 1 LIMIT 1
0.395 ms 1 /classes/Product.php:3570
1321
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2645
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.394 ms 0 /classes/SpecificPrice.php:259
2244
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 5093)
0.394 ms 1 /classes/Product.php:3860
1938
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3807
AND image_shop.`cover` = 1 LIMIT 1
0.394 ms 1 /classes/Product.php:3570
2055
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4943)
0.393 ms 1 /classes/Product.php:3860
1628
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3585
AND image_shop.`cover` = 1 LIMIT 1
0.393 ms 1 /classes/Product.php:3570
1068
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3477
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.392 ms 0 /classes/SpecificPrice.php:259
882
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2791)
0.392 ms 1 /classes/Product.php:3860
1866
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3771 AND id_shop=1 LIMIT 1
0.392 ms 1 /classes/Product.php:6876
2587
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 6189)
0.392 ms 1 /classes/Product.php:3860
3142
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 9693)
0.392 ms 1 /classes/Product.php:3860
3247
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 10072)
0.392 ms 1 /classes/Product.php:3860
29
SELECT SQL_NO_CACHE c.id_currency
FROM `hgt78_currency` c
WHERE (iso_code = 'GBP') LIMIT 1
0.391 ms 1 /classes/Currency.php:893
34
SELECT SQL_NO_CACHE id_shop
FROM `hgt78_currency_shop`
WHERE `id_currency` = 1
AND id_shop = 1 LIMIT 1
0.391 ms 1 /classes/ObjectModel.php:1729
1485
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2490
AND image_shop.`cover` = 1 LIMIT 1
0.391 ms 1 /classes/Product.php:3570
1512
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2733)
0.391 ms 1 /classes/Product.php:3860
2061
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4944
AND image_shop.`cover` = 1 LIMIT 1
0.391 ms 1 /classes/Product.php:3570
2609
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 6192)
0.391 ms 1 /classes/Product.php:3860
2787
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 7779)
0.391 ms 1 /classes/Product.php:3860
1011
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.390 ms 1 /classes/Product.php:5659
1288
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2643
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.390 ms 0 /classes/SpecificPrice.php:259
1603
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3558) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.390 ms 1 /classes/stock/StockAvailable.php:453
2278
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 5591)
0.390 ms 1 /classes/Product.php:3860
2510
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 6182)
0.390 ms 1 /classes/Product.php:3860
2982
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 9323
AND image_shop.`cover` = 1 LIMIT 1
0.390 ms 1 /classes/Product.php:3570
3446
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 5136
0.390 ms 1 /classes/Product.php:2902
3901
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4574
ORDER BY `position`
0.390 ms 1 Yes /classes/Product.php:3545
4782
SELECT SQL_NO_CACHE c.*, cl.*  FROM `hgt78_category` c
LEFT JOIN `hgt78_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`nleft` <= 2 AND c.`nright` >= 577 AND c.`nleft` >= 1 AND c.`nright` <= 590 ORDER BY `nleft` DESC
0.390 ms 2 /classes/Category.php:1600
3953
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 5283
0.390 ms 1 /classes/Product.php:2902
1846
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3765) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.389 ms 1 /classes/stock/StockAvailable.php:453
1982
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4574
AND image_shop.`cover` = 1 LIMIT 1
0.389 ms 1 /classes/Product.php:3570
1998
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4575)
0.389 ms 1 /classes/Product.php:3860
2549
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 6186
AND image_shop.`cover` = 1 LIMIT 1
0.389 ms 1 /classes/Product.php:3570
2898
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 8418 AND id_shop=1 LIMIT 1
0.389 ms 1 /classes/Product.php:6876
1927
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3806
AND image_shop.`cover` = 1 LIMIT 1
0.389 ms 1 /classes/Product.php:3570
2273
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 5591
AND image_shop.`cover` = 1 LIMIT 1
0.389 ms 2 /classes/Product.php:3570
2837
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 8395
AND image_shop.`cover` = 1 LIMIT 1
0.389 ms 1 /classes/Product.php:3570
829
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2781 AND `id_group` = 1 LIMIT 1
0.388 ms 0 /classes/GroupReduction.php:156
2357
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 6047 AND id_shop=1 LIMIT 1
0.388 ms 1 /classes/Product.php:6876
3199
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 10068)
0.388 ms 1 /classes/Product.php:3860
4436
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 196) LIMIT 1
0.388 ms 1 /src/Adapter/EntityMapper.php:71
3265
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 10111
AND image_shop.`cover` = 1 LIMIT 1
0.387 ms 2 /classes/Product.php:3570
3640
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2639
ORDER BY `position`
0.387 ms 1 Yes /classes/Product.php:3545
575
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2765 AND `id_group` = 1 LIMIT 1
0.387 ms 0 /classes/GroupReduction.php:156
2021
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4934)
0.387 ms 1 /classes/Product.php:3860
3106
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 9690 LIMIT 1
0.387 ms 11 /classes/SpecificPrice.php:435
3521
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2661
0.387 ms 1 /classes/Product.php:2902
4398
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 161 AND `id_shop` = 1
0.387 ms 6 /src/Adapter/EntityMapper.php:79
54
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 11) AND (b.`id_shop` = 1) LIMIT 1
0.386 ms 1 /src/Adapter/EntityMapper.php:71
359
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3743 LIMIT 1
0.386 ms 10 /classes/SpecificPrice.php:435
1048
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2629)
0.386 ms 1 /classes/Product.php:3860
1304
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2655) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.386 ms 1 /classes/stock/StockAvailable.php:453
2010
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4932)
0.386 ms 1 /classes/Product.php:3860
3700
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2658
ORDER BY `position`
0.386 ms 1 Yes /classes/Product.php:3545
1447
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3099 AND id_shop=1 LIMIT 1
0.385 ms 1 /classes/Product.php:6876
1611
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3559)
0.385 ms 1 /classes/Product.php:3860
2815
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 8393
AND image_shop.`cover` = 1 LIMIT 1
0.385 ms 1 /classes/Product.php:3570
4343
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 34) AND (b.`id_shop` = 1) LIMIT 1
0.385 ms 1 /src/Adapter/EntityMapper.php:71
1591
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3557 AND `id_group` = 1 LIMIT 1
0.384 ms 0 /classes/GroupReduction.php:156
3037
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 9597
AND image_shop.`cover` = 1 LIMIT 1
0.384 ms 1 /classes/Product.php:3570
4438
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 197) LIMIT 1
0.384 ms 1 /src/Adapter/EntityMapper.php:71
459
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2623 LIMIT 1
0.384 ms 10 /classes/SpecificPrice.php:435
1315
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2644) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.383 ms 1 /classes/stock/StockAvailable.php:453
2183
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 5284
AND image_shop.`cover` = 1 LIMIT 1
0.383 ms 2 /classes/Product.php:3570
3048
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 9598
AND image_shop.`cover` = 1 LIMIT 1
0.383 ms 1 /classes/Product.php:3570
172
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 5148 LIMIT 1
0.382 ms 10 /classes/SpecificPrice.php:435
2521
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 6183)
0.382 ms 1 /classes/Product.php:3860
2532
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 6184)
0.382 ms 1 /classes/Product.php:3860
3331
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 10304
AND image_shop.`cover` = 1 LIMIT 1
0.382 ms 1 /classes/Product.php:3570
3376
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 11001
AND image_shop.`cover` = 1 LIMIT 1
0.382 ms 3 /classes/Product.php:3570
541
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2775 AND id_shop=1 LIMIT 1
0.381 ms 1 /classes/Product.php:6876
1248
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2658 AND `id_group` = 1 LIMIT 1
0.381 ms 0 /classes/GroupReduction.php:156
1809
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3757)
0.381 ms 1 /classes/Product.php:3860
2715
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 7942
AND image_shop.`cover` = 1 LIMIT 1
0.381 ms 1 /classes/Product.php:3570
3682
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2641
ORDER BY `position`
0.381 ms 1 Yes /classes/Product.php:3545
696
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2779 AND id_shop=1 LIMIT 1
0.380 ms 1 /classes/Product.php:6876
1754
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3752)
0.380 ms 1 /classes/Product.php:3860
2239
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 5093
AND image_shop.`cover` = 1 LIMIT 1
0.380 ms 4 /classes/Product.php:3570
3353
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 12552
AND image_shop.`cover` = 1 LIMIT 1
0.380 ms 1 /classes/Product.php:3570
3686
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2656
0.380 ms 1 /classes/Product.php:2902
4427
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 65 AND `id_shop` = 1
0.380 ms 6 /src/Adapter/EntityMapper.php:79
968
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2634
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.379 ms 0 /classes/SpecificPrice.php:259
1523
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2650)
0.379 ms 1 /classes/Product.php:3860
2256
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 5589)
0.379 ms 1 /classes/Product.php:3860
2469
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 6178) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.379 ms 1 /classes/stock/StockAvailable.php:453
2911
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 8419) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.379 ms 1 /classes/stock/StockAvailable.php:453
4181
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 9535
0.379 ms 1 /classes/Product.php:2902
1929
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3806 LIMIT 1
0.378 ms 10 /classes/SpecificPrice.php:435
2482
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 6179
ORDER BY f.position ASC
0.378 ms 5 Yes /classes/Product.php:6021
1906
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 184 LIMIT 1
0.378 ms 1 /classes/Product.php:5659
2626
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 6194
AND image_shop.`cover` = 1 LIMIT 1
0.378 ms 1 /classes/Product.php:3570
1089
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3459 LIMIT 1
0.377 ms 10 /classes/SpecificPrice.php:435
1471
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3132) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.377 ms 1 /classes/stock/StockAvailable.php:453
1900
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3777 AND `id_group` = 1 LIMIT 1
0.377 ms 0 /classes/GroupReduction.php:156
3932
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4964
0.377 ms 1 /classes/Product.php:2902
1353
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.376 ms 1 /classes/Product.php:5659
1375
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.376 ms 1 /classes/Product.php:5659
1433
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2892
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.376 ms 0 /classes/SpecificPrice.php:259
1663
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3689 LIMIT 1
0.376 ms 10 /classes/SpecificPrice.php:435
2475
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 6179
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.376 ms 0 /classes/SpecificPrice.php:259
2859
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 8397
AND image_shop.`cover` = 1 LIMIT 1
0.376 ms 1 /classes/Product.php:3570
2881
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 8417
AND image_shop.`cover` = 1 LIMIT 1
0.376 ms 1 /classes/Product.php:3570
584
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2661)
0.375 ms 1 /classes/Product.php:3860
758
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3178 LIMIT 1
0.375 ms 10 /classes/SpecificPrice.php:435
1965
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3936)
0.375 ms 1 /classes/Product.php:3860
2571
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 6188
AND image_shop.`cover` = 1 LIMIT 1
0.375 ms 1 /classes/Product.php:3570
2582
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 6189
AND image_shop.`cover` = 1 LIMIT 1
0.375 ms 1 /classes/Product.php:3570
2284
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 5592
AND image_shop.`cover` = 1 LIMIT 1
0.375 ms 1 /classes/Product.php:3570
690
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2779
AND image_shop.`cover` = 1 LIMIT 1
0.374 ms 1 /classes/Product.php:3570
2428
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 6174
AND image_shop.`cover` = 1 LIMIT 1
0.374 ms 1 /classes/Product.php:3570
2714
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 7941
ORDER BY f.position ASC
0.374 ms 5 Yes /classes/Product.php:6021
2793
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 7773
AND image_shop.`cover` = 1 LIMIT 1
0.374 ms 1 /classes/Product.php:3570
3148
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 9694
AND image_shop.`cover` = 1 LIMIT 1
0.374 ms 1 /classes/Product.php:3570
4410
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 263 AND `id_shop` = 1
0.374 ms 6 /src/Adapter/EntityMapper.php:79
1141
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2625
ORDER BY f.position ASC
0.374 ms 5 Yes /classes/Product.php:6021
4409
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 263) LIMIT 1
0.374 ms 1 /src/Adapter/EntityMapper.php:71
1658
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3639) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.373 ms 1 /classes/stock/StockAvailable.php:453
1669
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3689) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.373 ms 1 /classes/stock/StockAvailable.php:453
2687
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 7938)
0.373 ms 1 /classes/Product.php:3860
3205
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 10069
AND image_shop.`cover` = 1 LIMIT 1
0.373 ms 1 /classes/Product.php:3570
3298
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 10299
AND image_shop.`cover` = 1 LIMIT 1
0.373 ms 1 /classes/Product.php:3570
712
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2797
AND image_shop.`cover` = 1 LIMIT 1
0.372 ms 1 /classes/Product.php:3570
1163
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2627
ORDER BY f.position ASC
0.372 ms 5 Yes /classes/Product.php:6021
1293
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2643) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.372 ms 1 /classes/stock/StockAvailable.php:453
1642
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3586
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.372 ms 0 /classes/SpecificPrice.php:259
2233
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 5350)
0.372 ms 1 /classes/Product.php:3860
2419
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 6173 LIMIT 1
0.372 ms 10 /classes/SpecificPrice.php:435
2614
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 6192
ORDER BY f.position ASC
0.372 ms 5 Yes /classes/Product.php:6021
3164
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 9695)
0.372 ms 1 /classes/Product.php:3860
3281
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 10297)
0.372 ms 1 /classes/Product.php:3860
3452
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 5134
0.372 ms 1 /classes/Product.php:2902
3959
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 5293
0.372 ms 1 /classes/Product.php:2902
2072
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4962
AND image_shop.`cover` = 1 LIMIT 1
0.371 ms 1 /classes/Product.php:3570
2172
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 5283
AND image_shop.`cover` = 1 LIMIT 1
0.371 ms 2 /classes/Product.php:3570
3662
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2622
0.371 ms 1 /classes/Product.php:2902
4084
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 6500
ORDER BY `position`
0.371 ms 2 Yes /classes/Product.php:3545
4218
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 9695
ORDER BY `position`
0.371 ms 1 Yes /classes/Product.php:3545
1158
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2627)
0.370 ms 1 /classes/Product.php:3860
1285
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2643
AND image_shop.`cover` = 1 LIMIT 1
0.370 ms 1 /classes/Product.php:3570
2199
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 5293)
0.370 ms 1 /classes/Product.php:3860
2328
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 5972
AND image_shop.`cover` = 1 LIMIT 1
0.370 ms 1 /classes/Product.php:3570
3276
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 10297
AND image_shop.`cover` = 1 LIMIT 1
0.370 ms 1 /classes/Product.php:3570
2505
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 6182
AND image_shop.`cover` = 1 LIMIT 1
0.369 ms 1 /classes/Product.php:3570
2782
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 7779
AND image_shop.`cover` = 1 LIMIT 1
0.369 ms 1 /classes/Product.php:3570
3026
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 9596
AND image_shop.`cover` = 1 LIMIT 1
0.369 ms 1 /classes/Product.php:3570
877
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2791
AND image_shop.`cover` = 1 LIMIT 1
0.369 ms 1 /classes/Product.php:3570
1253
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.369 ms 1 /classes/Product.php:5659
1463
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3132
AND image_shop.`cover` = 1 LIMIT 1
0.369 ms 1 /classes/Product.php:3570
1793
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3756
AND image_shop.`cover` = 1 LIMIT 1
0.368 ms 1 /classes/Product.php:3570
2262
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 5590
AND image_shop.`cover` = 1 LIMIT 1
0.368 ms 2 /classes/Product.php:3570
1673
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.368 ms 1 /classes/Product.php:5659
1749
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3752
AND image_shop.`cover` = 1 LIMIT 1
0.368 ms 1 /classes/Product.php:3570
4460
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 47) LIMIT 1
0.368 ms 1 /src/Adapter/EntityMapper.php:71
395
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3587)
0.367 ms 1 /classes/Product.php:3860
2604
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 6192
AND image_shop.`cover` = 1 LIMIT 1
0.367 ms 1 /classes/Product.php:3570
3170
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 9697
AND image_shop.`cover` = 1 LIMIT 1
0.367 ms 1 /classes/Product.php:3570
4408
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 262 AND `id_shop` = 1
0.367 ms 6 /src/Adapter/EntityMapper.php:79
1302
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2655 AND id_shop=1 LIMIT 1
0.366 ms 1 /classes/Product.php:6876
1874
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3775
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.366 ms 0 /classes/SpecificPrice.php:259
2156
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 5267 AND id_shop=1 LIMIT 1
0.366 ms 1 /classes/Product.php:6876
4160
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 8976
0.366 ms 1 /classes/Product.php:2902
497
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2769 AND id_shop=1 LIMIT 1
0.365 ms 1 /classes/Product.php:6876
1332
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3252 LIMIT 1
0.365 ms 10 /classes/SpecificPrice.php:435
2384
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 6108
AND image_shop.`cover` = 1 LIMIT 1
0.365 ms 1 /classes/Product.php:3570
3746
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3155
0.365 ms 1 /classes/Product.php:2902
4299
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 2) AND (b.`id_shop` = 1) LIMIT 1
0.365 ms 1 /src/Adapter/EntityMapper.php:71
792
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2794
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.364 ms 0 /classes/SpecificPrice.php:259
1882
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3776
AND image_shop.`cover` = 1 LIMIT 1
0.364 ms 2 /classes/Product.php:3570
2210
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 5296)
0.364 ms 1 /classes/Product.php:3860
4312
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 40 AND `id_shop` = 1
0.364 ms 6 /src/Adapter/EntityMapper.php:79
4434
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 145) LIMIT 1
0.364 ms 1 /src/Adapter/EntityMapper.php:71
2460
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 6177
ORDER BY f.position ASC
0.364 ms 5 Yes /classes/Product.php:6021
1474
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3327
AND image_shop.`cover` = 1 LIMIT 1
0.363 ms 2 /classes/Product.php:3570
3159
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 9695
AND image_shop.`cover` = 1 LIMIT 1
0.363 ms 1 /classes/Product.php:3570
3181
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 10067
AND image_shop.`cover` = 1 LIMIT 1
0.363 ms 1 /classes/Product.php:3570
1260
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2647) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.362 ms 1 /classes/stock/StockAvailable.php:453
2434
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 6174 AND id_shop=1 LIMIT 1
0.362 ms 1 /classes/Product.php:6876
3059
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 9687
AND image_shop.`cover` = 1 LIMIT 1
0.362 ms 1 /classes/Product.php:3570
3365
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 12551
AND image_shop.`cover` = 1 LIMIT 1
0.362 ms 1 /classes/Product.php:3570
891
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2792
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.361 ms 0 /classes/SpecificPrice.php:259
1651
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.361 ms 1 /classes/Product.php:5659
2748
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 7945
AND image_shop.`cover` = 1 LIMIT 1
0.361 ms 1 /classes/Product.php:3570
3694
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3456
ORDER BY `position`
0.361 ms 1 Yes /classes/Product.php:3545
312
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 5136
ORDER BY f.position ASC
0.360 ms 5 Yes /classes/Product.php:6021
1297
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.360 ms 1 /classes/Product.php:5659
1412
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3155)
0.360 ms 1 /classes/Product.php:3860
2848
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 8396
AND image_shop.`cover` = 1 LIMIT 1
0.360 ms 1 /classes/Product.php:3570
3342
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 10305
AND image_shop.`cover` = 1 LIMIT 1
0.360 ms 1 /classes/Product.php:3570
4457
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 36 AND `id_shop` = 1
0.360 ms 6 /src/Adapter/EntityMapper.php:79
2397
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 6129 LIMIT 1
0.359 ms 10 /classes/SpecificPrice.php:435
2565
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 6187)
0.359 ms 1 /classes/Product.php:3860
2806
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 8392 LIMIT 1
0.359 ms 10 /classes/SpecificPrice.php:435
3287
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 10298
AND image_shop.`cover` = 1 LIMIT 1
0.359 ms 1 /classes/Product.php:3570
1415
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3155) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.358 ms 1 /classes/stock/StockAvailable.php:453
1849
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3766
AND image_shop.`cover` = 1 LIMIT 1
0.358 ms 1 /classes/Product.php:3570
2362
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 6106
AND image_shop.`cover` = 1 LIMIT 1
0.358 ms 1 /classes/Product.php:3570
2488
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 6180)
0.358 ms 1 /classes/Product.php:3860
3848
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3755
0.358 ms 1 /classes/Product.php:2902
30
SELECT SQL_NO_CACHE *
FROM `hgt78_currency` a
LEFT JOIN `hgt78_currency_lang` `b` ON a.`id_currency` = b.`id_currency` AND b.`id_lang` = 1
LEFT JOIN `hgt78_currency_shop` `c` ON a.`id_currency` = c.`id_currency` AND c.`id_shop` = 1
WHERE (a.`id_currency` = 2) LIMIT 1
0.358 ms 1 /src/Adapter/EntityMapper.php:71
1153
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2627
AND image_shop.`cover` = 1 LIMIT 1
0.358 ms 1 /classes/Product.php:3570
2016
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4934
AND image_shop.`cover` = 1 LIMIT 1
0.358 ms 1 /classes/Product.php:3570
2494
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 6181
AND image_shop.`cover` = 1 LIMIT 1
0.358 ms 1 /classes/Product.php:3570
3193
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 10068
AND image_shop.`cover` = 1 LIMIT 1
0.358 ms 1 /classes/Product.php:3570
1496
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2621
AND image_shop.`cover` = 1 LIMIT 1
0.357 ms 1 /classes/Product.php:3570
1815
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3763
AND image_shop.`cover` = 1 LIMIT 1
0.357 ms 1 /classes/Product.php:3570
2892
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 8418
AND image_shop.`cover` = 1 LIMIT 1
0.357 ms 1 /classes/Product.php:3570
3541
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2764
ORDER BY `position`
0.357 ms 1 Yes /classes/Product.php:3545
260
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 5140 LIMIT 1
0.357 ms 10 /classes/SpecificPrice.php:435
1562
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3484
AND image_shop.`cover` = 1 LIMIT 1
0.357 ms 1 /classes/Product.php:3570
2013
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4932) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.357 ms 1 /classes/stock/StockAvailable.php:453
3082
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 9688
AND image_shop.`cover` = 1 LIMIT 1
0.357 ms 1 /classes/Product.php:3570
4028
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 6177
0.357 ms 1 /classes/Product.php:2902
4157
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 8975
0.357 ms 1 /classes/Product.php:2902
195
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 5146
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.356 ms 0 /classes/SpecificPrice.php:259
682
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2778
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.356 ms 0 /classes/SpecificPrice.php:259
1002
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2637
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.356 ms 0 /classes/SpecificPrice.php:259
1131
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2625
AND image_shop.`cover` = 1 LIMIT 1
0.356 ms 1 /classes/Product.php:3570
1159
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2627 AND id_shop=1 LIMIT 1
0.356 ms 1 /classes/Product.php:6876
1678
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3745 AND id_shop=1 LIMIT 1
0.356 ms 1 /classes/Product.php:6876
2175
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 5283
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.356 ms 0 /classes/SpecificPrice.php:259
2228
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 5350
AND image_shop.`cover` = 1 LIMIT 1
0.356 ms 1 /classes/Product.php:3570
3115
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 9691
AND image_shop.`cover` = 1 LIMIT 1
0.356 ms 1 /classes/Product.php:3570
247
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 5141
AND image_shop.`cover` = 1 LIMIT 1
0.355 ms 1 /classes/Product.php:3570
1398
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3326 LIMIT 1
0.355 ms 10 /classes/SpecificPrice.php:435
3562
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2799
ORDER BY `position`
0.355 ms 1 Yes /classes/Product.php:3545
2527
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 6184
AND image_shop.`cover` = 1 LIMIT 1
0.355 ms 1 /classes/Product.php:3570
1960
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3936
AND image_shop.`cover` = 1 LIMIT 1
0.354 ms 1 /classes/Product.php:3570
2306
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 5970
AND image_shop.`cover` = 1 LIMIT 1
0.354 ms 1 /classes/Product.php:3570
2329
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.354 ms 1 /classes/Product.php:5659
2593
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 6191
AND image_shop.`cover` = 1 LIMIT 1
0.354 ms 1 /classes/Product.php:3570
2637
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 6195
AND image_shop.`cover` = 1 LIMIT 1
0.354 ms 1 /classes/Product.php:3570
3731
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3255
0.354 ms 1 /classes/Product.php:2902
4127
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 8393
0.354 ms 1 /classes/Product.php:2902
4346
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 344) LIMIT 1
0.354 ms 1 /src/Adapter/EntityMapper.php:71
2554
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 6186)
0.354 ms 1 /classes/Product.php:3860
3665
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3458
0.354 ms 1 /classes/Product.php:2902
615
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2692
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.353 ms 0 /classes/SpecificPrice.php:259
989
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.353 ms 1 /classes/Product.php:5659
2681
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 7938
AND image_shop.`cover` = 1 LIMIT 1
0.353 ms 1 /classes/Product.php:3570
3565
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2800
ORDER BY `position`
0.353 ms 1 Yes /classes/Product.php:3545
1971
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4256
AND image_shop.`cover` = 1 LIMIT 1
0.352 ms 1 /classes/Product.php:3570
2346
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 5973 AND `id_group` = 1 LIMIT 1
0.352 ms 0 /classes/GroupReduction.php:156
2546
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 6185) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.352 ms 1 /classes/stock/StockAvailable.php:453
2993
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 9324
AND image_shop.`cover` = 1 LIMIT 1
0.352 ms 1 /classes/Product.php:3570
4451
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 80 AND `id_shop` = 1
0.352 ms 6 /src/Adapter/EntityMapper.php:79
8
SELECT SQL_NO_CACHE *
FROM `hgt78_shop_group` a
WHERE (a.`id_shop_group` = 1) LIMIT 1
0.352 ms 1 /src/Adapter/EntityMapper.php:71
188
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 5147 AND `id_group` = 1 LIMIT 1
0.352 ms 0 /classes/GroupReduction.php:156
2620
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 6193)
0.352 ms 1 /classes/Product.php:3860
2642
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 6195)
0.352 ms 1 /classes/Product.php:3860
2670
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 6501
AND image_shop.`cover` = 1 LIMIT 1
0.352 ms 1 /classes/Product.php:3570
2726
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 7943
AND image_shop.`cover` = 1 LIMIT 1
0.352 ms 1 /classes/Product.php:3570
2750
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 7945 LIMIT 1
0.352 ms 10 /classes/SpecificPrice.php:435
4013
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 6129
0.352 ms 1 /classes/Product.php:2902
4221
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 9697
ORDER BY `position`
0.352 ms 1 Yes /classes/Product.php:3545
3962
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 5296
0.351 ms 1 /classes/Product.php:2902
865
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2789
ORDER BY f.position ASC
0.351 ms 5 Yes /classes/Product.php:6021
834
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.350 ms 1 /classes/Product.php:5659
4462
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 76) LIMIT 1
0.350 ms 1 /src/Adapter/EntityMapper.php:71
1871
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3775
AND image_shop.`cover` = 1 LIMIT 1
0.349 ms 2 /classes/Product.php:3570
2324
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 5971 AND `id_group` = 1 LIMIT 1
0.349 ms 0 /classes/GroupReduction.php:156
3093
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 9689
AND image_shop.`cover` = 1 LIMIT 1
0.349 ms 1 /classes/Product.php:3570
3968
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 5350
0.349 ms 1 /classes/Product.php:2902
105
SELECT SQL_NO_CACHE *
FROM `hgt78_tax` a
WHERE (a.`id_tax` = 1) LIMIT 1
0.348 ms 1 /src/Adapter/EntityMapper.php:71
1606
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3559
AND image_shop.`cover` = 1 LIMIT 1
0.348 ms 1 /classes/Product.php:3570
2704
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 7941
AND image_shop.`cover` = 1 LIMIT 1
0.348 ms 1 /classes/Product.php:3570
4178
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 9325
0.348 ms 1 /classes/Product.php:2902
904
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3177)
0.348 ms 1 /classes/Product.php:3860
1017
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2638 AND `id_group` = 1 LIMIT 1
0.348 ms 0 /classes/GroupReduction.php:156
1691
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3746) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.347 ms 1 /classes/stock/StockAvailable.php:453
2351
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `hgt78_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 178 LIMIT 1
0.347 ms 1 /classes/Category.php:1378
3719
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2644
0.347 ms 1 /classes/Product.php:2902
2091
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4963) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.347 ms 1 /classes/stock/StockAvailable.php:453
3241
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 10072
AND image_shop.`cover` = 1 LIMIT 1
0.346 ms 1 /classes/Product.php:3570
163
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 6727)
0.346 ms 1 /classes/Product.php:3860
1789
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3755 AND `id_group` = 1 LIMIT 1
0.346 ms 0 /classes/GroupReduction.php:156
1868
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3771) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.346 ms 1 /classes/stock/StockAvailable.php:453
1987
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4574)
0.346 ms 1 /classes/Product.php:3860
2188
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 5284)
0.346 ms 1 /classes/Product.php:3860
2560
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 6187
AND image_shop.`cover` = 1 LIMIT 1
0.345 ms 1 /classes/Product.php:3570
2648
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 6499
AND image_shop.`cover` = 1 LIMIT 1
0.345 ms 2 /classes/Product.php:3570
2737
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 7944
AND image_shop.`cover` = 1 LIMIT 1
0.345 ms 1 /classes/Product.php:3570
3071
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 9686
AND image_shop.`cover` = 1 LIMIT 1
0.345 ms 1 /classes/Product.php:3570
3189
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 10067 AND `id_group` = 1 LIMIT 1
0.345 ms 0 /classes/GroupReduction.php:156
4373
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 216) AND (b.`id_shop` = 1) LIMIT 1
0.345 ms 1 /src/Adapter/EntityMapper.php:71
4375
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 44) LIMIT 1
0.345 ms 1 /src/Adapter/EntityMapper.php:71
1354
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3255 LIMIT 1
0.344 ms 10 /classes/SpecificPrice.php:435
1664
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3689
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.344 ms 1 /classes/SpecificPrice.php:259
1684
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.344 ms 1 /classes/Product.php:5659
1740
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3751 LIMIT 1
0.344 ms 10 /classes/SpecificPrice.php:435
1939
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 184 LIMIT 1
0.344 ms 1 /classes/Product.php:5659
2050
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4943
AND image_shop.`cover` = 1 LIMIT 1
0.344 ms 1 /classes/Product.php:3570
2140
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 113 LIMIT 1
0.344 ms 1 /classes/Product.php:5659
2439
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 6176
AND image_shop.`cover` = 1 LIMIT 1
0.344 ms 1 /classes/Product.php:3570
3857
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3763
0.344 ms 1 /classes/Product.php:2902
79
SELECT SQL_NO_CACHE * FROM hgt78_range_price WHERE id_carrier = 282 LIMIT 1
0.344 ms 2 /modules/colissimo_simplicite/colissimo_simplicite.php:1415
171
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 309 LIMIT 1
0.344 ms 1 /classes/Product.php:5659
1402
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3326 AND id_shop=1 LIMIT 1
0.343 ms 1 /classes/Product.php:6876
2250
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 5589
AND image_shop.`cover` = 1 LIMIT 1
0.343 ms 2 /classes/Product.php:3570
1120
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2624
AND image_shop.`cover` = 1 LIMIT 1
0.342 ms 1 /classes/Product.php:3570
1962
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3936 LIMIT 1
0.342 ms 10 /classes/SpecificPrice.php:435
261
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 5140
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.342 ms 0 /classes/SpecificPrice.php:259
1123
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2624
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.342 ms 0 /classes/SpecificPrice.php:259
1410
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3155
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.342 ms 0 /classes/SpecificPrice.php:259
2458
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 6177) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.342 ms 1 /classes/stock/StockAvailable.php:453
4209
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 9692
ORDER BY `position`
0.342 ms 1 Yes /classes/Product.php:3545
841
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3179) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.341 ms 1 /classes/stock/StockAvailable.php:453
2205
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 5296
AND image_shop.`cover` = 1 LIMIT 1
0.341 ms 2 /classes/Product.php:3570
636
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2771 LIMIT 1
0.341 ms 10 /classes/SpecificPrice.php:435
924
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2635
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.341 ms 0 /classes/SpecificPrice.php:259
2408
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 6172 LIMIT 1
0.341 ms 10 /classes/SpecificPrice.php:435
2927
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 8975 LIMIT 1
0.341 ms 16 /classes/SpecificPrice.php:435
1016
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2638 AND id_shop=1 LIMIT 1
0.340 ms 1 /classes/Product.php:6876
1271
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2646) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.340 ms 1 /classes/stock/StockAvailable.php:453
1551
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3455
AND image_shop.`cover` = 1 LIMIT 1
0.340 ms 1 /classes/Product.php:3570
3839
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3752
0.340 ms 1 /classes/Product.php:2902
4377
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 51) LIMIT 1
0.340 ms 1 /src/Adapter/EntityMapper.php:71
2472
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 6179
AND image_shop.`cover` = 1 LIMIT 1
0.339 ms 1 /classes/Product.php:3570
2474
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 6179 LIMIT 1
0.339 ms 10 /classes/SpecificPrice.php:435
4072
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 6193
ORDER BY `position`
0.339 ms 1 Yes /classes/Product.php:3545
4278
SELECT SQL_NO_CACHE * FROM `hgt78_hook_module_exceptions`
WHERE `id_shop` IN (1)
0.339 ms 1 /classes/module/Module.php:2046
2096
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4964 LIMIT 1
0.339 ms 10 /classes/SpecificPrice.php:435
1804
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3757
AND image_shop.`cover` = 1 LIMIT 1
0.338 ms 1 /classes/Product.php:3570
2365
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 6106
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.338 ms 0 /classes/SpecificPrice.php:259
3917
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4942
0.338 ms 1 /classes/Product.php:2902
4333
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 175) LIMIT 1
0.338 ms 1 /src/Adapter/EntityMapper.php:71
4378
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 51 AND `id_shop` = 1
0.338 ms 6 /src/Adapter/EntityMapper.php:79
3128
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 9692 LIMIT 1
0.338 ms 11 /classes/SpecificPrice.php:435
1422
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2818
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.337 ms 0 /classes/SpecificPrice.php:259
1919
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3805
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.337 ms 0 /classes/SpecificPrice.php:259
4331
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 172) LIMIT 1
0.337 ms 1 /src/Adapter/EntityMapper.php:71
687
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2778) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.337 ms 1 /classes/stock/StockAvailable.php:453
1366
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3256
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.337 ms 0 /classes/SpecificPrice.php:259
3779
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2654
0.337 ms 1 /classes/Product.php:2902
713
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.336 ms 1 /classes/Product.php:5659
1264
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.336 ms 1 /classes/Product.php:5659
1535
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2654 AND id_shop=1 LIMIT 1
0.336 ms 1 /classes/Product.php:6876
1790
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3755) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.336 ms 1 /classes/stock/StockAvailable.php:453
2403
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 6129) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.336 ms 1 /classes/stock/StockAvailable.php:453
3544
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2777
ORDER BY `position`
0.336 ms 1 Yes /classes/Product.php:3545
1564
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3484 LIMIT 1
0.335 ms 10 /classes/SpecificPrice.php:435
1941
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3807
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.335 ms 0 /classes/SpecificPrice.php:259
3309
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 10302
AND image_shop.`cover` = 1 LIMIT 1
0.335 ms 1 /classes/Product.php:3570
3983
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 5592
0.335 ms 1 /classes/Product.php:2902
4394
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 73 AND `id_shop` = 1
0.335 ms 6 /src/Adapter/EntityMapper.php:79
4456
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 36) LIMIT 1
0.335 ms 1 /src/Adapter/EntityMapper.php:71
305
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 5136
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.334 ms 0 /classes/SpecificPrice.php:259
313
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 5135
AND image_shop.`cover` = 1 LIMIT 1
0.334 ms 1 /classes/Product.php:3570
1414
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3155 AND `id_group` = 1 LIMIT 1
0.334 ms 0 /classes/GroupReduction.php:156
2450
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 6177
AND image_shop.`cover` = 1 LIMIT 1
0.334 ms 1 /classes/Product.php:3570
966
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.333 ms 1 /classes/Product.php:5659
1280
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2642 AND id_shop=1 LIMIT 1
0.333 ms 1 /classes/Product.php:6876
1904
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3804
AND image_shop.`cover` = 1 LIMIT 1
0.333 ms 1 /classes/Product.php:3570
3688
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2648
ORDER BY `position`
0.333 ms 1 Yes /classes/Product.php:3545
4121
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 7773
0.333 ms 1 /classes/Product.php:2902
3126
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 9692
AND image_shop.`cover` = 1 LIMIT 1
0.332 ms 1 /classes/Product.php:3570
2151
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 113 LIMIT 1
0.332 ms 1 /classes/Product.php:5659
2392
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 6108) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.332 ms 1 /classes/stock/StockAvailable.php:453
2598
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 6191)
0.332 ms 1 /classes/Product.php:3860
4327
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 62) LIMIT 1
0.332 ms 1 /src/Adapter/EntityMapper.php:71
756
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3178
AND image_shop.`cover` = 1 LIMIT 1
0.331 ms 1 /classes/Product.php:3570
1935
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3806) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.331 ms 1 /classes/stock/StockAvailable.php:453
2216
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 5335
AND image_shop.`cover` = 1 LIMIT 1
0.331 ms 1 /classes/Product.php:3570
692
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2779 LIMIT 1
0.330 ms 10 /classes/SpecificPrice.php:435
4172
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 9323
0.330 ms 1 /classes/Product.php:2902
4288
SELECT SQL_NO_CACHE id_group FROM hgt78_cart_rule_group WHERE id_cart_rule = 0
0.330 ms 1 /classes/CartRule.php:438
832
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2781
ORDER BY f.position ASC
0.329 ms 5 Yes /classes/Product.php:6021
1760
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3753
AND image_shop.`cover` = 1 LIMIT 1
0.329 ms 1 /classes/Product.php:3570
1918
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3805 LIMIT 1
0.329 ms 10 /classes/SpecificPrice.php:435
4081
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 6499
ORDER BY `position`
0.329 ms 2 Yes /classes/Product.php:3545
1783
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.328 ms 1 /classes/Product.php:5659
1966
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3936 AND id_shop=1 LIMIT 1
0.328 ms 1 /classes/Product.php:6876
515
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2773 LIMIT 1
0.328 ms 10 /classes/SpecificPrice.php:435
4335
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 185) LIMIT 1
0.328 ms 1 /src/Adapter/EntityMapper.php:71
233
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 5143) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.327 ms 1 /classes/stock/StockAvailable.php:453
921
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2635
AND image_shop.`cover` = 1 LIMIT 1
0.327 ms 1 /classes/Product.php:3570
1192
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2656 AND id_shop=1 LIMIT 1
0.327 ms 1 /classes/Product.php:6876
1391
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3265 AND id_shop=1 LIMIT 1
0.327 ms 1 /classes/Product.php:6876
1689
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3746 AND id_shop=1 LIMIT 1
0.327 ms 1 /classes/Product.php:6876
4407
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 262) LIMIT 1
0.326 ms 1 /src/Adapter/EntityMapper.php:71
114
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 7542
AND image_shop.`cover` = 1 LIMIT 1
0.326 ms 1 /classes/Product.php:3570
2107
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4965 LIMIT 1
0.326 ms 10 /classes/SpecificPrice.php:435
2342
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 5973
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.326 ms 0 /classes/SpecificPrice.php:259
1431
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.325 ms 1 /classes/Product.php:5659
1704
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3747
ORDER BY f.position ASC
0.325 ms 5 Yes /classes/Product.php:6021
1739
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.325 ms 1 /classes/Product.php:5659
1993
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4575
AND image_shop.`cover` = 1 LIMIT 1
0.325 ms 1 /classes/Product.php:3570
2856
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 8396) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.325 ms 1 /classes/stock/StockAvailable.php:453
4433
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 96 AND `id_shop` = 1
0.325 ms 6 /src/Adapter/EntityMapper.php:79
2334
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 5972 AND id_shop=1 LIMIT 1
0.324 ms 1 /classes/Product.php:6876
3782
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3454
0.324 ms 1 /classes/Product.php:2902
1696
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3747 LIMIT 1
0.323 ms 10 /classes/SpecificPrice.php:435
1298
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2655 LIMIT 1
0.323 ms 10 /classes/SpecificPrice.php:435
651
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2738)
0.322 ms 1 /classes/Product.php:3860
660
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2764
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.322 ms 0 /classes/SpecificPrice.php:259
4313
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 55) LIMIT 1
0.322 ms 1 /src/Adapter/EntityMapper.php:71
1459
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3107 AND `id_group` = 1 LIMIT 1
0.321 ms 0 /classes/GroupReduction.php:156
4415
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 266) LIMIT 1
0.320 ms 1 /src/Adapter/EntityMapper.php:71
77
SELECT SQL_NO_CACHE * FROM hgt78_carrier_zone WHERE id_carrier = 282 LIMIT 1
0.320 ms 4 /modules/colissimo_simplicite/colissimo_simplicite.php:1383
753
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2800) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.320 ms 1 /classes/stock/StockAvailable.php:453
1850
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 174 LIMIT 1
0.320 ms 1 /classes/Product.php:5659
1867
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3771 AND `id_group` = 1 LIMIT 1
0.320 ms 0 /classes/GroupReduction.php:156
2900
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 8418) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.320 ms 1 /classes/stock/StockAvailable.php:453
3836
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3751
0.320 ms 1 /classes/Product.php:2902
614
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2692 LIMIT 1
0.319 ms 10 /classes/SpecificPrice.php:435
867
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 182 LIMIT 1
0.319 ms 1 /classes/Product.php:5659
2153
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 5267
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.319 ms 0 /classes/SpecificPrice.php:259
2631
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 6194)
0.319 ms 1 /classes/Product.php:3860
4314
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 55 AND `id_shop` = 1
0.319 ms 6 /src/Adapter/EntityMapper.php:79
2106
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.318 ms 1 /classes/Product.php:5659
4787
SELECT SQL_NO_CACHE `name`
FROM `hgt78_hook`
WHERE `id_hook` = 912 LIMIT 1
0.318 ms 1 /classes/Hook.php:247
1860
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3771
AND image_shop.`cover` = 1 LIMIT 1
0.318 ms 1 /classes/Product.php:3570
4783
SELECT SQL_NO_CACHE `id_module` FROM `hgt78_module` WHERE `name` = "iqitlinksmanager" LIMIT 1
0.318 ms 1 /classes/module/Module.php:2664
1531
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2654 LIMIT 1
0.317 ms 10 /classes/SpecificPrice.php:435
3920
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4943
0.317 ms 1 /classes/Product.php:2902
3938
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4966
0.317 ms 1 /classes/Product.php:2902
565
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2766) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.317 ms 1 /classes/stock/StockAvailable.php:453
1607
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.317 ms 1 /classes/Product.php:5659
1877
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3775 AND id_shop=1 LIMIT 1
0.317 ms 1 /classes/Product.php:6876
4315
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 71) LIMIT 1
0.317 ms 1 /src/Adapter/EntityMapper.php:71
4799
INSERT INTO `hgt78_connections_source` (`id_connections`, `http_referer`, `request_uri`, `keywords`, `date_add`) VALUES ('105465', '', 'www.encens.fr/2-accueil?productListView=grid&q=Cat%C3%A9gories-Luminaires%2FDisponibilit%C3%A9-En+stock-Non+disponible&resultsPerPage=99999', '', '2025-05-01 16:11:25')
0.317 ms 1 /classes/ObjectModel.php:622
239
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 5142
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.316 ms 0 /classes/SpecificPrice.php:259
326
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 5134 LIMIT 1
0.316 ms 10 /classes/SpecificPrice.php:435
1518
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2650
AND image_shop.`cover` = 1 LIMIT 1
0.316 ms 1 /classes/Product.php:3570
2005
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `hgt78_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 177 LIMIT 1
0.316 ms 1 /classes/Category.php:1378
2118
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4966 LIMIT 1
0.316 ms 10 /classes/SpecificPrice.php:435
4001
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 6047
0.316 ms 1 /classes/Product.php:2902
336
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 309 LIMIT 1
0.315 ms 1 /classes/Product.php:5659
4431
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 82 AND `id_shop` = 1
0.315 ms 6 /src/Adapter/EntityMapper.php:79
2440
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 182 LIMIT 1
0.314 ms 1 /classes/Product.php:5659
2516
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 6183
AND image_shop.`cover` = 1 LIMIT 1
0.314 ms 1 /classes/Product.php:3570
2756
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 7945) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.314 ms 1 /classes/stock/StockAvailable.php:453
3703
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2647
ORDER BY `position`
0.314 ms 1 Yes /classes/Product.php:3545
645
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2738
AND image_shop.`cover` = 1 LIMIT 1
0.313 ms 1 /classes/Product.php:3570
1408
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 181 LIMIT 1
0.313 ms 1 /classes/Product.php:5659
1884
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3776 LIMIT 1
0.313 ms 10 /classes/SpecificPrice.php:435
3914
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4935
0.313 ms 1 /classes/Product.php:2902
4234
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 10070
0.313 ms 1 /classes/Product.php:2902
2867
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 8397) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.312 ms 1 /classes/stock/StockAvailable.php:453
3764
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3327
0.312 ms 1 /classes/Product.php:2902
4046
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 6183
0.312 ms 1 /classes/Product.php:2902
3845
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3754
0.312 ms 1 /classes/Product.php:2902
1216
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2657) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.311 ms 1 /classes/stock/StockAvailable.php:453
2418
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 182 LIMIT 1
0.311 ms 1 /classes/Product.php:5659
4237
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 10071
0.311 ms 1 /classes/Product.php:2902
3023
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 9535) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.311 ms 1 /classes/stock/StockAvailable.php:453
4019
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 6173
0.311 ms 1 /classes/Product.php:2902
2152
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 5267 LIMIT 1
0.310 ms 10 /classes/SpecificPrice.php:435
2659
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 6500
AND image_shop.`cover` = 1 LIMIT 1
0.310 ms 2 /classes/Product.php:3570
115
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 185 LIMIT 1
0.310 ms 1 /classes/Product.php:5659
988
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2636
AND image_shop.`cover` = 1 LIMIT 1
0.310 ms 1 /classes/Product.php:3570
1844
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3765 AND id_shop=1 LIMIT 1
0.310 ms 1 /classes/Product.php:6876
1924
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3805) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.310 ms 1 /classes/stock/StockAvailable.php:453
2872
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 8401 LIMIT 1
0.310 ms 10 /classes/SpecificPrice.php:435
2878
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 8401) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.310 ms 1 /classes/stock/StockAvailable.php:453
2894
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 8418 LIMIT 1
0.310 ms 10 /classes/SpecificPrice.php:435
3001
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 9324) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.310 ms 1 /classes/stock/StockAvailable.php:453
3995
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 5972
0.310 ms 1 /classes/Product.php:2902
609
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2691) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.309 ms 1 /classes/stock/StockAvailable.php:453
525
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 182 LIMIT 1
0.309 ms 1 /classes/Product.php:5659
923
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2635 LIMIT 1
0.309 ms 10 /classes/SpecificPrice.php:435
1823
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3763 AND `id_group` = 1 LIMIT 1
0.309 ms 0 /classes/GroupReduction.php:156
2194
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 5293
AND image_shop.`cover` = 1 LIMIT 1
0.309 ms 2 /classes/Product.php:3570
526
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2774 LIMIT 1
0.308 ms 10 /classes/SpecificPrice.php:435
4049
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 6184
0.308 ms 1 /classes/Product.php:2902
1078
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2620 LIMIT 1
0.308 ms 10 /classes/SpecificPrice.php:435
116
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 7542 LIMIT 1
0.307 ms 10 /classes/SpecificPrice.php:435
4395
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 74) LIMIT 1
0.307 ms 1 /src/Adapter/EntityMapper.php:71
4444
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 61) LIMIT 1
0.307 ms 1 /src/Adapter/EntityMapper.php:71
3416
SELECT SQL_NO_CACHE `name`, `alias` FROM `hgt78_hook_alias`
0.307 ms 88 /classes/Hook.php:290
80
SELECT SQL_NO_CACHE * FROM hgt78_delivery WHERE id_carrier = 282 LIMIT 1
0.306 ms 8 /modules/colissimo_simplicite/colissimo_simplicite.php:1420
238
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 5142 LIMIT 1
0.306 ms 10 /classes/SpecificPrice.php:435
2001
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4575) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.306 ms 1 /classes/stock/StockAvailable.php:453
2396
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.306 ms 1 /classes/Product.php:5659
4175
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 9324
0.306 ms 1 /classes/Product.php:2902
20
SELECT SQL_NO_CACHE * FROM `hgt78_hook_module_exceptions`
WHERE `id_shop` IN (1)
0.306 ms 1 /classes/module/Module.php:2046
1299
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2655
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.306 ms 1 /classes/SpecificPrice.php:259
2845
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 8395) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.306 ms 1 /classes/stock/StockAvailable.php:453
3568
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3178
ORDER BY `position`
0.306 ms 1 Yes /classes/Product.php:3545
4432
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 96) LIMIT 1
0.306 ms 1 /src/Adapter/EntityMapper.php:71
2325
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 5971) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.305 ms 1 /classes/stock/StockAvailable.php:453
3378
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 11001 LIMIT 1
0.305 ms 10 /classes/SpecificPrice.php:435
728
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2798)
0.305 ms 1 /classes/Product.php:3860
1307
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2644
AND image_shop.`cover` = 1 LIMIT 1
0.305 ms 1 /classes/Product.php:3570
1426
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2818 AND `id_group` = 1 LIMIT 1
0.305 ms 0 /classes/GroupReduction.php:156
2442
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 6176
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.305 ms 0 /classes/SpecificPrice.php:259
2995
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 9324 LIMIT 1
0.305 ms 10 /classes/SpecificPrice.php:435
4476
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 84) LIMIT 1
0.304 ms 1 /src/Adapter/EntityMapper.php:71
1542
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3454 LIMIT 1
0.304 ms 10 /classes/SpecificPrice.php:435
4124
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 8392
0.304 ms 1 /classes/Product.php:2902
4446
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 66) LIMIT 1
0.304 ms 1 /src/Adapter/EntityMapper.php:71
2922
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 8420) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.303 ms 1 /classes/stock/StockAvailable.php:453
1608
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3559 LIMIT 1
0.303 ms 10 /classes/SpecificPrice.php:435
193
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 309 LIMIT 1
0.302 ms 1 /classes/Product.php:5659
679
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2778
AND image_shop.`cover` = 1 LIMIT 1
0.302 ms 1 /classes/Product.php:3570
1443
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3099 LIMIT 1
0.302 ms 10 /classes/SpecificPrice.php:435
276
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 5139 AND `id_group` = 1 LIMIT 1
0.302 ms 0 /classes/GroupReduction.php:156
1777
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3754 AND id_shop=1 LIMIT 1
0.302 ms 1 /classes/Product.php:6876
1851
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3766 LIMIT 1
0.302 ms 10 /classes/SpecificPrice.php:435
1855
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3766 AND id_shop=1 LIMIT 1
0.302 ms 1 /classes/Product.php:6876
1630
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3585 LIMIT 1
0.301 ms 10 /classes/SpecificPrice.php:435
2380
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 6107 AND `id_group` = 1 LIMIT 1
0.301 ms 0 /classes/GroupReduction.php:156
1133
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2625 LIMIT 1
0.301 ms 10 /classes/SpecificPrice.php:435
1563
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.301 ms 1 /classes/Product.php:5659
4458
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 42) LIMIT 1
0.301 ms 1 /src/Adapter/EntityMapper.php:71
307
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 5136)
0.300 ms 1 /classes/Product.php:3860
2745
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 7944) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.300 ms 1 /classes/stock/StockAvailable.php:453
3956
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 5284
0.300 ms 1 /classes/Product.php:2902
471
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2767 LIMIT 1
0.300 ms 10 /classes/SpecificPrice.php:435
3869
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3771
0.300 ms 1 /classes/Product.php:2902
3977
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 5590
0.300 ms 1 /classes/Product.php:2902
4255
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 10299
0.300 ms 1 /classes/Product.php:2902
3306
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 10299) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.299 ms 1 /classes/stock/StockAvailable.php:453
4323
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 38) LIMIT 1
0.299 ms 1 /src/Adapter/EntityMapper.php:71
703
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2795 LIMIT 1
0.299 ms 10 /classes/SpecificPrice.php:435
1629
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.299 ms 1 /classes/Product.php:5659
2264
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 5590 LIMIT 1
0.299 ms 10 /classes/SpecificPrice.php:435
3045
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 9597) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.299 ms 1 /classes/stock/StockAvailable.php:453
3350
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 10305) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.299 ms 1 /classes/stock/StockAvailable.php:453
4216
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 9694
0.299 ms 1 /classes/Product.php:2902
2102
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4964) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.298 ms 1 /classes/stock/StockAvailable.php:453
2742
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 7944)
0.298 ms 1 /classes/Product.php:3860
3788
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3484
0.298 ms 1 /classes/Product.php:2902
1150
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2626) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.297 ms 1 /classes/stock/StockAvailable.php:453
1236
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2649 AND id_shop=1 LIMIT 1
0.297 ms 1 /classes/Product.php:6876
2291
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 5592 AND `id_group` = 1 LIMIT 1
0.297 ms 0 /classes/GroupReduction.php:156
2425
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 6173) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.297 ms 1 /classes/stock/StockAvailable.php:453
2529
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 6184 LIMIT 1
0.297 ms 10 /classes/SpecificPrice.php:435
3184
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 10067 LIMIT 1
0.297 ms 10 /classes/SpecificPrice.php:435
1344
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3254
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.296 ms 0 /classes/SpecificPrice.php:259
1700
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3747 AND id_shop=1 LIMIT 1
0.296 ms 1 /classes/Product.php:6876
4052
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 6185
0.296 ms 1 /classes/Product.php:2902
928
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2635 AND `id_group` = 1 LIMIT 1
0.296 ms 0 /classes/GroupReduction.php:156
1338
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3252) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.296 ms 1 /classes/stock/StockAvailable.php:453
1945
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3807 AND `id_group` = 1 LIMIT 1
0.296 ms 0 /classes/GroupReduction.php:156
2773
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 7769 LIMIT 1
0.296 ms 10 /classes/SpecificPrice.php:435
2977
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 9321 AND id_shop=1 LIMIT 1
0.296 ms 1 /classes/Product.php:6876
3273
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 10111) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.296 ms 1 /classes/stock/StockAvailable.php:453
4362
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 78) LIMIT 1
0.296 ms 1 /src/Adapter/EntityMapper.php:71
602
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.295 ms 1 /classes/Product.php:5659
1778
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3754 AND `id_group` = 1 LIMIT 1
0.295 ms 0 /classes/GroupReduction.php:156
2069
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4944) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.295 ms 1 /classes/stock/StockAvailable.php:453
2551
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 6186 LIMIT 1
0.295 ms 10 /classes/SpecificPrice.php:435
2884
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 8417
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.295 ms 0 /classes/SpecificPrice.php:259
2111
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4965 AND id_shop=1 LIMIT 1
0.295 ms 1 /classes/Product.php:6876
2973
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 9321 LIMIT 1
0.295 ms 10 /classes/SpecificPrice.php:435
3232
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 10071 LIMIT 1
0.295 ms 10 /classes/SpecificPrice.php:435
3896
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3936
0.295 ms 1 /classes/Product.php:2902
4447
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 66 AND `id_shop` = 1
0.295 ms 6 /src/Adapter/EntityMapper.php:79
1018
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2638) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.294 ms 1 /classes/stock/StockAvailable.php:453
3334
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 10304
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.294 ms 1 /classes/SpecificPrice.php:259
4413
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 265) LIMIT 1
0.294 ms 1 /src/Adapter/EntityMapper.php:71
1553
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3455 LIMIT 1
0.294 ms 10 /classes/SpecificPrice.php:435
2225
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 5335) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.294 ms 1 /classes/stock/StockAvailable.php:453
2314
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 5970) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.294 ms 1 /classes/stock/StockAvailable.php:453
4363
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 78 AND `id_shop` = 1
0.294 ms 6 /src/Adapter/EntityMapper.php:79
4784
SELECT SQL_NO_CACHE `id_module` FROM `hgt78_module_shop` WHERE `id_module` = 89 AND `id_shop` = 1 LIMIT 1
0.294 ms 1 /classes/module/Module.php:2137
27
SELECT SQL_NO_CACHE `id_lang` FROM `hgt78_lang`
WHERE `locale` = 'fr-fr'
OR `language_code` = 'fr-fr' LIMIT 1
0.293 ms 6 /classes/Language.php:883
499
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2769) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.293 ms 1 /classes/stock/StockAvailable.php:453
2823
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 8393) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.293 ms 1 /classes/stock/StockAvailable.php:453
3339
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 10304) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.293 ms 1 /classes/stock/StockAvailable.php:453
4420
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 49) LIMIT 1
0.293 ms 1 /src/Adapter/EntityMapper.php:71
4450
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 80) LIMIT 1
0.293 ms 1 /src/Adapter/EntityMapper.php:71
424
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `hgt78_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 38 LIMIT 1
0.292 ms 1 /classes/Category.php:1378
780
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3176 LIMIT 1
0.292 ms 10 /classes/SpecificPrice.php:435
2447
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 6176) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.292 ms 1 /classes/stock/StockAvailable.php:453
2767
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 7946) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.292 ms 1 /classes/stock/StockAvailable.php:453
2850
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 8396 LIMIT 1
0.292 ms 10 /classes/SpecificPrice.php:435
2883
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 8417 LIMIT 1
0.292 ms 10 /classes/SpecificPrice.php:435
2971
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `hgt78_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 173 LIMIT 1
0.292 ms 1 /classes/Category.php:1378
3028
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 9596 LIMIT 1
0.292 ms 10 /classes/SpecificPrice.php:435
3749
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2818
0.292 ms 1 /classes/Product.php:2902
4341
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 334) LIMIT 1
0.292 ms 1 /src/Adapter/EntityMapper.php:71
348
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4902 LIMIT 1
0.291 ms 10 /classes/SpecificPrice.php:435
3161
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 9695 LIMIT 1
0.291 ms 11 /classes/SpecificPrice.php:435
4340
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 190 AND `id_shop` = 1
0.291 ms 6 /src/Adapter/EntityMapper.php:79
631
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2693) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.291 ms 1 /classes/stock/StockAvailable.php:453
1852
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3766
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.291 ms 1 /classes/SpecificPrice.php:259
1857
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3766) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.291 ms 1 /classes/stock/StockAvailable.php:453
2445
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 6176 AND id_shop=1 LIMIT 1
0.291 ms 1 /classes/Product.php:6876
4320
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 169 AND `id_shop` = 1
0.291 ms 6 /src/Adapter/EntityMapper.php:79
4379
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 56) LIMIT 1
0.291 ms 1 /src/Adapter/EntityMapper.php:71
4329
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 72) LIMIT 1
0.290 ms 1 /src/Adapter/EntityMapper.php:71
1609
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3559
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.290 ms 0 /classes/SpecificPrice.php:259
2541
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 6185
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.290 ms 0 /classes/SpecificPrice.php:259
3034
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 9596) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.290 ms 1 /classes/stock/StockAvailable.php:453
3238
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 10071) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.290 ms 1 /classes/stock/StockAvailable.php:453
4316
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 71 AND `id_shop` = 1
0.290 ms 6 /src/Adapter/EntityMapper.php:79
250
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 5141
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.289 ms 0 /classes/SpecificPrice.php:259
446
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2651
AND image_shop.`cover` = 1 LIMIT 1
0.289 ms 1 /classes/Product.php:3570
4337
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 186) LIMIT 1
0.289 ms 1 /src/Adapter/EntityMapper.php:71
2124
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4966) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.289 ms 1 /classes/stock/StockAvailable.php:453
2141
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 5266 LIMIT 1
0.289 ms 10 /classes/SpecificPrice.php:435
2672
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 6501 LIMIT 1
0.289 ms 10 /classes/SpecificPrice.php:435
2889
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 8417) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.289 ms 1 /classes/stock/StockAvailable.php:453
3262
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 10073) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.289 ms 1 /classes/stock/StockAvailable.php:453
816
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2780)
0.288 ms 1 /classes/Product.php:3860
1314
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2644 AND `id_group` = 1 LIMIT 1
0.288 ms 0 /classes/GroupReduction.php:156
1364
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.288 ms 1 /classes/Product.php:5659
1817
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 174 LIMIT 1
0.288 ms 1 /classes/Product.php:5659
1946
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3807) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.288 ms 1 /classes/stock/StockAvailable.php:453
1976
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4256)
0.288 ms 1 /classes/Product.php:3860
3178
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 9697) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.288 ms 1 /classes/stock/StockAvailable.php:453
4474
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 83) LIMIT 1
0.288 ms 1 /src/Adapter/EntityMapper.php:71
1541
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 185 LIMIT 1
0.287 ms 1 /classes/Product.php:5659
2502
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 6181) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.287 ms 1 /classes/stock/StockAvailable.php:453
2956
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 9055) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.287 ms 1 /classes/stock/StockAvailable.php:453
3073
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 9686 LIMIT 1
0.287 ms 11 /classes/SpecificPrice.php:435
1784
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3755 LIMIT 1
0.286 ms 10 /classes/SpecificPrice.php:435
1839
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 174 LIMIT 1
0.286 ms 1 /classes/Product.php:5659
2368
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 6106 AND id_shop=1 LIMIT 1
0.286 ms 1 /classes/Product.php:6876
2979
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 9321) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.286 ms 1 /classes/stock/StockAvailable.php:453
3866
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3766
0.286 ms 1 /classes/Product.php:2902
4332
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 172 AND `id_shop` = 1
0.286 ms 6 /src/Adapter/EntityMapper.php:79
742
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2799) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.286 ms 1 /classes/stock/StockAvailable.php:453
1188
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2656 LIMIT 1
0.286 ms 10 /classes/SpecificPrice.php:435
2568
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 6187) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.286 ms 1 /classes/stock/StockAvailable.php:453
2984
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 9323 LIMIT 1
0.286 ms 10 /classes/SpecificPrice.php:435
3220
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 10070 LIMIT 1
0.286 ms 10 /classes/SpecificPrice.php:435
418
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2694 AND id_shop=1 LIMIT 1
0.285 ms 1 /classes/Product.php:6876
1476
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3327 LIMIT 1
0.285 ms 10 /classes/SpecificPrice.php:435
993
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2636)
0.285 ms 1 /classes/Product.php:3860
1409
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3155 LIMIT 1
0.285 ms 10 /classes/SpecificPrice.php:435
1830
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3764
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.285 ms 0 /classes/SpecificPrice.php:259
2298
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 5774
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.285 ms 1 /classes/SpecificPrice.php:259
2456
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 6177 AND id_shop=1 LIMIT 1
0.285 ms 1 /classes/Product.php:6876
2861
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 8397 LIMIT 1
0.285 ms 10 /classes/SpecificPrice.php:435
2965
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 9306 AND id_shop=1 LIMIT 1
0.285 ms 1 /classes/Product.php:6876
3548
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2778
0.285 ms 1 /classes/Product.php:2902
3734
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3256
0.285 ms 1 /classes/Product.php:2902
1612
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3559 AND id_shop=1 LIMIT 1
0.284 ms 1 /classes/Product.php:6876
2146
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 5266 AND `id_group` = 1 LIMIT 1
0.284 ms 0 /classes/GroupReduction.php:156
3117
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 9691 LIMIT 1
0.284 ms 11 /classes/SpecificPrice.php:435
3737
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3264
0.284 ms 1 /classes/Product.php:2902
1598
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3558
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.283 ms 0 /classes/SpecificPrice.php:259
1685
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3746 LIMIT 1
0.283 ms 10 /classes/SpecificPrice.php:435
1930
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3806
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.283 ms 0 /classes/SpecificPrice.php:259
2461
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 6178
AND image_shop.`cover` = 1 LIMIT 1
0.283 ms 1 /classes/Product.php:3570
2779
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 7769) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.283 ms 1 /classes/stock/StockAvailable.php:453
2990
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 9323) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.283 ms 1 /classes/stock/StockAvailable.php:453
3006
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 9325 LIMIT 1
0.283 ms 10 /classes/SpecificPrice.php:435
3250
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 10072) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.283 ms 1 /classes/stock/StockAvailable.php:453
3821
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3746
0.283 ms 1 /classes/Product.php:2902
3911
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4934
0.283 ms 1 /classes/Product.php:2902
4347
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 344 AND `id_shop` = 1
0.283 ms 6 /src/Adapter/EntityMapper.php:79
81
SELECT SQL_NO_CACHE `id_category`
FROM `hgt78_category_shop`
WHERE `id_category` = 2
AND `id_shop` = 1 LIMIT 1
0.282 ms 1 /classes/Category.php:2450
1139
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2625) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.282 ms 1 /classes/stock/StockAvailable.php:453
4330
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 72 AND `id_shop` = 1
0.282 ms 6 /src/Adapter/EntityMapper.php:79
4798
SELECT SQL_NO_CACHE `id_guest`
FROM `hgt78_connections`
WHERE `id_guest` = 194626
AND `date_add` > '2025-05-01 15:41:00'
AND id_shop IN (1) 
ORDER BY `date_add` DESC LIMIT 1
0.282 ms 1 Yes /classes/Connection.php:168
1675
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3745
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.282 ms 0 /classes/SpecificPrice.php:259
2573
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 6188 LIMIT 1
0.282 ms 10 /classes/SpecificPrice.php:435
3767
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2490
0.282 ms 1 /classes/Product.php:2902
805
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2793)
0.281 ms 1 /classes/Product.php:3860
2436
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 6174) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.281 ms 1 /classes/stock/StockAvailable.php:453
3830
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3749
0.281 ms 1 /classes/Product.php:2902
4079
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 6195
0.281 ms 1 /classes/Product.php:2902
2467
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 6178 AND id_shop=1 LIMIT 1
0.281 ms 1 /classes/Product.php:6876
4463
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 76 AND `id_shop` = 1
0.281 ms 6 /src/Adapter/EntityMapper.php:79
1565
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3484
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.280 ms 0 /classes/SpecificPrice.php:259
3226
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 10070) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.280 ms 1 /classes/stock/StockAvailable.php:453
3851
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3756
0.280 ms 1 /classes/Product.php:2902
1172
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2640) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.280 ms 1 /classes/stock/StockAvailable.php:453
1432
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2892 LIMIT 1
0.280 ms 10 /classes/SpecificPrice.php:435
2024
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4934) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.280 ms 1 /classes/stock/StockAvailable.php:453
2128
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `hgt78_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 113 LIMIT 1
0.280 ms 1 /classes/Category.php:1378
2145
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 5266 AND id_shop=1 LIMIT 1
0.280 ms 1 /classes/Product.php:6876
2390
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 6108 AND id_shop=1 LIMIT 1
0.280 ms 1 /classes/Product.php:6876
3379
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 11001
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.280 ms 1 /classes/SpecificPrice.php:259
1574
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.279 ms 1 /classes/Product.php:5659
1879
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3775) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.279 ms 1 /classes/stock/StockAvailable.php:453
2012
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4932 AND `id_group` = 1 LIMIT 1
0.279 ms 0 /classes/GroupReduction.php:156
2058
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4943) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.279 ms 1 /classes/stock/StockAvailable.php:453
3322
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 10303 LIMIT 1
0.279 ms 10 /classes/SpecificPrice.php:435
458
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 185 LIMIT 1
0.278 ms 1 /classes/Product.php:5659
748
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2800
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.278 ms 0 /classes/SpecificPrice.php:259
802
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2793 LIMIT 1
0.278 ms 10 /classes/SpecificPrice.php:435
1209
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.278 ms 1 /classes/Product.php:5659
1303
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2655 AND `id_group` = 1 LIMIT 1
0.278 ms 0 /classes/GroupReduction.php:156
1341
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3254
AND image_shop.`cover` = 1 LIMIT 1
0.278 ms 1 /classes/Product.php:3570
2008
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4932
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.278 ms 0 /classes/SpecificPrice.php:259
2483
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 6180
AND image_shop.`cover` = 1 LIMIT 1
0.278 ms 1 /classes/Product.php:3570
2717
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 7942 LIMIT 1
0.278 ms 10 /classes/SpecificPrice.php:435
2905
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 8419 LIMIT 1
0.278 ms 10 /classes/SpecificPrice.php:435
2916
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 8420 LIMIT 1
0.278 ms 10 /classes/SpecificPrice.php:435
3167
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 9695) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.278 ms 1 /classes/stock/StockAvailable.php:453
4393
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 73) LIMIT 1
0.278 ms 1 /src/Adapter/EntityMapper.php:71
1575
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3556 LIMIT 1
0.277 ms 10 /classes/SpecificPrice.php:435
1949
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3808
AND image_shop.`cover` = 1 LIMIT 1
0.277 ms 1 /classes/Product.php:3570
2615
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 6193
AND image_shop.`cover` = 1 LIMIT 1
0.277 ms 1 /classes/Product.php:3570
3300
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 10299 LIMIT 1
0.277 ms 10 /classes/SpecificPrice.php:435
4790
SELECT SQL_NO_CACHE additional FROM hgt78_lgcookieslaw_lang WHERE id_lang = 1 LIMIT 1
0.277 ms 1 /modules/lgcookieslaw/lgcookieslaw.php:161
4169
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 9321
0.277 ms 1 /classes/Product.php:2902
390
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3587
AND image_shop.`cover` = 1 LIMIT 1
0.276 ms 1 /classes/Product.php:3570
532
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2774) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.276 ms 1 /classes/stock/StockAvailable.php:453
2557
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 6186) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.276 ms 1 /classes/stock/StockAvailable.php:453
3752
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2892
0.276 ms 1 /classes/Product.php:2902
4061
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 6188
0.276 ms 1 /classes/Product.php:2902
2370
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 6106) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.276 ms 1 /classes/stock/StockAvailable.php:453
4338
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 186 AND `id_shop` = 1
0.276 ms 6 /src/Adapter/EntityMapper.php:79
1482
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3327) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.275 ms 1 /classes/stock/StockAvailable.php:453
2795
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 7773 LIMIT 1
0.275 ms 10 /classes/SpecificPrice.php:435
3295
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 10298) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.275 ms 1 /classes/stock/StockAvailable.php:453
4429
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 81 AND `id_shop` = 1
0.275 ms 6 /src/Adapter/EntityMapper.php:79
2302
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 5774 AND `id_group` = 1 LIMIT 1
0.275 ms 0 /classes/GroupReduction.php:156
3344
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 10305 LIMIT 1
0.275 ms 10 /classes/SpecificPrice.php:435
4472
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 39) LIMIT 1
0.275 ms 1 /src/Adapter/EntityMapper.php:71
1254
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2647 LIMIT 1
0.274 ms 10 /classes/SpecificPrice.php:435
2650
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 6499 LIMIT 1
0.274 ms 10 /classes/SpecificPrice.php:435
3208
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 10069 LIMIT 1
0.274 ms 10 /classes/SpecificPrice.php:435
1546
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3454 AND id_shop=1 LIMIT 1
0.274 ms 1 /classes/Product.php:6876
1636
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3585) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.274 ms 1 /classes/stock/StockAvailable.php:453
1889
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3776 AND `id_group` = 1 LIMIT 1
0.274 ms 0 /classes/GroupReduction.php:156
2108
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4965
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.274 ms 0 /classes/SpecificPrice.php:259
3084
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 9688 LIMIT 1
0.274 ms 11 /classes/SpecificPrice.php:435
3256
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 10073 LIMIT 1
0.274 ms 10 /classes/SpecificPrice.php:435
784
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3176 AND id_shop=1 LIMIT 1
0.273 ms 1 /classes/Product.php:6876
1169
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2640)
0.273 ms 1 /classes/Product.php:3860
1170
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2640 AND id_shop=1 LIMIT 1
0.273 ms 1 /classes/Product.php:6876
2085
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4963 LIMIT 1
0.273 ms 10 /classes/SpecificPrice.php:435
3101
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 9689) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.273 ms 1 /classes/stock/StockAvailable.php:453
3333
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 10304 LIMIT 1
0.273 ms 10 /classes/SpecificPrice.php:435
3367
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 12551 LIMIT 1
0.273 ms 10 /classes/SpecificPrice.php:435
591
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.272 ms 1 /classes/Product.php:5659
1526
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2650) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.272 ms 1 /classes/stock/StockAvailable.php:453
3384
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 11001) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.272 ms 1 /classes/stock/StockAvailable.php:453
4306
SELECT SQL_NO_CACHE `width`, `height`
FROM hgt78_image_type
WHERE `name` = 'small_default' LIMIT 1
0.272 ms 1 /classes/Image.php:563
4342
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 334 AND `id_shop` = 1
0.272 ms 6 /src/Adapter/EntityMapper.php:79
3680
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2640
0.272 ms 1 /classes/Product.php:2902
2095
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.271 ms 1 /classes/Product.php:5659
2466
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 6178)
0.271 ms 1 /classes/Product.php:3860
4421
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 49 AND `id_shop` = 1
0.271 ms 6 /src/Adapter/EntityMapper.php:79
149
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 7539 LIMIT 1
0.271 ms 10 /classes/SpecificPrice.php:435
2259
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 5589) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.271 ms 1 /classes/stock/StockAvailable.php:453
3196
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 10068 LIMIT 1
0.271 ms 10 /classes/SpecificPrice.php:435
3202
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 10068) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.271 ms 1 /classes/stock/StockAvailable.php:453
3356
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 12552 LIMIT 1
0.271 ms 10 /classes/SpecificPrice.php:435
4426
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 65) LIMIT 1
0.271 ms 1 /src/Adapter/EntityMapper.php:71
613
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.270 ms 1 /classes/Product.php:5659
2018
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4934 LIMIT 1
0.270 ms 10 /classes/SpecificPrice.php:435
4243
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 10073
0.270 ms 1 /classes/Product.php:2902
1324
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2645 AND id_shop=1 LIMIT 1
0.270 ms 1 /classes/Product.php:6876
2035
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4935) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.270 ms 1 /classes/stock/StockAvailable.php:453
2041
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4942 LIMIT 1
0.270 ms 10 /classes/SpecificPrice.php:435
2117
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.270 ms 1 /classes/Product.php:5659
4228
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 10068
0.270 ms 1 /classes/Product.php:2902
303
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 309 LIMIT 1
0.269 ms 1 /classes/Product.php:5659
1051
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2629) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.269 ms 1 /classes/stock/StockAvailable.php:453
2839
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 8395 LIMIT 1
0.269 ms 10 /classes/SpecificPrice.php:435
3935
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4965
0.269 ms 1 /classes/Product.php:2902
4225
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 10067
0.269 ms 1 /classes/Product.php:2902
4336
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 185 AND `id_shop` = 1
0.269 ms 6 /src/Adapter/EntityMapper.php:79
530
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2774 AND id_shop=1 LIMIT 1
0.269 ms 1 /classes/Product.php:6876
559
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2766 LIMIT 1
0.269 ms 10 /classes/SpecificPrice.php:435
1109
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3458
AND image_shop.`cover` = 1 LIMIT 1
0.269 ms 1 /classes/Product.php:3570
1872
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.269 ms 1 /classes/Product.php:5659
951
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2632) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.268 ms 1 /classes/stock/StockAvailable.php:453
1721
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3749)
0.268 ms 1 /classes/Product.php:3860
2385
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 178 LIMIT 1
0.268 ms 1 /classes/Product.php:5659
3201
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 10068 AND `id_group` = 1 LIMIT 1
0.268 ms 0 /classes/GroupReduction.php:156
3244
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 10072 LIMIT 1
0.268 ms 10 /classes/SpecificPrice.php:435
4400
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 162 AND `id_shop` = 1
0.268 ms 6 /src/Adapter/EntityMapper.php:79
927
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2635 AND id_shop=1 LIMIT 1
0.267 ms 1 /classes/Product.php:6876
1270
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2646 AND `id_group` = 1 LIMIT 1
0.267 ms 0 /classes/GroupReduction.php:156
1313
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2644 AND id_shop=1 LIMIT 1
0.267 ms 1 /classes/Product.php:6876
1427
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2818) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.267 ms 1 /classes/stock/StockAvailable.php:453
2213
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 5296) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.267 ms 1 /classes/stock/StockAvailable.php:453
2485
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 6180 LIMIT 1
0.267 ms 10 /classes/SpecificPrice.php:435
2828
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 8394 LIMIT 1
0.267 ms 2 /classes/SpecificPrice.php:435
4449
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 79 AND `id_shop` = 1
0.267 ms 6 /src/Adapter/EntityMapper.php:79
3284
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 10297) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.267 ms 1 /classes/stock/StockAvailable.php:453
4430
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 82) LIMIT 1
0.267 ms 1 /src/Adapter/EntityMapper.php:71
1464
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.266 ms 1 /classes/Product.php:5659
2915
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 184 LIMIT 1
0.266 ms 1 /classes/Product.php:5659
3854
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3757
0.266 ms 1 /classes/Product.php:2902
4459
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 42 AND `id_shop` = 1
0.266 ms 6 /src/Adapter/EntityMapper.php:79
519
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2773 AND id_shop=1 LIMIT 1
0.265 ms 1 /classes/Product.php:6876
1807
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3757
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.265 ms 0 /classes/SpecificPrice.php:259
2801
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 7773) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.265 ms 1 /classes/stock/StockAvailable.php:453
2834
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 8394) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.265 ms 1 /classes/stock/StockAvailable.php:453
3139
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 9693 LIMIT 1
0.265 ms 11 /classes/SpecificPrice.php:435
72
SELECT SQL_NO_CACHE *
FROM `hgt78_shop_url` a0
0.265 ms 1 /classes/PrestaShopCollection.php:383
494
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2769
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.265 ms 0 /classes/SpecificPrice.php:259
569
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 182 LIMIT 1
0.265 ms 1 /classes/Product.php:5659
1856
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3766 AND `id_group` = 1 LIMIT 1
0.265 ms 0 /classes/GroupReduction.php:156
2281
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 5591) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.265 ms 1 /classes/stock/StockAvailable.php:453
3095
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 9689 LIMIT 1
0.265 ms 11 /classes/SpecificPrice.php:435
3944
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 5266
0.265 ms 1 /classes/Product.php:2902
4428
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 81) LIMIT 1
0.265 ms 1 /src/Adapter/EntityMapper.php:71
785
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3176 AND `id_group` = 1 LIMIT 1
0.264 ms 0 /classes/GroupReduction.php:156
1768
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3753) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.264 ms 1 /classes/stock/StockAvailable.php:453
253
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 5141 AND id_shop=1 LIMIT 1
0.264 ms 1 /classes/Product.php:6876
702
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.264 ms 1 /classes/Product.php:5659
1460
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3107) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.264 ms 1 /classes/stock/StockAvailable.php:453
3145
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 9693) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.264 ms 1 /classes/stock/StockAvailable.php:453
3172
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 9697 LIMIT 1
0.264 ms 11 /classes/SpecificPrice.php:435
3890
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3807
0.264 ms 1 /classes/Product.php:2902
38
SELECT SQL_NO_CACHE `id_category`
FROM `hgt78_category_shop`
WHERE `id_category` = 2
AND `id_shop` = 1 LIMIT 1
0.263 ms 1 /classes/Category.php:2450
1581
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3556) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.263 ms 1 /classes/stock/StockAvailable.php:453
1403
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3326 AND `id_group` = 1 LIMIT 1
0.263 ms 0 /classes/GroupReduction.php:156
1520
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2650 LIMIT 1
0.263 ms 10 /classes/SpecificPrice.php:435
1537
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2654) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.263 ms 1 /classes/stock/StockAvailable.php:453
1705
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3748
AND image_shop.`cover` = 1 LIMIT 1
0.263 ms 1 /classes/Product.php:3570
1806
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3757 LIMIT 1
0.263 ms 10 /classes/SpecificPrice.php:435
2084
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.263 ms 1 /classes/Product.php:5659
3012
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 9325) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.263 ms 1 /classes/stock/StockAvailable.php:453
3150
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 9694 LIMIT 1
0.263 ms 11 /classes/SpecificPrice.php:435
3214
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 10069) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.263 ms 1 /classes/stock/StockAvailable.php:453
3410
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 5147
0.263 ms 1 /classes/Product.php:2902
3833
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3750
0.263 ms 1 /classes/Product.php:2902
447
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 185 LIMIT 1
0.262 ms 1 /classes/Product.php:5659
454
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2651) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.262 ms 1 /classes/stock/StockAvailable.php:453
514
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 182 LIMIT 1
0.262 ms 1 /classes/Product.php:5659
863
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2789) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.262 ms 1 /classes/stock/StockAvailable.php:453
1805
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.262 ms 1 /classes/Product.php:5659
1888
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3776 AND id_shop=1 LIMIT 1
0.262 ms 1 /classes/Product.php:6876
2174
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 5283 LIMIT 1
0.262 ms 8 /classes/SpecificPrice.php:435
3278
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 10297 LIMIT 1
0.262 ms 10 /classes/SpecificPrice.php:435
3311
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 10302 LIMIT 1
0.262 ms 10 /classes/SpecificPrice.php:435
3328
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 10303) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.262 ms 1 /classes/stock/StockAvailable.php:453
288
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 5138) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.261 ms 1 /classes/stock/StockAvailable.php:453
779
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.261 ms 1 /classes/Product.php:5659
1419
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.261 ms 1 /classes/Product.php:5659
2029
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4935 LIMIT 1
0.261 ms 10 /classes/SpecificPrice.php:435
3893
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3808
0.261 ms 1 /classes/Product.php:2902
2122
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4966 AND id_shop=1 LIMIT 1
0.261 ms 1 /classes/Product.php:6876
2682
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `hgt78_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 320 LIMIT 1
0.260 ms 1 /classes/Category.php:1378
2784
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 7779 LIMIT 1
0.260 ms 10 /classes/SpecificPrice.php:435
2887
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 8417 AND id_shop=1 LIMIT 1
0.260 ms 1 /classes/Product.php:6876
3156
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 9694) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.260 ms 1 /classes/stock/StockAvailable.php:453
3289
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 10298 LIMIT 1
0.260 ms 10 /classes/SpecificPrice.php:435
200
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 5146) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.260 ms 1 /classes/stock/StockAvailable.php:453
879
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2791 LIMIT 1
0.260 ms 10 /classes/SpecificPrice.php:435
2052
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4943 LIMIT 1
0.260 ms 10 /classes/SpecificPrice.php:435
3373
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 12551) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.260 ms 1 /classes/stock/StockAvailable.php:453
198
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 5146 AND id_shop=1 LIMIT 1
0.259 ms 1 /classes/Product.php:6876
1079
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2620
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.259 ms 0 /classes/SpecificPrice.php:259
1370
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3256 AND `id_group` = 1 LIMIT 1
0.259 ms 0 /classes/GroupReduction.php:156
1911
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3804 AND id_shop=1 LIMIT 1
0.259 ms 1 /classes/Product.php:6876
2496
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 6181 LIMIT 1
0.259 ms 10 /classes/SpecificPrice.php:435
3395
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 7541
0.259 ms 1 /classes/Product.php:2902
3413
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 5146
0.259 ms 1 /classes/Product.php:2902
3899
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4256
0.259 ms 1 /classes/Product.php:2902
4384
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 195 AND `id_shop` = 1
0.259 ms 6 /src/Adapter/EntityMapper.php:79
4475
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 83 AND `id_shop` = 1
0.259 ms 6 /src/Adapter/EntityMapper.php:79
2524
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 6183) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.258 ms 1 /classes/stock/StockAvailable.php:453
918
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2659) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.258 ms 1 /classes/stock/StockAvailable.php:453
1469
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3132 AND id_shop=1 LIMIT 1
0.258 ms 1 /classes/Product.php:6876
1470
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3132 AND `id_group` = 1 LIMIT 1
0.258 ms 0 /classes/GroupReduction.php:156
1568
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3484 AND id_shop=1 LIMIT 1
0.258 ms 1 /classes/Product.php:6876
1716
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3749
AND image_shop.`cover` = 1 LIMIT 1
0.258 ms 1 /classes/Product.php:3570
2130
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 5265 LIMIT 1
0.258 ms 10 /classes/SpecificPrice.php:435
2191
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 5284) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.258 ms 1 /classes/stock/StockAvailable.php:453
2319
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 5971 LIMIT 1
0.258 ms 10 /classes/SpecificPrice.php:435
2817
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 8393 LIMIT 1
0.258 ms 10 /classes/SpecificPrice.php:435
4425
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 60 AND `id_shop` = 1
0.258 ms 6 /src/Adapter/EntityMapper.php:79
2123
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4966 AND `id_group` = 1 LIMIT 1
0.257 ms 0 /classes/GroupReduction.php:156
2270
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 5590) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.257 ms 1 /classes/stock/StockAvailable.php:453
3090
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 9688) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.257 ms 1 /classes/stock/StockAvailable.php:453
3190
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 10067) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.257 ms 1 /classes/stock/StockAvailable.php:453
3267
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 10111 LIMIT 1
0.257 ms 10 /classes/SpecificPrice.php:435
3407
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 5148
0.257 ms 1 /classes/Product.php:2902
3881
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3804
0.257 ms 1 /classes/Product.php:2902
4376
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 44 AND `id_shop` = 1
0.257 ms 6 /src/Adapter/EntityMapper.php:79
4469
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 221 AND `id_shop` = 1
0.257 ms 6 /src/Adapter/EntityMapper.php:79
4478
SELECT SQL_NO_CACHE `width`, `height`
FROM hgt78_image_type
WHERE `name` = 'home_default' LIMIT 1
0.257 ms 1 /classes/Image.php:563
563
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2766 AND id_shop=1 LIMIT 1
0.256 ms 1 /classes/Product.php:6876
1530
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 185 LIMIT 1
0.256 ms 1 /classes/Product.php:5659
1901
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3777) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.256 ms 1 /classes/stock/StockAvailable.php:453
3671
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2625
0.256 ms 1 /classes/Product.php:2902
4422
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 59) LIMIT 1
0.256 ms 1 /src/Adapter/EntityMapper.php:71
4470
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 39) AND (b.`id_shop` = 1) LIMIT 1
0.256 ms 1 /src/Adapter/EntityMapper.php:71
4473
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 39 AND `id_shop` = 1
0.256 ms 6 /src/Adapter/EntityMapper.php:79
3317
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 10302) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.256 ms 1 /classes/stock/StockAvailable.php:453
4292
SELECT SQL_NO_CACHE `id_module` FROM `hgt78_module` WHERE `name` = "ps_languageselector" LIMIT 1
0.256 ms 1 /classes/module/Module.php:2664
803
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2793
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.255 ms 0 /classes/SpecificPrice.php:259
1990
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4574) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.255 ms 1 /classes/stock/StockAvailable.php:453
2275
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 5591 LIMIT 1
0.255 ms 10 /classes/SpecificPrice.php:435
320
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 5135 AND `id_group` = 1 LIMIT 1
0.255 ms 0 /classes/GroupReduction.php:156
1576
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3556
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.255 ms 1 /classes/SpecificPrice.php:259
1933
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3806 AND id_shop=1 LIMIT 1
0.255 ms 1 /classes/Product.php:6876
4353
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 46 AND `id_shop` = 1
0.255 ms 6 /src/Adapter/EntityMapper.php:79
669
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 182 LIMIT 1
0.254 ms 1 /classes/Product.php:5659
1073
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3477) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.254 ms 1 /classes/stock/StockAvailable.php:453
1142
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2626
AND image_shop.`cover` = 1 LIMIT 1
0.254 ms 1 /classes/Product.php:3570
1548
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3454) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.254 ms 1 /classes/stock/StockAvailable.php:453
1772
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.254 ms 1 /classes/Product.php:5659
1833
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3764 AND id_shop=1 LIMIT 1
0.254 ms 1 /classes/Product.php:6876
3079
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 9686) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.254 ms 1 /classes/stock/StockAvailable.php:453
330
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 5134 AND id_shop=1 LIMIT 1
0.253 ms 1 /classes/Product.php:6876
1951
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3808 LIMIT 1
0.253 ms 10 /classes/SpecificPrice.php:435
1232
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2649 LIMIT 1
0.253 ms 10 /classes/SpecificPrice.php:435
2074
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4962 LIMIT 1
0.253 ms 10 /classes/SpecificPrice.php:435
2080
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4962) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.253 ms 1 /classes/stock/StockAvailable.php:453
2129
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 113 LIMIT 1
0.253 ms 1 /classes/Product.php:5659
2336
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 5972) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.253 ms 1 /classes/stock/StockAvailable.php:453
2486
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 6180
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.253 ms 0 /classes/SpecificPrice.php:259
2790
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 7779) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.253 ms 1 /classes/stock/StockAvailable.php:453
3029
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 9596
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.253 ms 1 /classes/SpecificPrice.php:259
3056
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 9598) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.253 ms 1 /classes/stock/StockAvailable.php:453
4414
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 265 AND `id_shop` = 1
0.253 ms 6 /src/Adapter/EntityMapper.php:79
1957
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3808) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.252 ms 1 /classes/stock/StockAvailable.php:453
2241
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 5093 LIMIT 1
0.252 ms 9 /classes/SpecificPrice.php:435
2409
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 6172
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.252 ms 0 /classes/SpecificPrice.php:259
2661
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 6500 LIMIT 1
0.252 ms 10 /classes/SpecificPrice.php:435
3068
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 9687) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.252 ms 1 /classes/stock/StockAvailable.php:453
3123
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 9691) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.252 ms 1 /classes/stock/StockAvailable.php:453
3134
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 9692) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.252 ms 1 /classes/stock/StockAvailable.php:453
3362
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 12552) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.252 ms 1 /classes/stock/StockAvailable.php:453
3740
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3265
0.252 ms 1 /classes/Product.php:2902
4091
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 7938
0.252 ms 1 /classes/Product.php:2902
4195
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 9686
0.252 ms 1 /classes/Product.php:2902
4246
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 10111
0.252 ms 1 /classes/Product.php:2902
4468
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 221) LIMIT 1
0.252 ms 1 /src/Adapter/EntityMapper.php:71
2909
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 8419 AND id_shop=1 LIMIT 1
0.252 ms 1 /classes/Product.php:6876
194
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 5146 LIMIT 1
0.251 ms 10 /classes/SpecificPrice.php:435
220
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 5144 AND id_shop=1 LIMIT 1
0.251 ms 1 /classes/Product.php:6876
297
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 5137 AND id_shop=1 LIMIT 1
0.251 ms 1 /classes/Product.php:6876
404
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2893
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.251 ms 0 /classes/SpecificPrice.php:259
714
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2797 LIMIT 1
0.251 ms 10 /classes/SpecificPrice.php:435
764
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3178) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.251 ms 1 /classes/stock/StockAvailable.php:453
1012
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2638 LIMIT 1
0.251 ms 10 /classes/SpecificPrice.php:435
1480
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3327 AND id_shop=1 LIMIT 1
0.251 ms 1 /classes/Product.php:6876
2605
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 182 LIMIT 1
0.251 ms 1 /classes/Product.php:5659
2926
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 181 LIMIT 1
0.251 ms 1 /classes/Product.php:5659
3112
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 9690) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.251 ms 1 /classes/stock/StockAvailable.php:453
3773
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2733
0.251 ms 1 /classes/Product.php:2902
3794
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3557
0.251 ms 1 /classes/Product.php:2902
4328
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 62 AND `id_shop` = 1
0.251 ms 6 /src/Adapter/EntityMapper.php:79
3818
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3745
0.251 ms 1 /classes/Product.php:2902
209
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 5145 AND id_shop=1 LIMIT 1
0.250 ms 1 /classes/Product.php:6876
991
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2636
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.250 ms 0 /classes/SpecificPrice.php:259
1618
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.250 ms 1 /classes/Product.php:5659
1800
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3756 AND `id_group` = 1 LIMIT 1
0.250 ms 0 /classes/GroupReduction.php:156
2690
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 7938) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.250 ms 1 /classes/stock/StockAvailable.php:453
2695
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 7940 LIMIT 1
0.250 ms 10 /classes/SpecificPrice.php:435
2961
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 9306 LIMIT 1
0.250 ms 10 /classes/SpecificPrice.php:435
3887
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3806
0.250 ms 1 /classes/Product.php:2902
4040
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 6181
0.250 ms 1 /classes/Product.php:2902
4355
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 54) LIMIT 1
0.250 ms 1 /src/Adapter/EntityMapper.php:71
3464
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3741
0.250 ms 1 /classes/Product.php:2902
1995
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4575 LIMIT 1
0.249 ms 10 /classes/SpecificPrice.php:435
2207
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 5296 LIMIT 1
0.249 ms 10 /classes/SpecificPrice.php:435
960
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2633 AND id_shop=1 LIMIT 1
0.249 ms 1 /classes/Product.php:6876
2112
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4965 AND `id_group` = 1 LIMIT 1
0.249 ms 0 /classes/GroupReduction.php:156
1175
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2641
AND image_shop.`cover` = 1 LIMIT 1
0.248 ms 1 /classes/Product.php:3570
2230
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 5350 LIMIT 1
0.248 ms 10 /classes/SpecificPrice.php:435
1619
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3584 LIMIT 1
0.248 ms 10 /classes/SpecificPrice.php:435
1796
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3756
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.248 ms 0 /classes/SpecificPrice.php:259
1801
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3756) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.248 ms 1 /classes/stock/StockAvailable.php:453
2217
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `hgt78_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 62 LIMIT 1
0.248 ms 1 /classes/Category.php:1378
2942
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 8976 AND id_shop=1 LIMIT 1
0.248 ms 1 /classes/Product.php:6876
3348
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 10305 AND id_shop=1 LIMIT 1
0.248 ms 1 /classes/Product.php:6876
4213
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 9693
0.248 ms 1 /classes/Product.php:2902
4466
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 217) LIMIT 1
0.248 ms 1 /src/Adapter/EntityMapper.php:71
1834
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3764 AND `id_group` = 1 LIMIT 1
0.247 ms 0 /classes/GroupReduction.php:156
2047
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4942) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.247 ms 1 /classes/stock/StockAvailable.php:453
2202
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 5293) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.247 ms 1 /classes/stock/StockAvailable.php:453
3392
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 7542
0.247 ms 1 /classes/Product.php:2902
4477
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 84 AND `id_shop` = 1
0.247 ms 6 /src/Adapter/EntityMapper.php:79
2827
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 174 LIMIT 1
0.247 ms 1 /classes/Product.php:5659
64
SELECT SQL_NO_CACHE format
FROM `hgt78_address_format`
WHERE `id_country` = 8 LIMIT 1
0.246 ms 1 /classes/AddressFormat.php:656
1155
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2627 LIMIT 1
0.246 ms 10 /classes/SpecificPrice.php:435
2063
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4944 LIMIT 1
0.246 ms 10 /classes/SpecificPrice.php:435
2169
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 5282) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.246 ms 1 /classes/stock/StockAvailable.php:453
2712
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 7941) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.246 ms 1 /classes/stock/StockAvailable.php:453
2734
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 7943) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.246 ms 1 /classes/stock/StockAvailable.php:453
3039
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 9597 LIMIT 1
0.246 ms 11 /classes/SpecificPrice.php:435
3797
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3558
0.246 ms 1 /classes/Product.php:2902
4064
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 6189
0.246 ms 1 /classes/Product.php:2902
4136
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 8396
0.246 ms 1 /classes/Product.php:2902
2660
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 95 LIMIT 1
0.246 ms 1 /classes/Product.php:5659
259
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 309 LIMIT 1
0.245 ms 1 /classes/Product.php:5659
272
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 5139
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.245 ms 1 /classes/SpecificPrice.php:259
1176
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.245 ms 1 /classes/Product.php:5659
1325
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2645 AND `id_group` = 1 LIMIT 1
0.245 ms 0 /classes/GroupReduction.php:156
3017
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 9535 LIMIT 1
0.245 ms 10 /classes/SpecificPrice.php:435
4067
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 6191
0.245 ms 1 /classes/Product.php:2902
1005
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2637 AND id_shop=1 LIMIT 1
0.245 ms 1 /classes/Product.php:6876
3449
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 5135
0.245 ms 1 /classes/Product.php:2902
4780
SELECT SQL_NO_CACHE c.`nleft`, c.`nright`  FROM `hgt78_category` c
LEFT JOIN `hgt78_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`id_category` = 2 LIMIT 1
0.245 ms 1 /classes/Category.php:1585
1355
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3255
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.244 ms 0 /classes/SpecificPrice.php:259
1762
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3753 LIMIT 1
0.244 ms 10 /classes/SpecificPrice.php:435
2022
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4934 AND id_shop=1 LIMIT 1
0.244 ms 1 /classes/Product.php:6876
2478
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 6179 AND id_shop=1 LIMIT 1
0.244 ms 1 /classes/Product.php:6876
2535
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 6184) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.244 ms 1 /classes/stock/StockAvailable.php:453
3050
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 9598 LIMIT 1
0.244 ms 10 /classes/SpecificPrice.php:435
3062
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 9687 LIMIT 1
0.244 ms 11 /classes/SpecificPrice.php:435
3479
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2660
0.244 ms 1 /classes/Product.php:2902
862
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2789 AND `id_group` = 1 LIMIT 1
0.243 ms 0 /classes/GroupReduction.php:156
1623
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3584 AND id_shop=1 LIMIT 1
0.243 ms 1 /classes/Product.php:6876
1828
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 174 LIMIT 1
0.243 ms 1 /classes/Product.php:5659
1873
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3775 LIMIT 1
0.243 ms 10 /classes/SpecificPrice.php:435
1885
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3776
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.243 ms 0 /classes/SpecificPrice.php:259
1895
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3777 LIMIT 1
0.243 ms 10 /classes/SpecificPrice.php:435
2157
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 5267 AND `id_group` = 1 LIMIT 1
0.243 ms 0 /classes/GroupReduction.php:156
2473
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 182 LIMIT 1
0.243 ms 1 /classes/Product.php:5659
2812
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 8392) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.243 ms 1 /classes/stock/StockAvailable.php:453
4356
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 54 AND `id_shop` = 1
0.243 ms 6 /src/Adapter/EntityMapper.php:79
685
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2778 AND id_shop=1 LIMIT 1
0.242 ms 1 /classes/Product.php:6876
1164
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2640
AND image_shop.`cover` = 1 LIMIT 1
0.242 ms 1 /classes/Product.php:3570
2247
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 5093) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.242 ms 1 /classes/stock/StockAvailable.php:453
2506
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 182 LIMIT 1
0.242 ms 1 /classes/Product.php:5659
3875
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3776
0.242 ms 1 /classes/Product.php:2902
4154
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 8420
0.242 ms 1 /classes/Product.php:2902
2089
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4963 AND id_shop=1 LIMIT 1
0.241 ms 1 /classes/Product.php:6876
3182
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 184 LIMIT 1
0.241 ms 1 /classes/Product.php:5659
3536
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2771
0.241 ms 1 /classes/Product.php:2902
2640
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 6195
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.241 ms 0 /classes/SpecificPrice.php:259
270
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 309 LIMIT 1
0.240 ms 1 /classes/Product.php:5659
1189
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2656
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.240 ms 1 /classes/SpecificPrice.php:259
1475
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.240 ms 1 /classes/Product.php:5659
2904
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 184 LIMIT 1
0.240 ms 1 /classes/Product.php:5659
3140
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 9693
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.240 ms 0 /classes/SpecificPrice.php:259
3321
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 184 LIMIT 1
0.240 ms 1 /classes/Product.php:5659
3656
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2620
0.240 ms 1 /classes/Product.php:2902
1713
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3748) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.240 ms 1 /classes/stock/StockAvailable.php:453
2490
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 6180 AND `id_group` = 1 LIMIT 1
0.240 ms 0 /classes/GroupReduction.php:156
896
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2792) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.239 ms 1 /classes/stock/StockAvailable.php:453
2420
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 6173
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.239 ms 1 /classes/SpecificPrice.php:259
2606
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 6192 LIMIT 1
0.239 ms 10 /classes/SpecificPrice.php:435
2954
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 9055 AND id_shop=1 LIMIT 1
0.239 ms 1 /classes/Product.php:6876
3596
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2789
0.239 ms 1 /classes/Product.php:2902
3599
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2790
0.239 ms 1 /classes/Product.php:2902
4349
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 45) LIMIT 1
0.239 ms 1 /src/Adapter/EntityMapper.php:71
4390
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 48 AND `id_shop` = 1
0.239 ms 6 /src/Adapter/EntityMapper.php:79
1137
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2625 AND id_shop=1 LIMIT 1
0.239 ms 1 /classes/Product.php:6876
1746
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3751) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.239 ms 1 /classes/stock/StockAvailable.php:453
3138
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 334 LIMIT 1
0.239 ms 1 /classes/Product.php:5659
3431
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 5141
0.239 ms 1 /classes/Product.php:2902
3602
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2791
0.239 ms 1 /classes/Product.php:2902
96
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE `from` BETWEEN '2025-05-01 00:00:00' AND '2025-05-01 23:59:59' LIMIT 1
0.238 ms 1 /classes/SpecificPrice.php:377
127
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 7541 LIMIT 1
0.238 ms 10 /classes/SpecificPrice.php:435
1453
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.238 ms 1 /classes/Product.php:5659
1822
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3763 AND id_shop=1 LIMIT 1
0.238 ms 1 /classes/Product.php:6876
2340
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.238 ms 1 /classes/Product.php:5659
3105
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 334 LIMIT 1
0.238 ms 1 /classes/Product.php:5659
3260
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 10073 AND id_shop=1 LIMIT 1
0.238 ms 1 /classes/Product.php:6876
3947
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 5267
0.238 ms 1 /classes/Product.php:2902
4464
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 77) LIMIT 1
0.238 ms 1 /src/Adapter/EntityMapper.php:71
237
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 309 LIMIT 1
0.237 ms 1 /classes/Product.php:5659
375
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3741 AND `id_group` = 1 LIMIT 1
0.237 ms 0 /classes/GroupReduction.php:156
762
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3178 AND id_shop=1 LIMIT 1
0.237 ms 1 /classes/Product.php:6876
844
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2788
AND image_shop.`cover` = 1 LIMIT 1
0.237 ms 1 /classes/Product.php:3570
1021
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2639
AND image_shop.`cover` = 1 LIMIT 1
0.237 ms 1 /classes/Product.php:3570
1148
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2626 AND id_shop=1 LIMIT 1
0.237 ms 1 /classes/Product.php:6876
1397
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.237 ms 1 /classes/Product.php:5659
1436
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2892 AND id_shop=1 LIMIT 1
0.237 ms 1 /classes/Product.php:6876
1690
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3746 AND `id_group` = 1 LIMIT 1
0.237 ms 0 /classes/GroupReduction.php:156
1861
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.237 ms 1 /classes/Product.php:5659
2489
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 6180 AND id_shop=1 LIMIT 1
0.237 ms 1 /classes/Product.php:6876
3257
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 10073
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.237 ms 1 /classes/SpecificPrice.php:259
165
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 6727 AND `id_group` = 1 LIMIT 1
0.236 ms 0 /classes/GroupReduction.php:156
1182
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2641 AND `id_group` = 1 LIMIT 1
0.236 ms 0 /classes/GroupReduction.php:156
1187
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.236 ms 1 /classes/Product.php:5659
1702
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3747) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.236 ms 1 /classes/stock/StockAvailable.php:453
1862
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3771 LIMIT 1
0.236 ms 10 /classes/SpecificPrice.php:435
1984
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4574 LIMIT 1
0.236 ms 10 /classes/SpecificPrice.php:435
2279
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 5591 AND id_shop=1 LIMIT 1
0.236 ms 1 /classes/Product.php:6876
2821
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 8393 AND id_shop=1 LIMIT 1
0.236 ms 1 /classes/Product.php:6876
3282
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 10297 AND id_shop=1 LIMIT 1
0.236 ms 1 /classes/Product.php:6876
3587
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2781
0.236 ms 1 /classes/Product.php:2902
3989
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 5970
0.236 ms 1 /classes/Product.php:2902
4133
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 8395
0.236 ms 1 /classes/Product.php:2902
1337
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3252 AND `id_group` = 1 LIMIT 1
0.235 ms 0 /classes/GroupReduction.php:156
3072
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 334 LIMIT 1
0.235 ms 1 /classes/Product.php:5659
3266
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 95 LIMIT 1
0.235 ms 1 /classes/Product.php:5659
3761
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3132
0.235 ms 1 /classes/Product.php:2902
698
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2779) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.235 ms 1 /classes/stock/StockAvailable.php:453
1071
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3477 AND id_shop=1 LIMIT 1
0.235 ms 1 /classes/Product.php:6876
2656
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 6499) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.235 ms 1 /classes/stock/StockAvailable.php:453
2678
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 6501) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.235 ms 1 /classes/stock/StockAvailable.php:453
2684
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 7938 LIMIT 1
0.235 ms 10 /classes/SpecificPrice.php:435
3005
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 173 LIMIT 1
0.235 ms 1 /classes/Product.php:5659
2142
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 5266
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.234 ms 0 /classes/SpecificPrice.php:259
2843
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 8395 AND id_shop=1 LIMIT 1
0.234 ms 1 /classes/Product.php:6876
4148
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 8418
0.234 ms 1 /classes/Product.php:2902
2208
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 5296
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.234 ms 1 /classes/SpecificPrice.php:259
2865
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 8397 AND id_shop=1 LIMIT 1
0.234 ms 1 /classes/Product.php:6876
243
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 5142 AND `id_group` = 1 LIMIT 1
0.233 ms 0 /classes/GroupReduction.php:156
824
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2781 LIMIT 1
0.233 ms 10 /classes/SpecificPrice.php:435
2308
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 5970 LIMIT 1
0.233 ms 10 /classes/SpecificPrice.php:435
2634
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 6194) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.233 ms 1 /classes/stock/StockAvailable.php:453
94
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 7543 LIMIT 1
0.233 ms 9 /classes/SpecificPrice.php:435
275
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 5139 AND id_shop=1 LIMIT 1
0.233 ms 1 /classes/Product.php:6876
2480
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 6179) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.233 ms 1 /classes/stock/StockAvailable.php:453
2555
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 6186 AND id_shop=1 LIMIT 1
0.233 ms 1 /classes/Product.php:6876
2829
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 8394
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.233 ms 0 /classes/SpecificPrice.php:259
2962
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 9306
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.233 ms 0 /classes/SpecificPrice.php:259
3027
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.233 ms 1 /classes/Product.php:5659
3154
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 9694 AND id_shop=1 LIMIT 1
0.233 ms 1 /classes/Product.php:6876
3271
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 10111 AND id_shop=1 LIMIT 1
0.233 ms 1 /classes/Product.php:6876
3443
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 5137
0.233 ms 1 /classes/Product.php:2902
3716
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2655
0.233 ms 1 /classes/Product.php:2902
3776
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2650
0.233 ms 1 /classes/Product.php:2902
4130
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 8394
0.233 ms 1 /classes/Product.php:2902
2518
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 6183 LIMIT 1
0.232 ms 10 /classes/SpecificPrice.php:435
598
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2690) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.232 ms 1 /classes/stock/StockAvailable.php:453
1686
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3746
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.232 ms 0 /classes/SpecificPrice.php:259
1757
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3752) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.232 ms 1 /classes/stock/StockAvailable.php:453
2629
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 6194
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.232 ms 0 /classes/SpecificPrice.php:259
2862
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 8397
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.232 ms 0 /classes/SpecificPrice.php:259
3345
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 10305
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.232 ms 1 /classes/SpecificPrice.php:259
3755
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3099
0.232 ms 1 /classes/Product.php:2902
3758
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3107
0.232 ms 1 /classes/Product.php:2902
4788
SELECT SQL_NO_CACHE content FROM hgt78_lgcookieslaw_lang WHERE id_lang = 1 LIMIT 1
0.232 ms 1 /modules/lgcookieslaw/lgcookieslaw.php:161
419
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2694 AND `id_group` = 1 LIMIT 1
0.231 ms 0 /classes/GroupReduction.php:156
1381
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3264 AND `id_group` = 1 LIMIT 1
0.231 ms 0 /classes/GroupReduction.php:156
2219
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 5335 LIMIT 1
0.231 ms 10 /classes/SpecificPrice.php:435
2374
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 178 LIMIT 1
0.231 ms 1 /classes/Product.php:5659
2517
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 182 LIMIT 1
0.231 ms 1 /classes/Product.php:5659
2749
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 320 LIMIT 1
0.231 ms 1 /classes/Product.php:5659
2849
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 185 LIMIT 1
0.231 ms 1 /classes/Product.php:5659
2983
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 173 LIMIT 1
0.231 ms 1 /classes/Product.php:5659
3116
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 334 LIMIT 1
0.231 ms 1 /classes/Product.php:5659
3323
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 10303
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.231 ms 1 /classes/SpecificPrice.php:259
3326
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 10303 AND id_shop=1 LIMIT 1
0.231 ms 1 /classes/Product.php:6876
3590
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3179
0.231 ms 1 /classes/Product.php:2902
4034
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 6179
0.231 ms 1 /classes/Product.php:2902
4264
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 10304
0.231 ms 1 /classes/Product.php:2902
4392
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 53 AND `id_shop` = 1
0.231 ms 6 /src/Adapter/EntityMapper.php:79
4465
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 77 AND `id_shop` = 1
0.231 ms 6 /src/Adapter/EntityMapper.php:79
4785
SELECT SQL_NO_CACHE `id_module` FROM `hgt78_module` WHERE `name` = "iqitcontactpage" LIMIT 1
0.231 ms 1 /classes/module/Module.php:2664
2667
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 6500) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.231 ms 1 /classes/stock/StockAvailable.php:453
265
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 5140 AND `id_group` = 1 LIMIT 1
0.230 ms 0 /classes/GroupReduction.php:156
676
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2777) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.230 ms 1 /classes/stock/StockAvailable.php:453
945
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2632 LIMIT 1
0.230 ms 10 /classes/SpecificPrice.php:435
994
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2636 AND id_shop=1 LIMIT 1
0.230 ms 1 /classes/Product.php:6876
1425
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2818 AND id_shop=1 LIMIT 1
0.230 ms 1 /classes/Product.php:6876
1728
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.230 ms 1 /classes/Product.php:5659
2119
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4966
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.230 ms 0 /classes/SpecificPrice.php:259
2783
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 95 LIMIT 1
0.230 ms 1 /classes/Product.php:5659
3221
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 10070
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.230 ms 1 /classes/SpecificPrice.php:259
4058
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 6187
0.230 ms 1 /classes/Product.php:2902
4796
SELECT SQL_NO_CACHE psgdpr.active FROM `hgt78_psgdpr_consent` psgdpr
WHERE psgdpr.id_module = 22 LIMIT 1
0.230 ms 12 /modules/psgdpr/classes/GDPRConsent.php:132
3176
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 9697 AND id_shop=1 LIMIT 1
0.230 ms 1 /classes/Product.php:6876
3209
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 10069
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.229 ms 1 /classes/SpecificPrice.php:259
3301
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 10299
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.229 ms 1 /classes/SpecificPrice.php:259
3581
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2793
0.229 ms 1 /classes/Product.php:2902
808
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2793) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.229 ms 1 /classes/stock/StockAvailable.php:453
868
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2790 LIMIT 1
0.229 ms 10 /classes/SpecificPrice.php:435
1922
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3805 AND id_shop=1 LIMIT 1
0.229 ms 1 /classes/Product.php:6876
3905
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4575
0.229 ms 1 /classes/Product.php:2902
4280
SELECT SQL_NO_CACHE id_shop
FROM `hgt78_group_shop`
WHERE `id_group` = 1
AND id_shop = 1 LIMIT 1
0.229 ms 1 /classes/ObjectModel.php:1729
581
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2661 LIMIT 1
0.228 ms 10 /classes/SpecificPrice.php:435
1243
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2658 LIMIT 1
0.228 ms 10 /classes/SpecificPrice.php:435
2882
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 184 LIMIT 1
0.228 ms 1 /classes/Product.php:5659
3992
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 5971
0.228 ms 1 /classes/Product.php:2902
1667
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3689 AND id_shop=1 LIMIT 1
0.228 ms 1 /classes/Product.php:6876
1697
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3747
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.228 ms 0 /classes/SpecificPrice.php:259
2180
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 5283) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.228 ms 1 /classes/stock/StockAvailable.php:453
2588
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 6189 AND id_shop=1 LIMIT 1
0.228 ms 1 /classes/Product.php:6876
2805
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 174 LIMIT 1
0.228 ms 1 /classes/Product.php:5659
2851
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 8396
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.228 ms 0 /classes/SpecificPrice.php:259
4776
SELECT SQL_NO_CACHE `id_module` FROM `hgt78_module` WHERE `name` = "ps_categorytree" LIMIT 1
0.228 ms 1 /classes/module/Module.php:2664
1238
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2649) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.227 ms 1 /classes/stock/StockAvailable.php:453
3584
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2780
0.227 ms 1 /classes/Product.php:2902
319
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 5135 AND id_shop=1 LIMIT 1
0.227 ms 1 /classes/Product.php:6876
763
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3178 AND `id_group` = 1 LIMIT 1
0.227 ms 0 /classes/GroupReduction.php:156
1570
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3484) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.227 ms 1 /classes/stock/StockAvailable.php:453
1912
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3804 AND `id_group` = 1 LIMIT 1
0.227 ms 0 /classes/GroupReduction.php:156
3197
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 10068
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.227 ms 0 /classes/SpecificPrice.php:259
3632
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2636
0.227 ms 1 /classes/Product.php:2902
3674
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2626
0.227 ms 1 /classes/Product.php:2902
3713
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2643
0.227 ms 1 /classes/Product.php:2902
4037
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 6180
0.227 ms 1 /classes/Product.php:2902
4360
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 70 AND `id_shop` = 1
0.227 ms 6 /src/Adapter/EntityMapper.php:79
4792
SELECT SQL_NO_CACHE button2 FROM hgt78_lgcookieslaw_lang WHERE id_lang = 1 LIMIT 1
0.227 ms 1 /modules/lgcookieslaw/lgcookieslaw.php:161
504
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2770 LIMIT 1
0.226 ms 10 /classes/SpecificPrice.php:435
1711
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3748 AND id_shop=1 LIMIT 1
0.226 ms 1 /classes/Product.php:6876
1890
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3776) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.226 ms 1 /classes/stock/StockAvailable.php:453
2097
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4964
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.226 ms 0 /classes/SpecificPrice.php:259
2100
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4964 AND id_shop=1 LIMIT 1
0.226 ms 1 /classes/Product.php:6876
2479
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 6179 AND `id_group` = 1 LIMIT 1
0.226 ms 0 /classes/GroupReduction.php:156
2579
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 6188) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.226 ms 1 /classes/stock/StockAvailable.php:453
2621
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 6193 AND id_shop=1 LIMIT 1
0.226 ms 1 /classes/Product.php:6876
3279
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 10297
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.226 ms 1 /classes/SpecificPrice.php:259
3382
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 11001 AND id_shop=1 LIMIT 1
0.226 ms 1 /classes/Product.php:6876
3800
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3559
0.226 ms 1 /classes/Product.php:2902
3926
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4962
0.226 ms 1 /classes/Product.php:2902
2739
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 7944 LIMIT 1
0.226 ms 10 /classes/SpecificPrice.php:435
576
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2765) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.225 ms 1 /classes/stock/StockAvailable.php:453
922
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.225 ms 1 /classes/Product.php:5659
2430
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 6174 LIMIT 1
0.225 ms 10 /classes/SpecificPrice.php:435
3230
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 184 LIMIT 1
0.225 ms 1 /classes/Product.php:5659
3692
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2657
0.225 ms 1 /classes/Product.php:2902
4281
SELECT SQL_NO_CACHE ctg.`id_group`
FROM hgt78_category_group ctg
WHERE ctg.`id_category` = 2 AND ctg.`id_group` = 1 LIMIT 1
0.225 ms 1 /classes/Category.php:1754
4467
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 217 AND `id_shop` = 1
0.225 ms 6 /src/Adapter/EntityMapper.php:79
1701
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3747 AND `id_group` = 1 LIMIT 1
0.225 ms 0 /classes/GroupReduction.php:156
2507
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 6182 LIMIT 1
0.225 ms 10 /classes/SpecificPrice.php:435
4145
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 8417
0.225 ms 1 /classes/Product.php:2902
1044
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.224 ms 1 /classes/Product.php:5659
1812
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3757) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.224 ms 1 /classes/stock/StockAvailable.php:453
469
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `hgt78_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 182 LIMIT 1
0.224 ms 1 /classes/Category.php:1378
503
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 182 LIMIT 1
0.224 ms 1 /classes/Product.php:5659
675
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2777 AND `id_group` = 1 LIMIT 1
0.224 ms 0 /classes/GroupReduction.php:156
1105
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2622 AND `id_group` = 1 LIMIT 1
0.224 ms 0 /classes/GroupReduction.php:156
1580
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3556 AND `id_group` = 1 LIMIT 1
0.224 ms 0 /classes/GroupReduction.php:156
2413
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 6172 AND `id_group` = 1 LIMIT 1
0.224 ms 0 /classes/GroupReduction.php:156
2539
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 182 LIMIT 1
0.224 ms 1 /classes/Product.php:5659
1160
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2627 AND `id_group` = 1 LIMIT 1
0.223 ms 0 /classes/GroupReduction.php:156
2706
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 7941 LIMIT 1
0.223 ms 10 /classes/SpecificPrice.php:435
3971
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 5093
0.223 ms 1 /classes/Product.php:2902
4142
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 8401
0.223 ms 1 /classes/Product.php:2902
508
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2770 AND id_shop=1 LIMIT 1
0.223 ms 1 /classes/Product.php:6876
1488
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2490
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.223 ms 0 /classes/SpecificPrice.php:259
2236
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 5350) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.223 ms 1 /classes/stock/StockAvailable.php:453
2951
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 9055
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.223 ms 0 /classes/SpecificPrice.php:259
3049
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.223 ms 1 /classes/Product.php:5659
3293
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 10298 AND id_shop=1 LIMIT 1
0.223 ms 1 /classes/Product.php:6876
3371
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 12551 AND id_shop=1 LIMIT 1
0.223 ms 1 /classes/Product.php:6876
464
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2623 AND `id_group` = 1 LIMIT 1
0.222 ms 0 /classes/GroupReduction.php:156
1481
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3327 AND `id_group` = 1 LIMIT 1
0.222 ms 0 /classes/GroupReduction.php:156
3233
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 10071
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.222 ms 1 /classes/SpecificPrice.php:259
3310
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 184 LIMIT 1
0.222 ms 1 /classes/Product.php:5659
4366
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 199 AND `id_shop` = 1
0.222 ms 6 /src/Adapter/EntityMapper.php:79
4789
SELECT SQL_NO_CACHE required FROM hgt78_lgcookieslaw_lang WHERE id_lang = 1 LIMIT 1
0.222 ms 1 /modules/lgcookieslaw/lgcookieslaw.php:161
1255
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2647
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.221 ms 0 /classes/SpecificPrice.php:259
1559
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3455) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.221 ms 1 /classes/stock/StockAvailable.php:453
1940
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3807 LIMIT 1
0.221 ms 10 /classes/SpecificPrice.php:435
2617
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 6193 LIMIT 1
0.221 ms 10 /classes/SpecificPrice.php:435
2645
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 6195) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.221 ms 1 /classes/stock/StockAvailable.php:453
3107
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 9690
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.221 ms 0 /classes/SpecificPrice.php:259
3422
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 5144
0.221 ms 1 /classes/Product.php:2902
3809
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3586
0.221 ms 1 /classes/Product.php:2902
4249
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 10297
0.221 ms 1 /classes/Product.php:2902
4326
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 50 AND `id_shop` = 1
0.221 ms 6 /src/Adapter/EntityMapper.php:79
4371
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 35) LIMIT 1
0.221 ms 1 /src/Adapter/EntityMapper.php:71
1640
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.220 ms 1 /classes/Product.php:5659
2033
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4935 AND id_shop=1 LIMIT 1
0.220 ms 1 /classes/Product.php:6876
2224
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 5335 AND `id_group` = 1 LIMIT 1
0.220 ms 0 /classes/GroupReduction.php:156
2960
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 174 LIMIT 1
0.220 ms 1 /classes/Product.php:5659
3007
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 9325
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.220 ms 0 /classes/SpecificPrice.php:259
3149
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 334 LIMIT 1
0.220 ms 1 /classes/Product.php:5659
3171
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 334 LIMIT 1
0.220 ms 1 /classes/Product.php:5659
2917
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 8420
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.220 ms 0 /classes/SpecificPrice.php:259
686
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2778 AND `id_group` = 1 LIMIT 1
0.219 ms 0 /classes/GroupReduction.php:156
2086
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4963
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.219 ms 0 /classes/SpecificPrice.php:259
2286
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 5592 LIMIT 1
0.219 ms 10 /classes/SpecificPrice.php:435
2578
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 6188 AND `id_group` = 1 LIMIT 1
0.219 ms 0 /classes/GroupReduction.php:156
2895
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 8418
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.219 ms 0 /classes/SpecificPrice.php:259
2999
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 9324 AND id_shop=1 LIMIT 1
0.219 ms 1 /classes/Product.php:6876
3908
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4932
0.219 ms 1 /classes/Product.php:2902
4297
SELECT SQL_NO_CACHE *
FROM `hgt78_currency` a
LEFT JOIN `hgt78_currency_shop` `c` ON a.`id_currency` = c.`id_currency` AND c.`id_shop` = 1
WHERE (a.`id_currency` = 2) LIMIT 1
0.219 ms 1 /src/Adapter/EntityMapper.php:71
231
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 5143 AND id_shop=1 LIMIT 1
0.219 ms 1 /classes/Product.php:6876
3018
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 9535
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.219 ms 0 /classes/SpecificPrice.php:259
3824
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3747
0.219 ms 1 /classes/Product.php:2902
342
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 5133 AND `id_group` = 1 LIMIT 1
0.218 ms 0 /classes/GroupReduction.php:156
2253
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 5589 LIMIT 1
0.218 ms 10 /classes/SpecificPrice.php:435
2649
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 95 LIMIT 1
0.218 ms 1 /classes/Product.php:5659
3557
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2797
0.218 ms 1 /classes/Product.php:2902
1242
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.218 ms 1 /classes/Product.php:5659
2590
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 6189) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.218 ms 1 /classes/stock/StockAvailable.php:453
3212
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 10069 AND id_shop=1 LIMIT 1
0.218 ms 1 /classes/Product.php:6876
3389
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 7543
0.218 ms 1 /classes/Product.php:2902
321
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 5135) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.217 ms 1 /classes/stock/StockAvailable.php:453
1458
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3107 AND id_shop=1 LIMIT 1
0.217 ms 1 /classes/Product.php:6876
3016
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 174 LIMIT 1
0.217 ms 1 /classes/Product.php:5659
3261
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 10073 AND `id_group` = 1 LIMIT 1
0.217 ms 0 /classes/GroupReduction.php:156
3354
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `hgt78_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 172 LIMIT 1
0.217 ms 1 /classes/Category.php:1378
4219
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 9695
0.217 ms 1 /classes/Product.php:2902
4365
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 199) LIMIT 1
0.217 ms 1 /src/Adapter/EntityMapper.php:71
210
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 5145 AND `id_group` = 1 LIMIT 1
0.216 ms 0 /classes/GroupReduction.php:156
1358
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3255 AND id_shop=1 LIMIT 1
0.216 ms 1 /classes/Product.php:6876
1795
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3756 LIMIT 1
0.216 ms 10 /classes/SpecificPrice.php:435
2067
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4944 AND id_shop=1 LIMIT 1
0.216 ms 1 /classes/Product.php:6876
2544
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 6185 AND id_shop=1 LIMIT 1
0.216 ms 1 /classes/Product.php:6876
2550
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 182 LIMIT 1
0.216 ms 1 /classes/Product.php:5659
3206
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 184 LIMIT 1
0.216 ms 1 /classes/Product.php:5659
3277
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.216 ms 1 /classes/Product.php:5659
3305
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 10299 AND `id_group` = 1 LIMIT 1
0.216 ms 0 /classes/GroupReduction.php:156
3428
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 5142
0.216 ms 1 /classes/Product.php:2902
3791
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3556
0.216 ms 1 /classes/Product.php:2902
823
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 182 LIMIT 1
0.215 ms 1 /classes/Product.php:5659
1122
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2624 LIMIT 1
0.215 ms 10 /classes/SpecificPrice.php:435
2196
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 5293 LIMIT 1
0.215 ms 10 /classes/SpecificPrice.php:435
2665
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 6500 AND id_shop=1 LIMIT 1
0.215 ms 1 /classes/Product.php:6876
2738
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 320 LIMIT 1
0.215 ms 1 /classes/Product.php:5659
3242
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 184 LIMIT 1
0.215 ms 1 /classes/Product.php:5659
4372
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 35 AND `id_shop` = 1
0.215 ms 6 /src/Adapter/EntityMapper.php:79
1899
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3777 AND id_shop=1 LIMIT 1
0.215 ms 1 /classes/Product.php:6876
4368
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 200) LIMIT 1
0.215 ms 1 /src/Adapter/EntityMapper.php:71
852
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2788) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.214 ms 1 /classes/stock/StockAvailable.php:453
1491
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2490 AND id_shop=1 LIMIT 1
0.214 ms 1 /classes/Product.php:6876
2866
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 8397 AND `id_group` = 1 LIMIT 1
0.214 ms 0 /classes/GroupReduction.php:156
3074
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 9686
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.214 ms 0 /classes/SpecificPrice.php:259
812
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 182 LIMIT 1
0.214 ms 1 /classes/Product.php:5659
835
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3179 LIMIT 1
0.214 ms 10 /classes/SpecificPrice.php:435
2513
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 6182) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.214 ms 1 /classes/stock/StockAvailable.php:453
2765
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 7946 AND id_shop=1 LIMIT 1
0.214 ms 1 /classes/Product.php:6876
2838
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 174 LIMIT 1
0.214 ms 1 /classes/Product.php:5659
3299
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.214 ms 1 /classes/Product.php:5659
4025
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 6176
0.214 ms 1 /classes/Product.php:2902
4276
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 11001
0.214 ms 1 /classes/Product.php:2902
4352
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 46) LIMIT 1
0.214 ms 1 /src/Adapter/EntityMapper.php:71
4359
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 70) LIMIT 1
0.214 ms 1 /src/Adapter/EntityMapper.php:71
4388
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 37 AND `id_shop` = 1
0.214 ms 6 /src/Adapter/EntityMapper.php:79
2075
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4962
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.213 ms 0 /classes/SpecificPrice.php:259
2563
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 6187
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.213 ms 0 /classes/SpecificPrice.php:259
3022
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 9535 AND `id_group` = 1 LIMIT 1
0.213 ms 0 /classes/GroupReduction.php:156
3213
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 10069 AND `id_group` = 1 LIMIT 1
0.213 ms 0 /classes/GroupReduction.php:156
3254
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 184 LIMIT 1
0.213 ms 1 /classes/Product.php:5659
4163
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 9055
0.213 ms 1 /classes/Product.php:2902
769
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3075 LIMIT 1
0.213 ms 10 /classes/SpecificPrice.php:435
2101
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4964 AND `id_group` = 1 LIMIT 1
0.213 ms 0 /classes/GroupReduction.php:156
2297
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 5774 LIMIT 1
0.213 ms 10 /classes/SpecificPrice.php:435
2623
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 6193) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.213 ms 1 /classes/stock/StockAvailable.php:453
3539
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2738
0.213 ms 1 /classes/Product.php:2902
697
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2779 AND `id_group` = 1 LIMIT 1
0.212 ms 0 /classes/GroupReduction.php:156
2039
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `hgt78_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 190 LIMIT 1
0.212 ms 1 /classes/Category.php:1378
2206
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 95 LIMIT 1
0.212 ms 1 /classes/Product.php:5659
2345
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 5973 AND id_shop=1 LIMIT 1
0.212 ms 1 /classes/Product.php:6876
2562
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 6187 LIMIT 1
0.212 ms 10 /classes/SpecificPrice.php:435
2638
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 182 LIMIT 1
0.212 ms 1 /classes/Product.php:5659
2816
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 174 LIMIT 1
0.212 ms 1 /classes/Product.php:5659
3021
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 9535 AND id_shop=1 LIMIT 1
0.212 ms 1 /classes/Product.php:6876
3236
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 10071 AND id_shop=1 LIMIT 1
0.212 ms 1 /classes/Product.php:6876
3437
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 5139
0.212 ms 1 /classes/Product.php:2902
3653
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3477
0.212 ms 1 /classes/Product.php:2902
4115
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 7769
0.212 ms 1 /classes/Product.php:2902
553
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2776 AND `id_group` = 1 LIMIT 1
0.211 ms 0 /classes/GroupReduction.php:156
707
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2795 AND id_shop=1 LIMIT 1
0.211 ms 1 /classes/Product.php:6876
726
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2798
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.211 ms 0 /classes/SpecificPrice.php:259
740
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2799 AND id_shop=1 LIMIT 1
0.211 ms 1 /classes/Product.php:6876
2654
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 6499 AND id_shop=1 LIMIT 1
0.211 ms 1 /classes/Product.php:6876
2701
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 7940) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.211 ms 1 /classes/stock/StockAvailable.php:453
2860
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 185 LIMIT 1
0.211 ms 1 /classes/Product.php:5659
2888
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 8417 AND `id_group` = 1 LIMIT 1
0.211 ms 0 /classes/GroupReduction.php:156
2988
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 9323 AND id_shop=1 LIMIT 1
0.211 ms 1 /classes/Product.php:6876
4207
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 9691
0.211 ms 1 /classes/Product.php:2902
121
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 7542 AND `id_group` = 1 LIMIT 1
0.210 ms 0 /classes/GroupReduction.php:156
2358
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 6047 AND `id_group` = 1 LIMIT 1
0.210 ms 0 /classes/GroupReduction.php:156
2583
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 182 LIMIT 1
0.210 ms 1 /classes/Product.php:5659
2876
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 8401 AND id_shop=1 LIMIT 1
0.210 ms 1 /classes/Product.php:6876
3040
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 9597
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.210 ms 0 /classes/SpecificPrice.php:259
3044
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 9597 AND `id_group` = 1 LIMIT 1
0.210 ms 0 /classes/GroupReduction.php:156
3419
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 5145
0.210 ms 1 /classes/Product.php:2902
3806
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3585
0.210 ms 1 /classes/Product.php:2902
1455
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3107
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.210 ms 0 /classes/SpecificPrice.php:259
2871
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 185 LIMIT 1
0.210 ms 1 /classes/Product.php:5659
3054
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 9598 AND id_shop=1 LIMIT 1
0.210 ms 1 /classes/Product.php:6876
3268
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 10111
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.210 ms 1 /classes/SpecificPrice.php:259
900
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.209 ms 1 /classes/Product.php:5659
967
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2634 LIMIT 1
0.209 ms 10 /classes/SpecificPrice.php:435
1183
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2641) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.209 ms 1 /classes/stock/StockAvailable.php:453
2185
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 5284 LIMIT 1
0.209 ms 9 /classes/SpecificPrice.php:435
3554
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2795
0.209 ms 1 /classes/Product.php:2902
3884
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3805
0.209 ms 1 /classes/Product.php:2902
4304
SELECT SQL_NO_CACHE `id_module` FROM `hgt78_module` WHERE `name` = "iqitmegamenu" LIMIT 1
0.209 ms 1 /classes/module/Module.php:2664
304
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 5136 LIMIT 1
0.209 ms 10 /classes/SpecificPrice.php:435
911
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.209 ms 1 /classes/Product.php:5659
2223
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 5335 AND id_shop=1 LIMIT 1
0.209 ms 1 /classes/Product.php:6876
2906
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 8419
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.209 ms 0 /classes/SpecificPrice.php:259
3623
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2633
0.209 ms 1 /classes/Product.php:2902
735
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.208 ms 1 /classes/Product.php:5659
1894
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.208 ms 1 /classes/Product.php:5659
3094
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 334 LIMIT 1
0.208 ms 1 /classes/Product.php:5659
3842
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3753
0.208 ms 1 /classes/Product.php:2902
3878
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3777
0.208 ms 1 /classes/Product.php:2902
4097
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 7941
0.208 ms 1 /classes/Product.php:2902
961
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2633 AND `id_group` = 1 LIMIT 1
0.208 ms 0 /classes/GroupReduction.php:156
1309
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2644 LIMIT 1
0.208 ms 10 /classes/SpecificPrice.php:435
1336
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3252 AND id_shop=1 LIMIT 1
0.208 ms 1 /classes/Product.php:6876
2533
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 6184 AND id_shop=1 LIMIT 1
0.208 ms 1 /classes/Product.php:6876
3404
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 6727
0.208 ms 1 /classes/Product.php:2902
4273
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 12551
0.208 ms 1 /classes/Product.php:2902
199
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 5146 AND `id_group` = 1 LIMIT 1
0.207 ms 0 /classes/GroupReduction.php:156
436
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 185 LIMIT 1
0.207 ms 1 /classes/Product.php:5659
3290
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 10298
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.207 ms 1 /classes/SpecificPrice.php:259
337
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 5133 LIMIT 1
0.207 ms 10 /classes/SpecificPrice.php:435
396
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3587 AND id_shop=1 LIMIT 1
0.207 ms 1 /classes/Product.php:6876
996
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2636) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.207 ms 1 /classes/stock/StockAvailable.php:453
1543
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3454
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.207 ms 0 /classes/SpecificPrice.php:259
2799
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 7773 AND id_shop=1 LIMIT 1
0.207 ms 1 /classes/Product.php:6876
3060
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `hgt78_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 334 LIMIT 1
0.207 ms 1 /classes/Category.php:1378
3194
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 184 LIMIT 1
0.207 ms 1 /classes/Product.php:5659
3316
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 10302 AND `id_group` = 1 LIMIT 1
0.207 ms 0 /classes/GroupReduction.php:156
3530
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2692
0.207 ms 1 /classes/Product.php:2902
3569
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3178
0.207 ms 1 /classes/Product.php:2902
3701
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2658
0.207 ms 1 /classes/Product.php:2902
3872
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3775
0.207 ms 1 /classes/Product.php:2902
4303
SELECT SQL_NO_CACHE `name`
FROM `hgt78_hook`
WHERE `id_hook` = 910 LIMIT 1
0.207 ms 1 /classes/Hook.php:247
1579
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3556 AND id_shop=1 LIMIT 1
0.206 ms 1 /classes/Product.php:6876
353
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4902 AND `id_group` = 1 LIMIT 1
0.206 ms 0 /classes/GroupReduction.php:156
1968
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3936) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.206 ms 1 /classes/stock/StockAvailable.php:453
2173
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 95 LIMIT 1
0.206 ms 1 /classes/Product.php:5659
2540
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 6185 LIMIT 1
0.206 ms 10 /classes/SpecificPrice.php:435
2761
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 7946 LIMIT 1
0.206 ms 10 /classes/SpecificPrice.php:435
2949
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 176 LIMIT 1
0.206 ms 1 /classes/Product.php:5659
3151
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 9694
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.206 ms 0 /classes/SpecificPrice.php:259
4777
SELECT SQL_NO_CACHE `id_module` FROM `hgt78_module_shop` WHERE `id_module` = 13 AND `id_shop` = 1 LIMIT 1
0.206 ms 1 /classes/module/Module.php:2137
287
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 5138 AND `id_group` = 1 LIMIT 1
0.205 ms 0 /classes/GroupReduction.php:156
1144
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2626 LIMIT 1
0.205 ms 10 /classes/SpecificPrice.php:435
1276
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2642 LIMIT 1
0.205 ms 10 /classes/SpecificPrice.php:435
1437
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2892 AND `id_group` = 1 LIMIT 1
0.205 ms 0 /classes/GroupReduction.php:156
2285
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.205 ms 1 /classes/Product.php:5659
2595
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 6191 LIMIT 1
0.205 ms 10 /classes/SpecificPrice.php:435
2694
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 320 LIMIT 1
0.205 ms 1 /classes/Product.php:5659
2728
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 7943 LIMIT 1
0.205 ms 10 /classes/SpecificPrice.php:435
2994
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 173 LIMIT 1
0.205 ms 1 /classes/Product.php:5659
3812
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3639
0.205 ms 1 /classes/Product.php:2902
3902
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4574
0.205 ms 1 /classes/Product.php:2902
3338
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 10304 AND `id_group` = 1 LIMIT 1
0.205 ms 0 /classes/GroupReduction.php:156
132
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 7541 AND `id_group` = 1 LIMIT 1
0.204 ms 0 /classes/GroupReduction.php:156
759
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3178
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.204 ms 0 /classes/SpecificPrice.php:259
990
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2636 LIMIT 1
0.204 ms 10 /classes/SpecificPrice.php:435
1166
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2640 LIMIT 1
0.204 ms 10 /classes/SpecificPrice.php:435
1896
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3777
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.204 ms 0 /classes/SpecificPrice.php:259
2056
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4943 AND id_shop=1 LIMIT 1
0.204 ms 1 /classes/Product.php:6876
2090
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4963 AND `id_group` = 1 LIMIT 1
0.204 ms 0 /classes/GroupReduction.php:156
2766
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 7946 AND `id_group` = 1 LIMIT 1
0.204 ms 0 /classes/GroupReduction.php:156
3578
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2794
0.204 ms 1 /classes/Product.php:2902
3614
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2635
0.204 ms 1 /classes/Product.php:2902
3815
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3689
0.204 ms 1 /classes/Product.php:2902
1794
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.204 ms 1 /classes/Product.php:5659
476
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2767 AND `id_group` = 1 LIMIT 1
0.203 ms 0 /classes/GroupReduction.php:156
1499
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2621
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.203 ms 1 /classes/SpecificPrice.php:259
2073
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.203 ms 1 /classes/Product.php:5659
2873
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 8401
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.203 ms 0 /classes/SpecificPrice.php:259
2893
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 184 LIMIT 1
0.203 ms 1 /classes/Product.php:5659
3038
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.203 ms 1 /classes/Product.php:5659
3099
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 9689 AND id_shop=1 LIMIT 1
0.203 ms 1 /classes/Product.php:6876
3218
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 184 LIMIT 1
0.203 ms 1 /classes/Product.php:5659
3304
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 10299 AND id_shop=1 LIMIT 1
0.203 ms 1 /classes/Product.php:6876
3315
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 10302 AND id_shop=1 LIMIT 1
0.203 ms 1 /classes/Product.php:6876
3368
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 12551
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.203 ms 1 /classes/SpecificPrice.php:259
3611
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2659
0.203 ms 1 /classes/Product.php:2902
570
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2765 LIMIT 1
0.203 ms 10 /classes/SpecificPrice.php:435
907
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3177) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.203 ms 1 /classes/stock/StockAvailable.php:453
2296
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 185 LIMIT 1
0.203 ms 1 /classes/Product.php:5659
2561
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 182 LIMIT 1
0.203 ms 1 /classes/Product.php:5659
4350
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 45 AND `id_shop` = 1
0.203 ms 6 /src/Adapter/EntityMapper.php:79
1247
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2658 AND id_shop=1 LIMIT 1
0.202 ms 1 /classes/Product.php:6876
1744
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3751 AND id_shop=1 LIMIT 1
0.202 ms 1 /classes/Product.php:6876
1917
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 184 LIMIT 1
0.202 ms 1 /classes/Product.php:5659
1552
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 185 LIMIT 1
0.202 ms 1 /classes/Product.php:5659
2162
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 95 LIMIT 1
0.202 ms 1 /classes/Product.php:5659
2616
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 182 LIMIT 1
0.202 ms 1 /classes/Product.php:5659
2676
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 6501 AND id_shop=1 LIMIT 1
0.202 ms 1 /classes/Product.php:6876
2785
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 7779
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.202 ms 0 /classes/SpecificPrice.php:259
2985
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 9323
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.202 ms 0 /classes/SpecificPrice.php:259
3083
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 334 LIMIT 1
0.202 ms 1 /classes/Product.php:5659
2920
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 8420 AND id_shop=1 LIMIT 1
0.201 ms 1 /classes/Product.php:6876
913
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2659
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.201 ms 0 /classes/SpecificPrice.php:259
1466
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3132
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.201 ms 0 /classes/SpecificPrice.php:259
1634
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3585 AND id_shop=1 LIMIT 1
0.201 ms 1 /classes/Product.php:6876
1819
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3763
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.201 ms 0 /classes/SpecificPrice.php:259
2028
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 185 LIMIT 1
0.201 ms 1 /classes/Product.php:5659
2045
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4942 AND id_shop=1 LIMIT 1
0.201 ms 1 /classes/Product.php:6876
2318
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.201 ms 1 /classes/Product.php:5659
2435
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 6174 AND `id_group` = 1 LIMIT 1
0.201 ms 0 /classes/GroupReduction.php:156
2628
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 6194 LIMIT 1
0.201 ms 10 /classes/SpecificPrice.php:435
2732
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 7943 AND id_shop=1 LIMIT 1
0.201 ms 1 /classes/Product.php:6876
2833
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 8394 AND `id_group` = 1 LIMIT 1
0.201 ms 0 /classes/GroupReduction.php:156
3121
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 9691 AND id_shop=1 LIMIT 1
0.201 ms 1 /classes/Product.php:6876
3155
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 9694 AND `id_group` = 1 LIMIT 1
0.201 ms 0 /classes/GroupReduction.php:156
3294
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 10298 AND `id_group` = 1 LIMIT 1
0.201 ms 0 /classes/GroupReduction.php:156
3366
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.201 ms 1 /classes/Product.php:5659
3644
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2630
0.201 ms 1 /classes/Product.php:2902
746
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.200 ms 1 /classes/Product.php:5659
894
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2792 AND id_shop=1 LIMIT 1
0.200 ms 1 /classes/Product.php:6876
1448
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3099 AND `id_group` = 1 LIMIT 1
0.200 ms 0 /classes/GroupReduction.php:156
1519
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 185 LIMIT 1
0.200 ms 1 /classes/Product.php:5659
1816
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `hgt78_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 174 LIMIT 1
0.200 ms 1 /classes/Category.php:1378
1983
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.200 ms 1 /classes/Product.php:5659
2240
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 177 LIMIT 1
0.200 ms 1 /classes/Product.php:5659
2966
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 9306 AND `id_group` = 1 LIMIT 1
0.200 ms 0 /classes/GroupReduction.php:156
3132
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 9692 AND id_shop=1 LIMIT 1
0.200 ms 1 /classes/Product.php:6876
3160
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 334 LIMIT 1
0.200 ms 1 /classes/Product.php:5659
3349
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 10305 AND `id_group` = 1 LIMIT 1
0.200 ms 0 /classes/GroupReduction.php:156
1729
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3750 LIMIT 1
0.199 ms 10 /classes/SpecificPrice.php:435
1741
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3751
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.199 ms 0 /classes/SpecificPrice.php:259
2301
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 5774 AND id_shop=1 LIMIT 1
0.199 ms 1 /classes/Product.php:6876
2511
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 6182 AND id_shop=1 LIMIT 1
0.199 ms 1 /classes/Product.php:6876
2671
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 113 LIMIT 1
0.199 ms 1 /classes/Product.php:5659
2723
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 7942) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.199 ms 1 /classes/stock/StockAvailable.php:453
2727
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 320 LIMIT 1
0.199 ms 1 /classes/Product.php:5659
3200
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 10068 AND id_shop=1 LIMIT 1
0.199 ms 1 /classes/Product.php:6876
3357
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 12552
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.199 ms 1 /classes/SpecificPrice.php:259
4103
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 7943
0.199 ms 1 /classes/Product.php:2902
1057
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2628
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.199 ms 0 /classes/SpecificPrice.php:259
1961
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.199 ms 1 /classes/Product.php:5659
2290
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 5592 AND id_shop=1 LIMIT 1
0.199 ms 1 /classes/Product.php:6876
2832
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 8394 AND id_shop=1 LIMIT 1
0.199 ms 1 /classes/Product.php:6876
3000
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 9324 AND `id_group` = 1 LIMIT 1
0.199 ms 0 /classes/GroupReduction.php:156
1963
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3936
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.198 ms 0 /classes/SpecificPrice.php:259
2644
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 6195 AND `id_group` = 1 LIMIT 1
0.198 ms 0 /classes/GroupReduction.php:156
3245
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 10072
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.198 ms 0 /classes/SpecificPrice.php:259
3343
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 184 LIMIT 1
0.198 ms 1 /classes/Product.php:5659
4369
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 200 AND `id_shop` = 1
0.198 ms 6 /src/Adapter/EntityMapper.php:79
1077
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.198 ms 1 /classes/Product.php:5659
2051
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 190 LIMIT 1
0.198 ms 1 /classes/Product.php:5659
2078
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4962 AND id_shop=1 LIMIT 1
0.198 ms 1 /classes/Product.php:6876
2528
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 182 LIMIT 1
0.198 ms 1 /classes/Product.php:5659
2972
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 173 LIMIT 1
0.198 ms 1 /classes/Product.php:5659
593
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2690
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.197 ms 0 /classes/SpecificPrice.php:259
1761
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.197 ms 1 /classes/Product.php:5659
2484
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 182 LIMIT 1
0.197 ms 1 /classes/Product.php:5659
4210
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 9692
0.197 ms 1 /classes/Product.php:2902
414
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2694 LIMIT 1
0.197 ms 10 /classes/SpecificPrice.php:435
814
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2780
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.197 ms 0 /classes/SpecificPrice.php:259
980
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2782
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.197 ms 0 /classes/SpecificPrice.php:259
1497
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.197 ms 1 /classes/Product.php:5659
2716
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 320 LIMIT 1
0.197 ms 1 /classes/Product.php:5659
2943
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 8976 AND `id_group` = 1 LIMIT 1
0.197 ms 0 /classes/GroupReduction.php:156
3224
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 10070 AND id_shop=1 LIMIT 1
0.197 ms 1 /classes/Product.php:6876
3470
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3587
0.197 ms 1 /classes/Product.php:2902
3572
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3075
0.197 ms 1 /classes/Product.php:2902
3641
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2639
0.197 ms 1 /classes/Product.php:2902
3143
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 9693 AND id_shop=1 LIMIT 1
0.196 ms 1 /classes/Product.php:6876
28
SELECT SQL_NO_CACHE `id_lang` FROM `hgt78_lang`
WHERE `locale` = 'fr-fr'
OR `language_code` = 'fr-fr' LIMIT 1
0.196 ms 6 /classes/Language.php:883
393
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3587
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.196 ms 1 /classes/SpecificPrice.php:259
819
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2780) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.196 ms 1 /classes/stock/StockAvailable.php:453
1145
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2626
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.196 ms 0 /classes/SpecificPrice.php:259
1333
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3252
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.196 ms 0 /classes/SpecificPrice.php:259
1514
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2733 AND `id_group` = 1 LIMIT 1
0.196 ms 0 /classes/GroupReduction.php:156
1766
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3753 AND id_shop=1 LIMIT 1
0.196 ms 1 /classes/Product.php:6876
2017
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 185 LIMIT 1
0.196 ms 1 /classes/Product.php:5659
2131
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 5265
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.196 ms 0 /classes/SpecificPrice.php:259
2280
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 5591 AND `id_group` = 1 LIMIT 1
0.196 ms 0 /classes/GroupReduction.php:156
2307
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.196 ms 1 /classes/Product.php:5659
2352
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 178 LIMIT 1
0.196 ms 1 /classes/Product.php:5659
2364
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 6106 LIMIT 1
0.196 ms 10 /classes/SpecificPrice.php:435
2398
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 6129
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.196 ms 0 /classes/SpecificPrice.php:259
2689
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 7938 AND `id_group` = 1 LIMIT 1
0.196 ms 0 /classes/GroupReduction.php:156
3011
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 9325 AND `id_group` = 1 LIMIT 1
0.196 ms 0 /classes/GroupReduction.php:156
3332
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 184 LIMIT 1
0.196 ms 1 /classes/Product.php:5659
254
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 5141 AND `id_group` = 1 LIMIT 1
0.195 ms 0 /classes/GroupReduction.php:156
1955
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3808 AND id_shop=1 LIMIT 1
0.195 ms 1 /classes/Product.php:6876
2062
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 190 LIMIT 1
0.195 ms 1 /classes/Product.php:5659
2079
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4962 AND `id_group` = 1 LIMIT 1
0.195 ms 0 /classes/GroupReduction.php:156
2431
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 6174
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.195 ms 0 /classes/SpecificPrice.php:259
2464
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 6178
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.195 ms 0 /classes/SpecificPrice.php:259
2522
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 6183 AND id_shop=1 LIMIT 1
0.195 ms 1 /classes/Product.php:6876
2777
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 7769 AND id_shop=1 LIMIT 1
0.195 ms 1 /classes/Product.php:6876
3360
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 12552 AND id_shop=1 LIMIT 1
0.195 ms 1 /classes/Product.php:6876
1291
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2643 AND id_shop=1 LIMIT 1
0.195 ms 1 /classes/Product.php:6876
154
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 7539 AND `id_group` = 1 LIMIT 1
0.194 ms 0 /classes/GroupReduction.php:156
527
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2774
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.194 ms 0 /classes/SpecificPrice.php:259
2683
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 320 LIMIT 1
0.194 ms 1 /classes/Product.php:5659
3173
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 9697
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.194 ms 0 /classes/SpecificPrice.php:259
2601
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 6191) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.194 ms 1 /classes/stock/StockAvailable.php:453
349
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4902
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.193 ms 0 /classes/SpecificPrice.php:259
983
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2782 AND id_shop=1 LIMIT 1
0.193 ms 1 /classes/Product.php:6876
1492
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2490 AND `id_group` = 1 LIMIT 1
0.193 ms 0 /classes/GroupReduction.php:156
1751
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3752 LIMIT 1
0.193 ms 10 /classes/SpecificPrice.php:435
2453
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 6177
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.193 ms 0 /classes/SpecificPrice.php:259
2760
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 320 LIMIT 1
0.193 ms 1 /classes/Product.php:5659
2810
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 8392 AND id_shop=1 LIMIT 1
0.193 ms 1 /classes/Product.php:6876
4797
SELECT SQL_NO_CACHE psgdprl.message FROM `hgt78_psgdpr_consent` psgdpr
LEFT JOIN hgt78_psgdpr_consent_lang psgdprl ON (psgdpr.id_gdpr_consent = psgdprl.id_gdpr_consent)
WHERE psgdpr.id_module = 22 AND psgdprl.id_lang =1 LIMIT 1
0.193 ms 12 /modules/psgdpr/classes/GDPRConsent.php:111
475
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2767 AND id_shop=1 LIMIT 1
0.193 ms 1 /classes/Product.php:6876
1863
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3771
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.193 ms 0 /classes/SpecificPrice.php:259
1923
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3805 AND `id_group` = 1 LIMIT 1
0.193 ms 0 /classes/GroupReduction.php:156
3085
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 9688
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.193 ms 0 /classes/SpecificPrice.php:259
3327
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 10303 AND `id_group` = 1 LIMIT 1
0.193 ms 0 /classes/GroupReduction.php:156
3551
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2779
0.193 ms 1 /classes/Product.php:2902
3698
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2649
0.193 ms 1 /classes/Product.php:2902
4201
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 9689
0.193 ms 1 /classes/Product.php:2902
4300
SELECT SQL_NO_CACHE `id_module` FROM `hgt78_module` WHERE `name` = "iqitsearch" LIMIT 1
0.193 ms 1 /classes/module/Module.php:2664
741
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2799 AND `id_group` = 1 LIMIT 1
0.192 ms 0 /classes/GroupReduction.php:156
1635
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3585 AND `id_group` = 1 LIMIT 1
0.192 ms 0 /classes/GroupReduction.php:156
2030
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4935
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.192 ms 0 /classes/SpecificPrice.php:259
2584
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 6189 LIMIT 1
0.192 ms 10 /classes/SpecificPrice.php:435
2932
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 8975 AND `id_group` = 1 LIMIT 1
0.192 ms 0 /classes/GroupReduction.php:156
3043
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 9597 AND id_shop=1 LIMIT 1
0.192 ms 1 /classes/Product.php:6876
1413
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3155 AND id_shop=1 LIMIT 1
0.192 ms 1 /classes/Product.php:6876
2612
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 6192) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.192 ms 1 /classes/stock/StockAvailable.php:453
3127
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 334 LIMIT 1
0.192 ms 1 /classes/Product.php:5659
4088
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 6501
0.192 ms 1 /classes/Product.php:2902
315
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 5135 LIMIT 1
0.191 ms 10 /classes/SpecificPrice.php:435
498
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2769 AND `id_group` = 1 LIMIT 1
0.191 ms 0 /classes/GroupReduction.php:156
1308
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.191 ms 1 /classes/Product.php:5659
3051
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 9598
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.191 ms 0 /classes/SpecificPrice.php:259
3110
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 9690 AND id_shop=1 LIMIT 1
0.191 ms 1 /classes/Product.php:6876
3165
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 9695 AND id_shop=1 LIMIT 1
0.191 ms 1 /classes/Product.php:6876
3617
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2631
0.191 ms 1 /classes/Product.php:2902
3803
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3584
0.191 ms 1 /classes/Product.php:2902
671
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2777
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.190 ms 0 /classes/SpecificPrice.php:259
704
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2795
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.190 ms 0 /classes/SpecificPrice.php:259
1013
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2638
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.190 ms 0 /classes/SpecificPrice.php:259
1275
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.190 ms 1 /classes/Product.php:5659
2064
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4944
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.190 ms 0 /classes/SpecificPrice.php:259
2220
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 5335
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.190 ms 0 /classes/SpecificPrice.php:259
2937
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 190 LIMIT 1
0.190 ms 1 /classes/Product.php:5659
3066
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 9687 AND id_shop=1 LIMIT 1
0.190 ms 1 /classes/Product.php:6876
3096
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 9689
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.190 ms 0 /classes/SpecificPrice.php:259
3129
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 9692
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.190 ms 0 /classes/SpecificPrice.php:259
3144
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 9693 AND `id_group` = 1 LIMIT 1
0.190 ms 0 /classes/GroupReduction.php:156
3188
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 10067 AND id_shop=1 LIMIT 1
0.190 ms 1 /classes/Product.php:6876
3593
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2788
0.190 ms 1 /classes/Product.php:2902
4118
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 7779
0.190 ms 1 /classes/Product.php:2902
215
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 309 LIMIT 1
0.189 ms 1 /classes/Product.php:5659
363
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3743 AND id_shop=1 LIMIT 1
0.189 ms 1 /classes/Product.php:6876
946
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2632
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.189 ms 0 /classes/SpecificPrice.php:259
1269
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2646 AND id_shop=1 LIMIT 1
0.189 ms 1 /classes/Product.php:6876
2019
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4934
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.189 ms 0 /classes/SpecificPrice.php:259
2164
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 5282
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.189 ms 0 /classes/SpecificPrice.php:259
3272
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 10111 AND `id_group` = 1 LIMIT 1
0.189 ms 0 /classes/GroupReduction.php:156
331
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 5134 AND `id_group` = 1 LIMIT 1
0.189 ms 0 /classes/GroupReduction.php:156
1117
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3458) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.189 ms 1 /classes/stock/StockAvailable.php:453
1258
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2647 AND id_shop=1 LIMIT 1
0.189 ms 1 /classes/Product.php:6876
2655
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 6499 AND `id_group` = 1 LIMIT 1
0.189 ms 0 /classes/GroupReduction.php:156
3061
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 334 LIMIT 1
0.189 ms 1 /classes/Product.php:5659
3088
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 9688 AND id_shop=1 LIMIT 1
0.189 ms 1 /classes/Product.php:6876
1154
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.188 ms 1 /classes/Product.php:5659
2042
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4942
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.188 ms 0 /classes/SpecificPrice.php:259
3377
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 62 LIMIT 1
0.188 ms 1 /classes/Product.php:5659
4106
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 7944
0.188 ms 1 /classes/Product.php:2902
4192
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 9687
0.188 ms 1 /classes/Product.php:2902
4240
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 10072
0.188 ms 1 /classes/Product.php:2902
4781
SELECT SQL_NO_CACHE c.`nleft`, c.`nright` FROM `hgt78_category` c
WHERE c.`id_category` = 1 LIMIT 1
0.188 ms 1 /classes/Category.php:1591
2673
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 6501
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.188 ms 0 /classes/SpecificPrice.php:259
2707
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 7941
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.188 ms 0 /classes/SpecificPrice.php:259
3055
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 9598 AND `id_group` = 1 LIMIT 1
0.188 ms 0 /classes/GroupReduction.php:156
3063
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 9687
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.188 ms 0 /classes/SpecificPrice.php:259
3383
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 11001 AND `id_group` = 1 LIMIT 1
0.188 ms 0 /classes/GroupReduction.php:156
3527
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2691
0.188 ms 1 /classes/Product.php:2902
3608
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3177
0.188 ms 1 /classes/Product.php:2902
1934
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3806 AND `id_group` = 1 LIMIT 1
0.187 ms 0 /classes/GroupReduction.php:156
2807
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 8392
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.187 ms 0 /classes/SpecificPrice.php:259
3010
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 9325 AND id_shop=1 LIMIT 1
0.187 ms 1 /classes/Product.php:6876
3249
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 10072 AND `id_group` = 1 LIMIT 1
0.187 ms 0 /classes/GroupReduction.php:156
228
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 5143
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.187 ms 0 /classes/SpecificPrice.php:259
472
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2767
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.187 ms 0 /classes/SpecificPrice.php:259
790
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.187 ms 1 /classes/Product.php:5659
1000
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.187 ms 1 /classes/Product.php:5659
1502
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2621 AND id_shop=1 LIMIT 1
0.187 ms 1 /classes/Product.php:6876
1956
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3808 AND `id_group` = 1 LIMIT 1
0.187 ms 0 /classes/GroupReduction.php:156
2186
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 5284
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.187 ms 0 /classes/SpecificPrice.php:259
2840
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 8395
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.187 ms 0 /classes/SpecificPrice.php:259
2955
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 9055 AND `id_group` = 1 LIMIT 1
0.187 ms 0 /classes/GroupReduction.php:156
3077
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 9686 AND id_shop=1 LIMIT 1
0.187 ms 1 /classes/Product.php:6876
3533
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2693
0.187 ms 1 /classes/Product.php:2902
607
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2691 AND id_shop=1 LIMIT 1
0.186 ms 1 /classes/Product.php:6876
757
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.186 ms 1 /classes/Product.php:5659
1557
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3455 AND id_shop=1 LIMIT 1
0.186 ms 1 /classes/Product.php:6876
1972
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.186 ms 1 /classes/Product.php:5659
2257
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 5589 AND id_shop=1 LIMIT 1
0.186 ms 1 /classes/Product.php:6876
2331
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 5972
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.186 ms 0 /classes/SpecificPrice.php:259
3118
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 9691
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.186 ms 0 /classes/SpecificPrice.php:259
3288
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.186 ms 1 /classes/Product.php:5659
4094
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 7940
0.186 ms 1 /classes/Product.php:2902
4791
SELECT SQL_NO_CACHE button1 FROM hgt78_lgcookieslaw_lang WHERE id_lang = 1 LIMIT 1
0.186 ms 1 /modules/lgcookieslaw/lgcookieslaw.php:161
619
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2692 AND `id_group` = 1 LIMIT 1
0.185 ms 0 /classes/GroupReduction.php:156
1985
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4574
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.185 ms 0 /classes/SpecificPrice.php:259
1994
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.185 ms 1 /classes/Product.php:5659
2643
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 6195 AND id_shop=1 LIMIT 1
0.185 ms 1 /classes/Product.php:6876
2788
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 7779 AND id_shop=1 LIMIT 1
0.185 ms 1 /classes/Product.php:6876
403
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2893 LIMIT 1
0.184 ms 11 /classes/SpecificPrice.php:435
1177
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2641 LIMIT 1
0.184 ms 10 /classes/SpecificPrice.php:435
1841
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3765
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.184 ms 0 /classes/SpecificPrice.php:259
2211
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 5296 AND id_shop=1 LIMIT 1
0.184 ms 1 /classes/Product.php:6876
2369
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 6106 AND `id_group` = 1 LIMIT 1
0.184 ms 0 /classes/GroupReduction.php:156
2666
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 6500 AND `id_group` = 1 LIMIT 1
0.184 ms 0 /classes/GroupReduction.php:156
3162
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 9695
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.184 ms 0 /classes/SpecificPrice.php:259
4112
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 7946
0.184 ms 1 /classes/Product.php:2902
587
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2661) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.184 ms 1 /classes/stock/StockAvailable.php:453
2268
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 5590 AND id_shop=1 LIMIT 1
0.183 ms 1 /classes/Product.php:6876
2651
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 6499
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.183 ms 0 /classes/SpecificPrice.php:259
2677
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 6501 AND `id_group` = 1 LIMIT 1
0.183 ms 0 /classes/GroupReduction.php:156
4100
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 7942
0.183 ms 1 /classes/Product.php:2902
4109
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 7945
0.183 ms 1 /classes/Product.php:2902
4794
SELECT SQL_NO_CACHE `id_module` FROM `hgt78_module` WHERE `name` = "ps_emailsubscription" LIMIT 1
0.183 ms 1 /classes/module/Module.php:2664
1161
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2627) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.183 ms 1 /classes/stock/StockAvailable.php:453
1554
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3455
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.183 ms 1 /classes/SpecificPrice.php:259
2265
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 5590
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.183 ms 0 /classes/SpecificPrice.php:259
2796
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 7773
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.183 ms 0 /classes/SpecificPrice.php:259
3629
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2782
0.183 ms 1 /classes/Product.php:2902
1999
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4575 AND id_shop=1 LIMIT 1
0.182 ms 1 /classes/Product.php:6876
2263
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 198 LIMIT 1
0.182 ms 1 /classes/Product.php:5659
2530
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 6184
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.182 ms 0 /classes/SpecificPrice.php:259
3237
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 10071 AND `id_group` = 1 LIMIT 1
0.182 ms 0 /classes/GroupReduction.php:156
1380
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3264 AND id_shop=1 LIMIT 1
0.182 ms 1 /classes/Product.php:6876
2023
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4934 AND `id_group` = 1 LIMIT 1
0.182 ms 0 /classes/GroupReduction.php:156
2190
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 5284 AND `id_group` = 1 LIMIT 1
0.182 ms 0 /classes/GroupReduction.php:156
2242
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 5093
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.182 ms 0 /classes/SpecificPrice.php:259
2254
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 5589
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.182 ms 0 /classes/SpecificPrice.php:259
2376
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 6107
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.182 ms 0 /classes/SpecificPrice.php:259
3575
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3176
0.182 ms 1 /classes/Product.php:2902
2287
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 5592
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.181 ms 0 /classes/SpecificPrice.php:259
2607
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 6192
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.181 ms 1 /classes/SpecificPrice.php:259
2996
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 9324
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.181 ms 0 /classes/SpecificPrice.php:259
3545
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2777
0.181 ms 1 /classes/Product.php:2902
1143
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.181 ms 1 /classes/Product.php:5659
2231
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 5350
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.181 ms 0 /classes/SpecificPrice.php:259
2497
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 6181
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.181 ms 1 /classes/SpecificPrice.php:259
2800
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 7773 AND `id_group` = 1 LIMIT 1
0.181 ms 0 /classes/GroupReduction.php:156
3542
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2764
0.181 ms 1 /classes/Product.php:2902
3626
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2634
0.181 ms 1 /classes/Product.php:2902
3650
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2628
0.181 ms 1 /classes/Product.php:2902
4290
SELECT SQL_NO_CACHE `id_module` FROM `hgt78_module_shop` WHERE `id_module` = 79 AND `id_shop` = 1 LIMIT 1
0.181 ms 1 /classes/module/Module.php:2137
531
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2774 AND `id_group` = 1 LIMIT 1
0.180 ms 0 /classes/GroupReduction.php:156
580
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.180 ms 1 /classes/Product.php:5659
869
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2790
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.180 ms 0 /classes/SpecificPrice.php:259
957
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2633
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.180 ms 0 /classes/SpecificPrice.php:259
1755
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3752 AND id_shop=1 LIMIT 1
0.180 ms 1 /classes/Product.php:6876
2762
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 7946
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.180 ms 1 /classes/SpecificPrice.php:259
2794
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 177 LIMIT 1
0.180 ms 1 /classes/Product.php:5659
2921
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 8420 AND `id_group` = 1 LIMIT 1
0.180 ms 0 /classes/GroupReduction.php:156
2978
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 9321 AND `id_group` = 1 LIMIT 1
0.180 ms 0 /classes/GroupReduction.php:156
2989
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 9323 AND `id_group` = 1 LIMIT 1
0.180 ms 0 /classes/GroupReduction.php:156
1128
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2624) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.179 ms 1 /classes/stock/StockAvailable.php:453
1156
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2627
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.179 ms 0 /classes/SpecificPrice.php:259
1706
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.179 ms 1 /classes/Product.php:5659
2178
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 5283 AND id_shop=1 LIMIT 1
0.179 ms 1 /classes/Product.php:6876
2743
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 7944 AND id_shop=1 LIMIT 1
0.179 ms 1 /classes/Product.php:6876
2844
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 8395 AND `id_group` = 1 LIMIT 1
0.179 ms 0 /classes/GroupReduction.php:156
3248
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 10072 AND id_shop=1 LIMIT 1
0.179 ms 1 /classes/Product.php:6876
3638
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2638
0.179 ms 1 /classes/Product.php:2902
161
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 6727
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.179 ms 0 /classes/SpecificPrice.php:259
574
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2765 AND id_shop=1 LIMIT 1
0.179 ms 1 /classes/Product.php:6876
768
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.179 ms 1 /classes/Product.php:5659
2622
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 6193 AND `id_group` = 1 LIMIT 1
0.179 ms 0 /classes/GroupReduction.php:156
3620
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2632
0.179 ms 1 /classes/Product.php:2902
646
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `hgt78_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 181 LIMIT 1
0.178 ms 1 /classes/Category.php:1378
1266
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2646
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.178 ms 0 /classes/SpecificPrice.php:259
2195
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 95 LIMIT 1
0.178 ms 1 /classes/Product.php:5659
2567
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 6187 AND `id_group` = 1 LIMIT 1
0.178 ms 0 /classes/GroupReduction.php:156
2718
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 7942
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.178 ms 0 /classes/SpecificPrice.php:259
4222
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 9697
0.178 ms 1 /classes/Product.php:2902
857
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2789 LIMIT 1
0.178 ms 10 /classes/SpecificPrice.php:435
1132
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.178 ms 1 /classes/Product.php:5659
2068
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4944 AND `id_group` = 1 LIMIT 1
0.178 ms 0 /classes/GroupReduction.php:156
3560
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2798
0.178 ms 1 /classes/Product.php:2902
3635
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2637
0.178 ms 1 /classes/Product.php:2902
4151
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 8419
0.178 ms 1 /classes/Product.php:2902
2229
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 95 LIMIT 1
0.177 ms 1 /classes/Product.php:5659
2577
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 6188 AND id_shop=1 LIMIT 1
0.177 ms 1 /classes/Product.php:6876
2053
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4943
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.177 ms 0 /classes/SpecificPrice.php:259
2274
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 198 LIMIT 1
0.177 ms 1 /classes/Product.php:5659
2574
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 6188
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.177 ms 0 /classes/SpecificPrice.php:259
3032
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 9596 AND id_shop=1 LIMIT 1
0.176 ms 1 /classes/Product.php:6876
298
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 5137 AND `id_group` = 1 LIMIT 1
0.176 ms 0 /classes/GroupReduction.php:156
801
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.176 ms 1 /classes/Product.php:5659
878
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 182 LIMIT 1
0.176 ms 1 /classes/Product.php:5659
1259
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2647 AND `id_group` = 1 LIMIT 1
0.176 ms 0 /classes/GroupReduction.php:156
1973
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4256 LIMIT 1
0.176 ms 10 /classes/SpecificPrice.php:435
2040
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 190 LIMIT 1
0.176 ms 1 /classes/Product.php:5659
2855
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 8396 AND `id_group` = 1 LIMIT 1
0.176 ms 0 /classes/GroupReduction.php:156
4070
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 6192
0.176 ms 1 /classes/Product.php:2902
781
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3176
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.175 ms 0 /classes/SpecificPrice.php:259
1149
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2626 AND `id_group` = 1 LIMIT 1
0.175 ms 0 /classes/GroupReduction.php:156
1718
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3749 LIMIT 1
0.175 ms 10 /classes/SpecificPrice.php:435
1878
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3775 AND `id_group` = 1 LIMIT 1
0.175 ms 0 /classes/GroupReduction.php:156
2424
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 6173 AND `id_group` = 1 LIMIT 1
0.175 ms 0 /classes/GroupReduction.php:156
2688
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 7938 AND id_shop=1 LIMIT 1
0.175 ms 1 /classes/Product.php:6876
2705
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 320 LIMIT 1
0.175 ms 1 /classes/Product.php:5659
3647
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2629
0.175 ms 1 /classes/Product.php:2902
441
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2652 AND id_shop=1 LIMIT 1
0.174 ms 1 /classes/Product.php:6876
1342
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.174 ms 1 /classes/Product.php:5659
2034
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4935 AND `id_group` = 1 LIMIT 1
0.174 ms 0 /classes/GroupReduction.php:156
2500
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 6181 AND id_shop=1 LIMIT 1
0.174 ms 1 /classes/Product.php:6876
2512
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 6182 AND `id_group` = 1 LIMIT 1
0.174 ms 0 /classes/GroupReduction.php:156
2632
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 6194 AND id_shop=1 LIMIT 1
0.174 ms 1 /classes/Product.php:6876
2774
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 7769
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.174 ms 0 /classes/SpecificPrice.php:259
2910
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 8419 AND `id_group` = 1 LIMIT 1
0.174 ms 0 /classes/GroupReduction.php:156
3089
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 9688 AND `id_group` = 1 LIMIT 1
0.174 ms 0 /classes/GroupReduction.php:156
3605
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2792
0.174 ms 1 /classes/Product.php:2902
1752
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3752
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.174 ms 0 /classes/SpecificPrice.php:259
3372
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 12551 AND `id_group` = 1 LIMIT 1
0.174 ms 0 /classes/GroupReduction.php:156
770
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3075
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.173 ms 0 /classes/SpecificPrice.php:259
1310
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2644
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.173 ms 0 /classes/SpecificPrice.php:259
1745
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3751 AND `id_group` = 1 LIMIT 1
0.173 ms 0 /classes/GroupReduction.php:156
1521
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2650
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.173 ms 0 /classes/SpecificPrice.php:259
2596
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 6191
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.173 ms 1 /classes/SpecificPrice.php:259
2818
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 8393
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.173 ms 0 /classes/SpecificPrice.php:259
795
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2794 AND id_shop=1 LIMIT 1
0.172 ms 1 /classes/Product.php:6876
858
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2789
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.172 ms 0 /classes/SpecificPrice.php:259
1138
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2625 AND `id_group` = 1 LIMIT 1
0.172 ms 0 /classes/GroupReduction.php:156
2184
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 95 LIMIT 1
0.172 ms 1 /classes/Product.php:5659
1072
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3477 AND `id_group` = 1 LIMIT 1
0.172 ms 0 /classes/GroupReduction.php:156
1547
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3454 AND `id_group` = 1 LIMIT 1
0.172 ms 0 /classes/GroupReduction.php:156
1799
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3756 AND id_shop=1 LIMIT 1
0.172 ms 1 /classes/Product.php:6876
1988
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4574 AND id_shop=1 LIMIT 1
0.172 ms 1 /classes/Product.php:6876
2594
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 182 LIMIT 1
0.172 ms 1 /classes/Product.php:5659
4305
SELECT SQL_NO_CACHE `id_module` FROM `hgt78_module_shop` WHERE `id_module` = 90 AND `id_shop` = 1 LIMIT 1
0.172 ms 1 /classes/module/Module.php:2137
1244
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2658
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.171 ms 0 /classes/SpecificPrice.php:259
2246
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 5093 AND `id_group` = 1 LIMIT 1
0.171 ms 0 /classes/GroupReduction.php:156
2251
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `hgt78_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 198 LIMIT 1
0.171 ms 1 /classes/Category.php:1378
2789
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 7779 AND `id_group` = 1 LIMIT 1
0.171 ms 0 /classes/GroupReduction.php:156
3111
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 9690 AND `id_group` = 1 LIMIT 1
0.171 ms 0 /classes/GroupReduction.php:156
3133
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 9692 AND `id_group` = 1 LIMIT 1
0.171 ms 0 /classes/GroupReduction.php:156
382
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3740
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.171 ms 0 /classes/SpecificPrice.php:259
916
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2659 AND id_shop=1 LIMIT 1
0.171 ms 1 /classes/Product.php:6876
1027
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2639 AND id_shop=1 LIMIT 1
0.171 ms 1 /classes/Product.php:6876
1111
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3458 LIMIT 1
0.171 ms 10 /classes/SpecificPrice.php:435
2276
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 5591
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.171 ms 0 /classes/SpecificPrice.php:259
3078
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 9686 AND `id_group` = 1 LIMIT 1
0.171 ms 0 /classes/GroupReduction.php:156
4298
SELECT SQL_NO_CACHE *
FROM `hgt78_currency_lang`
WHERE `id_currency` = 2
0.171 ms 6 /src/Adapter/EntityMapper.php:79
552
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2776 AND id_shop=1 LIMIT 1
0.170 ms 1 /classes/Product.php:6876
917
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2659 AND `id_group` = 1 LIMIT 1
0.170 ms 0 /classes/GroupReduction.php:156
1348
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3254 AND `id_group` = 1 LIMIT 1
0.170 ms 0 /classes/GroupReduction.php:156
1712
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3748 AND `id_group` = 1 LIMIT 1
0.170 ms 0 /classes/GroupReduction.php:156
2234
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 5350 AND id_shop=1 LIMIT 1
0.170 ms 1 /classes/Product.php:6876
3100
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 9689 AND `id_group` = 1 LIMIT 1
0.170 ms 0 /classes/GroupReduction.php:156
3122
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 9691 AND `id_group` = 1 LIMIT 1
0.170 ms 0 /classes/GroupReduction.php:156
1613
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3559 AND `id_group` = 1 LIMIT 1
0.169 ms 0 /classes/GroupReduction.php:156
1767
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3753 AND `id_group` = 1 LIMIT 1
0.169 ms 0 /classes/GroupReduction.php:156
2006
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 177 LIMIT 1
0.169 ms 1 /classes/Product.php:5659
2463
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 6178 LIMIT 1
0.169 ms 10 /classes/SpecificPrice.php:435
2335
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 5972 AND `id_group` = 1 LIMIT 1
0.168 ms 0 /classes/GroupReduction.php:156
2534
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 6184 AND `id_group` = 1 LIMIT 1
0.168 ms 0 /classes/GroupReduction.php:156
3361
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 12552 AND `id_group` = 1 LIMIT 1
0.168 ms 0 /classes/GroupReduction.php:156
2572
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 182 LIMIT 1
0.167 ms 1 /classes/Product.php:5659
825
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2781
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.167 ms 0 /classes/SpecificPrice.php:259
1028
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2639 AND `id_group` = 1 LIMIT 1
0.167 ms 0 /classes/GroupReduction.php:156
1101
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2622
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.167 ms 0 /classes/SpecificPrice.php:259
2168
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 5282 AND `id_group` = 1 LIMIT 1
0.167 ms 0 /classes/GroupReduction.php:156
2552
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 6186
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.167 ms 0 /classes/SpecificPrice.php:259
856
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 182 LIMIT 1
0.166 ms 1 /classes/Product.php:5659
972
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2634 AND `id_group` = 1 LIMIT 1
0.166 ms 0 /classes/GroupReduction.php:156
2501
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 6181 AND `id_group` = 1 LIMIT 1
0.166 ms 0 /classes/GroupReduction.php:156
2508
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 6182
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.166 ms 0 /classes/SpecificPrice.php:259
2771
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `hgt78_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 180 LIMIT 1
0.166 ms 1 /classes/Category.php:1378
2877
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 8401 AND `id_group` = 1 LIMIT 1
0.166 ms 0 /classes/GroupReduction.php:156
664
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2764 AND `id_group` = 1 LIMIT 1
0.166 ms 0 /classes/GroupReduction.php:156
752
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2800 AND `id_group` = 1 LIMIT 1
0.166 ms 0 /classes/GroupReduction.php:156
1093
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3459 AND id_shop=1 LIMIT 1
0.166 ms 1 /classes/Product.php:6876
1237
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2649 AND `id_group` = 1 LIMIT 1
0.166 ms 0 /classes/GroupReduction.php:156
1524
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2650 AND id_shop=1 LIMIT 1
0.166 ms 1 /classes/Product.php:6876
2046
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4942 AND `id_group` = 1 LIMIT 1
0.166 ms 0 /classes/GroupReduction.php:156
364
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3743 AND `id_group` = 1 LIMIT 1
0.165 ms 0 /classes/GroupReduction.php:156
883
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2791 AND id_shop=1 LIMIT 1
0.165 ms 1 /classes/Product.php:6876
1707
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3748 LIMIT 1
0.165 ms 10 /classes/SpecificPrice.php:435
1734
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3750 AND `id_group` = 1 LIMIT 1
0.165 ms 0 /classes/GroupReduction.php:156
1810
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3757 AND id_shop=1 LIMIT 1
0.165 ms 1 /classes/Product.php:6876
2245
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 5093 AND id_shop=1 LIMIT 1
0.165 ms 1 /classes/Product.php:6876
2627
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 182 LIMIT 1
0.165 ms 1 /classes/Product.php:5659
4073
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 6193
0.165 ms 1 /classes/Product.php:2902
1750
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.164 ms 1 /classes/Product.php:5659
2363
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 178 LIMIT 1
0.164 ms 1 /classes/Product.php:5659
232
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 5143 AND `id_group` = 1 LIMIT 1
0.163 ms 0 /classes/GroupReduction.php:156
560
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2766
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.163 ms 0 /classes/SpecificPrice.php:259
773
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3075 AND id_shop=1 LIMIT 1
0.163 ms 1 /classes/Product.php:6876
2556
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 6186 AND `id_group` = 1 LIMIT 1
0.163 ms 0 /classes/GroupReduction.php:156
2057
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4943 AND `id_group` = 1 LIMIT 1
0.163 ms 0 /classes/GroupReduction.php:156
2733
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 7943 AND `id_group` = 1 LIMIT 1
0.163 ms 0 /classes/GroupReduction.php:156
2309
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 5970
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.162 ms 0 /classes/SpecificPrice.php:259
2778
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 7769 AND `id_group` = 1 LIMIT 1
0.162 ms 0 /classes/GroupReduction.php:156
520
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2773 AND `id_group` = 1 LIMIT 1
0.162 ms 0 /classes/GroupReduction.php:156
978
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 183 LIMIT 1
0.162 ms 1 /classes/Product.php:5659
2197
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 5293
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.162 ms 0 /classes/SpecificPrice.php:259
2200
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 5293 AND id_shop=1 LIMIT 1
0.162 ms 1 /classes/Product.php:6876
2722
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 7942 AND `id_group` = 1 LIMIT 1
0.162 ms 0 /classes/GroupReduction.php:156
4786
SELECT SQL_NO_CACHE `id_module` FROM `hgt78_module_shop` WHERE `id_module` = 81 AND `id_shop` = 1 LIMIT 1
0.162 ms 1 /classes/module/Module.php:2137
2212
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 5296 AND `id_group` = 1 LIMIT 1
0.161 ms 0 /classes/GroupReduction.php:156
2744
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 7944 AND `id_group` = 1 LIMIT 1
0.161 ms 0 /classes/GroupReduction.php:156
4076
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 6194
0.161 ms 1 /classes/Product.php:2902
564
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2766 AND `id_group` = 1 LIMIT 1
0.160 ms 0 /classes/GroupReduction.php:156
658
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 182 LIMIT 1
0.160 ms 1 /classes/Product.php:5659
1099
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.160 ms 1 /classes/Product.php:5659
2189
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 5284 AND id_shop=1 LIMIT 1
0.160 ms 1 /classes/Product.php:6876
2721
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 7942 AND id_shop=1 LIMIT 1
0.160 ms 1 /classes/Product.php:6876
3166
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 9695 AND `id_group` = 1 LIMIT 1
0.160 ms 0 /classes/GroupReduction.php:156
3177
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 9697 AND `id_group` = 1 LIMIT 1
0.160 ms 0 /classes/GroupReduction.php:156
1046
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2629
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.159 ms 0 /classes/SpecificPrice.php:259
1724
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3749) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.159 ms 1 /classes/stock/StockAvailable.php:453
2699
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 7940 AND id_shop=1 LIMIT 1
0.159 ms 1 /classes/Product.php:6876
2822
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 8393 AND `id_group` = 1 LIMIT 1
0.159 ms 0 /classes/GroupReduction.php:156
585
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2661 AND id_shop=1 LIMIT 1
0.158 ms 1 /classes/Product.php:6876
1950
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 184 LIMIT 1
0.158 ms 1 /classes/Product.php:5659
3225
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 10070 AND `id_group` = 1 LIMIT 1
0.158 ms 0 /classes/GroupReduction.php:156
3683
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2641
0.158 ms 1 /classes/Product.php:2902
846
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2788 LIMIT 1
0.158 ms 10 /classes/SpecificPrice.php:435
2519
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 6183
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.157 ms 0 /classes/SpecificPrice.php:259
1717
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.156 ms 1 /classes/Product.php:5659
1967
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3936 AND `id_group` = 1 LIMIT 1
0.156 ms 0 /classes/GroupReduction.php:156
2599
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 6191 AND id_shop=1 LIMIT 1
0.156 ms 1 /classes/Product.php:6876
4301
SELECT SQL_NO_CACHE `id_module` FROM `hgt78_module_shop` WHERE `id_module` = 95 AND `id_shop` = 1 LIMIT 1
0.156 ms 1 /classes/module/Module.php:2137
1343
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3254 LIMIT 1
0.155 ms 10 /classes/SpecificPrice.php:435
415
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2694
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.155 ms 0 /classes/SpecificPrice.php:259
597
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2690 AND `id_group` = 1 LIMIT 1
0.155 ms 0 /classes/GroupReduction.php:156
806
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2793 AND id_shop=1 LIMIT 1
0.155 ms 1 /classes/Product.php:6876
2218
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 62 LIMIT 1
0.155 ms 1 /classes/Product.php:5659
2269
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 5590 AND `id_group` = 1 LIMIT 1
0.155 ms 0 /classes/GroupReduction.php:156
2566
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 6187 AND id_shop=1 LIMIT 1
0.155 ms 1 /classes/Product.php:6876
2685
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 7938
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.155 ms 0 /classes/SpecificPrice.php:259
3283
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 10297 AND `id_group` = 1 LIMIT 1
0.155 ms 0 /classes/GroupReduction.php:156
1978
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4256 AND `id_group` = 1 LIMIT 1
0.154 ms 0 /classes/GroupReduction.php:156
2446
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 6176 AND `id_group` = 1 LIMIT 1
0.154 ms 0 /classes/GroupReduction.php:156
1763
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3753
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.154 ms 0 /classes/SpecificPrice.php:259
880
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2791
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.153 ms 0 /classes/SpecificPrice.php:259
3033
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 9596 AND `id_group` = 1 LIMIT 1
0.153 ms 0 /classes/GroupReduction.php:156
3067
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 9687 AND `id_group` = 1 LIMIT 1
0.152 ms 0 /classes/GroupReduction.php:156
2462
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 182 LIMIT 1
0.152 ms 1 /classes/Product.php:5659
1532
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2654
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.151 ms 0 /classes/SpecificPrice.php:259
184
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 5147
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.151 ms 0 /classes/SpecificPrice.php:259
1620
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3584
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.151 ms 0 /classes/SpecificPrice.php:259
2729
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 7943
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.151 ms 0 /classes/SpecificPrice.php:259
4295
SELECT SQL_NO_CACHE `id_module` FROM `hgt78_module_shop` WHERE `id_module` = 17 AND `id_shop` = 1 LIMIT 1
0.150 ms 1 /classes/module/Module.php:2137
430
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2660 AND id_shop=1 LIMIT 1
0.149 ms 1 /classes/Product.php:6876
1977
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4256 AND id_shop=1 LIMIT 1
0.149 ms 1 /classes/Product.php:6876
2618
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 6193
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.148 ms 0 /classes/SpecificPrice.php:259
2312
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 5970 AND id_shop=1 LIMIT 1
0.148 ms 1 /classes/Product.php:6876
2633
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 6194 AND `id_group` = 1 LIMIT 1
0.148 ms 0 /classes/GroupReduction.php:156
3566
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2800
0.147 ms 1 /classes/Product.php:2902
1989
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4574 AND `id_group` = 1 LIMIT 1
0.147 ms 0 /classes/GroupReduction.php:156
2700
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 7940 AND `id_group` = 1 LIMIT 1
0.147 ms 0 /classes/GroupReduction.php:156
3563
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2799
0.147 ms 1 /classes/Product.php:2902
718
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2797 AND id_shop=1 LIMIT 1
0.146 ms 1 /classes/Product.php:6876
2589
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 6189 AND `id_group` = 1 LIMIT 1
0.146 ms 0 /classes/GroupReduction.php:156
4082
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 6499
0.146 ms 1 /classes/Product.php:2902
1115
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3458 AND id_shop=1 LIMIT 1
0.146 ms 1 /classes/Product.php:6876
3355
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 172 LIMIT 1
0.146 ms 1 /classes/Product.php:5659
3689
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2648
0.146 ms 1 /classes/Product.php:2902
2585
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 6189
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.145 ms 0 /classes/SpecificPrice.php:259
608
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2691 AND `id_group` = 1 LIMIT 1
0.145 ms 0 /classes/GroupReduction.php:156
1558
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3455 AND `id_group` = 1 LIMIT 1
0.145 ms 0 /classes/GroupReduction.php:156
1756
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3752 AND `id_group` = 1 LIMIT 1
0.145 ms 0 /classes/GroupReduction.php:156
2258
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 5589 AND `id_group` = 1 LIMIT 1
0.145 ms 0 /classes/GroupReduction.php:156
2696
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 7940
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.144 ms 0 /classes/SpecificPrice.php:259
2755
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 7945 AND `id_group` = 1 LIMIT 1
0.144 ms 0 /classes/GroupReduction.php:156
708
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2795 AND `id_group` = 1 LIMIT 1
0.143 ms 0 /classes/GroupReduction.php:156
1624
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3584 AND `id_group` = 1 LIMIT 1
0.143 ms 0 /classes/GroupReduction.php:156
2252
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 198 LIMIT 1
0.143 ms 1 /classes/Product.php:5659
2545
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 6185 AND `id_group` = 1 LIMIT 1
0.142 ms 0 /classes/GroupReduction.php:156
3707
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2646
0.142 ms 1 /classes/Product.php:2902
818
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2780 AND `id_group` = 1 LIMIT 1
0.141 ms 0 /classes/GroupReduction.php:156
984
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2782 AND `id_group` = 1 LIMIT 1
0.141 ms 0 /classes/GroupReduction.php:156
1569
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3484 AND `id_group` = 1 LIMIT 1
0.141 ms 0 /classes/GroupReduction.php:156
1024
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2639
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.140 ms 0 /classes/SpecificPrice.php:259
314
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 309 LIMIT 1
0.140 ms 1 /classes/Product.php:5659
647
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 181 LIMIT 1
0.140 ms 1 /classes/Product.php:5659
839
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3179 AND id_shop=1 LIMIT 1
0.140 ms 1 /classes/Product.php:6876
845
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 182 LIMIT 1
0.139 ms 1 /classes/Product.php:5659
850
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2788 AND id_shop=1 LIMIT 1
0.139 ms 1 /classes/Product.php:6876
895
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2792 AND `id_group` = 1 LIMIT 1
0.139 ms 0 /classes/GroupReduction.php:156
1730
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3750
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.139 ms 0 /classes/SpecificPrice.php:259
2662
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 6500
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.139 ms 0 /classes/SpecificPrice.php:259
2710
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 7941 AND id_shop=1 LIMIT 1
0.139 ms 1 /classes/Product.php:6876
3695
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3456
0.139 ms 1 /classes/Product.php:2902
817
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2780 AND id_shop=1 LIMIT 1
0.138 ms 1 /classes/Product.php:6876
1204
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2648 AND `id_group` = 1 LIMIT 1
0.138 ms 0 /classes/GroupReduction.php:156
3704
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2647
0.138 ms 1 /classes/Product.php:2902
902
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3177
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.137 ms 0 /classes/SpecificPrice.php:259
1811
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3757 AND `id_group` = 1 LIMIT 1
0.137 ms 0 /classes/GroupReduction.php:156
2772
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 180 LIMIT 1
0.137 ms 1 /classes/Product.php:5659
2811
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 8392 AND `id_group` = 1 LIMIT 1
0.137 ms 0 /classes/GroupReduction.php:156
1126
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2624 AND id_shop=1 LIMIT 1
0.137 ms 1 /classes/Product.php:6876
2523
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 6183 AND `id_group` = 1 LIMIT 1
0.137 ms 0 /classes/GroupReduction.php:156
729
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2798 AND id_shop=1 LIMIT 1
0.136 ms 1 /classes/Product.php:6876
796
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2794 AND `id_group` = 1 LIMIT 1
0.136 ms 0 /classes/GroupReduction.php:156
905
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3177 AND id_shop=1 LIMIT 1
0.136 ms 1 /classes/Product.php:6876
1167
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2640
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.136 ms 0 /classes/SpecificPrice.php:259
1646
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3586 AND `id_group` = 1 LIMIT 1
0.136 ms 0 /classes/GroupReduction.php:156
2610
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 6192 AND id_shop=1 LIMIT 1
0.136 ms 1 /classes/Product.php:6876
4795
SELECT SQL_NO_CACHE `id_module` FROM `hgt78_module_shop` WHERE `id_module` = 22 AND `id_shop` = 1 LIMIT 1
0.136 ms 1 /classes/module/Module.php:2137
774
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3075 AND `id_group` = 1 LIMIT 1
0.135 ms 0 /classes/GroupReduction.php:156
828
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2781 AND id_shop=1 LIMIT 1
0.135 ms 1 /classes/Product.php:6876
2000
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4575 AND `id_group` = 1 LIMIT 1
0.134 ms 0 /classes/GroupReduction.php:156
2179
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 5283 AND `id_group` = 1 LIMIT 1
0.133 ms 0 /classes/GroupReduction.php:156
1112
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3458
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.133 ms 0 /classes/SpecificPrice.php:259
1110
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.132 ms 1 /classes/Product.php:5659
2201
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 5293 AND `id_group` = 1 LIMIT 1
0.132 ms 0 /classes/GroupReduction.php:156
2313
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 5970 AND `id_group` = 1 LIMIT 1
0.132 ms 0 /classes/GroupReduction.php:156
2235
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 5350 AND `id_group` = 1 LIMIT 1
0.131 ms 0 /classes/GroupReduction.php:156
1165
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.131 ms 1 /classes/Product.php:5659
1094
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3459 AND `id_group` = 1 LIMIT 1
0.129 ms 0 /classes/GroupReduction.php:156
1104
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2622 AND id_shop=1 LIMIT 1
0.129 ms 1 /classes/Product.php:6876
586
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2661 AND `id_group` = 1 LIMIT 1
0.127 ms 0 /classes/GroupReduction.php:156
2600
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 6191 AND `id_group` = 1 LIMIT 1
0.127 ms 0 /classes/GroupReduction.php:156
1719
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3749
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.126 ms 0 /classes/SpecificPrice.php:259
1722
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3749 AND id_shop=1 LIMIT 1
0.126 ms 1 /classes/Product.php:6876
1974
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4256
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.126 ms 0 /classes/SpecificPrice.php:259
2468
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 6178 AND `id_group` = 1 LIMIT 1
0.125 ms 0 /classes/GroupReduction.php:156
309
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 5136 AND `id_group` = 1 LIMIT 1
0.120 ms 0 /classes/GroupReduction.php:156
1178
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2641
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.120 ms 0 /classes/SpecificPrice.php:259
427
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2660
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.117 ms 0 /classes/SpecificPrice.php:259
719
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2797 AND `id_group` = 1 LIMIT 1
0.116 ms 0 /classes/GroupReduction.php:156
1215
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2657 AND `id_group` = 1 LIMIT 1
0.115 ms 0 /classes/GroupReduction.php:156
1708
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3748
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.114 ms 0 /classes/SpecificPrice.php:259
847
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2788
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.111 ms 0 /classes/SpecificPrice.php:259
1116
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3458 AND `id_group` = 1 LIMIT 1
0.111 ms 0 /classes/GroupReduction.php:156
807
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2793 AND `id_group` = 1 LIMIT 1
0.110 ms 0 /classes/GroupReduction.php:156
730
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2798 AND `id_group` = 1 LIMIT 1
0.110 ms 0 /classes/GroupReduction.php:156
2711
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 7941 AND `id_group` = 1 LIMIT 1
0.109 ms 0 /classes/GroupReduction.php:156
1171
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2640 AND `id_group` = 1 LIMIT 1
0.108 ms 0 /classes/GroupReduction.php:156
1127
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2624 AND `id_group` = 1 LIMIT 1
0.104 ms 0 /classes/GroupReduction.php:156
2611
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 6192 AND `id_group` = 1 LIMIT 1
0.104 ms 0 /classes/GroupReduction.php:156
1723
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3749 AND `id_group` = 1 LIMIT 1
0.101 ms 0 /classes/GroupReduction.php:156

Doubles

304 queries
SELECT *
FROM `hgtXX_product` a
LEFT JOIN `hgtXX_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = XX
LEFT JOIN `hgtXX_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = XX
WHERE (a.`id_product` = XX) AND (b.`id_shop` = XX) LIMIT XX
297 queries
SELECT XX FROM `hgtXX_specific_price` WHERE id_product = XX LIMIT XX
296 queries
SELECT image_shop.`id_image`
                    FROM `hgtXX_image` i
                     INNER JOIN hgtXX_image_shop image_shop
        ON (image_shop.id_image = i.id_image AND image_shop.id_shop = XX)
                    WHERE i.`id_product` = XX
                    AND image_shop.`cover` = XX LIMIT XX
296 queries
SELECT name FROM hgtXX_category_lang WHERE id_shop = XX AND id_lang = XX AND id_category = XX LIMIT XX
296 queries
				SELECT `priority`, `id_specific_price_priority`
				FROM `hgtXX_specific_price_priority`
				WHERE `id_product` = XX
				ORDER BY `id_specific_price_priority` DESC LIMIT XX
296 queries
			SELECT *, ( IF (`id_group` = XX, XX, XX) +  IF (`id_country` = XX, XX, XX) +  IF (`id_currency` = XX, XX, XX) +  IF (`id_shop` = XX, XX, XX) +  IF (`id_customer` = XX, XX, XX)) AS `score`
				FROM `hgtXX_specific_price`
				WHERE
                `id_shop` IN (XX, XX) AND
                `id_currency` IN (XX, XX) AND
                `id_country` IN (XX, XX) AND
                `id_group` IN (XX, XX) AND `id_product` = XX AND `id_customer` = XX AND `id_product_attribute` = XX AND `id_cart` = XX  AND (`from` = 'XX-XX-XX XX:XX:XX' OR 'XX-XX-XX XX:XX:XX' >= `from`) AND (`to` = 'XX-XX-XX XX:XX:XX' OR 'XX-XX-XX XX:XX:XX' <= `to`)
				AND IF(`from_quantity` > XX, `from_quantity`, XX) <= XX ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT XX
296 queries
SELECT product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,XX) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgtXX_product` p
INNER JOIN `hgtXX_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = XX)
LEFT JOIN `hgtXX_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = XX)
WHERE (p.`id_product` = XX)
296 queries
                            SELECT `id_tax_rules_group`
                            FROM `hgtXX_product_shop`
                            WHERE `id_product` = XX AND id_shop=XX LIMIT XX
296 queries
			SELECT `reduction`
			FROM `hgtXX_product_group_reduction_cache`
			WHERE `id_product` = XX AND `id_group` = XX LIMIT XX
296 queries
SELECT SUM(quantity)
FROM `hgtXX_stock_available`
WHERE (id_product = XX) AND (id_product_attribute = XX) AND (id_shop = XX) AND (id_shop_group = XX) LIMIT XX
296 queries
SELECT
            COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), XX) as deep_quantity,
            COALESCE(SUM(first_level_quantity), XX) as quantity
          FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, XX as pack_quantity
          FROM `hgtXX_cart_product` cp
            WHERE cp.`id_product_attribute` = XX
            
            AND cp.`id_cart` = XX AND cp.`id_product` = XX UNION SELECT XX as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
          FROM `hgtXX_cart_product` cp JOIN `hgtXX_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgtXX_product` pr ON p.`id_product_pack` = pr.`id_product`
            WHERE cp.`id_product_attribute` = XX
            
            AND cp.`id_cart` = XX AND p.`id_product_item` = XX AND (pr.`pack_stock_type` IN (XX,XX) OR (
            pr.`pack_stock_type` = XX
            AND XX = XX
        ))) as q LIMIT XX
296 queries
                SELECT name, value, pf.id_feature, f.position, fvl.id_feature_value
                FROM hgtXX_feature_product pf
                LEFT JOIN hgtXX_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = XX)
                LEFT JOIN hgtXX_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = XX)
                LEFT JOIN hgtXX_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = XX)
                 INNER JOIN hgtXX_feature_shop feature_shop
        ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = XX)
                WHERE pf.id_product = XX
                ORDER BY f.position ASC
296 queries
            SELECT image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
            FROM `hgtXX_image` i
             INNER JOIN hgtXX_image_shop image_shop
        ON (image_shop.id_image = i.id_image AND image_shop.id_shop = XX)
            LEFT JOIN `hgtXX_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = XX)
            WHERE i.`id_product` = XX
            ORDER BY `position`
296 queries
SELECT pa.`id_product`, a.`color`, pac.`id_product_attribute`, XX qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
            FROM `hgtXX_product_attribute` pa
             INNER JOIN hgtXX_product_attribute_shop product_attribute_shop
        ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = XX)
            JOIN `hgtXX_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
            JOIN `hgtXX_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
            JOIN `hgtXX_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = XX)
            JOIN `hgtXX_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
            WHERE pa.`id_product` IN (XX) AND ag.`is_color_group` = XX
            GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
            
            ORDER BY a.`position` ASC;
295 queries
SELECT `id_product_attribute`
            FROM `hgtXX_product_attribute`
            WHERE `id_product` = XX
71 queries
SELECT *
FROM `hgtXX_category` a
LEFT JOIN `hgtXX_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = XX
WHERE (a.`id_category` = XX) LIMIT XX
71 queries
SELECT *
							FROM `hgtXX_category_lang`
							WHERE `id_category` = XX AND `id_shop` = XX
27 queries
SELECT *
FROM `hgtXX_category` a
LEFT JOIN `hgtXX_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = XX
LEFT JOIN `hgtXX_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = XX
WHERE (a.`id_category` = XX) AND (b.`id_shop` = XX) LIMIT XX
21 queries
			SELECT cl.`link_rewrite`
			FROM `hgtXX_category_lang` cl
			WHERE `id_lang` = XX
			 AND cl.id_shop = XX 
			AND cl.`id_category` = XX LIMIT XX
18 queries
				SELECT c.*, cl.*
				FROM `hgtXX_category` c
				 INNER JOIN hgtXX_category_shop category_shop
        ON (category_shop.id_category = c.id_category AND category_shop.id_shop = XX)
				LEFT JOIN `hgtXX_category_lang` cl ON c.`id_category` = cl.`id_category` AND cl.id_shop = XX 
				LEFT JOIN `hgtXX_category_group` cg ON c.`id_category` = cg.`id_category`
				RIGHT JOIN `hgtXX_category` cXX ON cXX.`id_category` = XX AND c.`nleft` >= cXX.`nleft` AND c.`nright` <= cXX.`nright`
				WHERE XX  AND `id_lang` = XX
				 AND c.`active` = XX
				 AND cg.`id_group` IN (XX)
				 GROUP BY c.`id_category`
				 ORDER BY c.`level_depth` ASC
				, category_shop.`position` ASC
				
10 queries
SELECT `id_module` FROM `hgtXX_module_shop` WHERE `id_module` = XX AND `id_shop` = XX LIMIT XX
4 queries
SELECT `id_lang` FROM `hgtXX_lang`
                    WHERE `locale` = 'fr-fr'
                    OR `language_code` = 'fr-fr' LIMIT XX
3 queries
							SELECT `name`
							FROM `hgtXX_hook`
							WHERE `id_hook` = XX LIMIT XX
3 queries
				SELECT tr.*
				FROM `hgtXX_tax_rule` tr
				JOIN `hgtXX_tax_rules_group` trg ON (tr.`id_tax_rules_group` = trg.`id_tax_rules_group`)
				WHERE trg.`active` = XX
				AND tr.`id_country` = XX
				AND tr.`id_tax_rules_group` = XX
				AND tr.`id_state` IN (XX, XX)
				AND ('XX' BETWEEN tr.`zipcode_from` AND tr.`zipcode_to`
					OR (tr.`zipcode_to` = XX AND tr.`zipcode_from` IN(XX, 'XX')))
				ORDER BY tr.`zipcode_from` DESC, tr.`zipcode_to` DESC, tr.`id_state` DESC, tr.`id_country` DESC
2 queries
SELECT lower(name) as name
FROM `hgtXX_hook` h
WHERE (h.active = XX)
2 queries
SELECT h.`name` as hook, m.`id_module`, h.`id_hook`, m.`name` as module
FROM `hgtXX_module` m
 INNER JOIN hgtXX_module_shop module_shop
        ON (module_shop.id_module = m.id_module AND module_shop.id_shop = XX AND module_shop.enable_device & XX)
INNER JOIN `hgtXX_hook_module` `hm` ON hm.`id_module` = m.`id_module`
INNER JOIN `hgtXX_hook` `h` ON hm.`id_hook` = h.`id_hook`
LEFT JOIN `hgtXX_module_group` `mg` ON mg.`id_module` = m.`id_module`
WHERE (h.`name` != "paymentOptions") AND (hm.`id_shop` = XX) AND (mg.id_shop = XX AND  mg.`id_group` IN (XX))
GROUP BY hm.id_hook, hm.id_module
ORDER BY hm.`position`
2 queries
SELECT `name`, `alias` FROM `hgtXX_hook_alias`
2 queries
SELECT `id_hook`, `name` FROM `hgtXX_hook`
2 queries
                SELECT m.`id_module`, m.`name`, ms.`id_module`as `mshop`
                FROM `hgtXX_module` m
                LEFT JOIN `hgtXX_module_shop` ms
                ON m.`id_module` = ms.`id_module`
                AND ms.`id_shop` = XX
2 queries
SELECT name, alias FROM `hgtXX_hook_alias`
2 queries
SELECT * FROM `hgtXX_hook_module_exceptions`
                WHERE `id_shop` IN (XX)
2 queries
SELECT *
FROM `hgtXX_currency` a
LEFT JOIN `hgtXX_currency_lang` `b` ON a.`id_currency` = b.`id_currency` AND b.`id_lang` = XX
LEFT JOIN `hgtXX_currency_shop` `c` ON a.`id_currency` = c.`id_currency` AND c.`id_shop` = XX
WHERE (a.`id_currency` = XX) LIMIT XX
2 queries
SELECT *
FROM `hgtXX_currency` a
LEFT JOIN `hgtXX_currency_shop` `c` ON a.`id_currency` = c.`id_currency` AND c.`id_shop` = XX
WHERE (a.`id_currency` = XX) LIMIT XX
2 queries
SELECT *
							FROM `hgtXX_currency_lang`
							WHERE `id_currency` = XX
2 queries
				SELECT id_shop
				FROM `hgtXX_group_shop`
				WHERE `id_group` = XX
				AND id_shop = XX LIMIT XX
2 queries
		SELECT `id_category`
		FROM `hgtXX_category_shop`
		WHERE `id_category` = XX
		AND `id_shop` = XX LIMIT XX
2 queries
				SELECT ctg.`id_group`
				FROM hgtXX_category_group ctg
				WHERE ctg.`id_category` = XX AND ctg.`id_group` = XX LIMIT XX
2 queries
SELECT *
FROM `hgtXX_shop_url` aXX
2 queries
SELECT XX FROM `hgtXX_cart_rule` WHERE ((date_to >= "XX-XX-XX XX:XX:XX" AND date_to <= "XX-XX-XX XX:XX:XX") OR (date_from >= "XX-XX-XX XX:XX:XX" AND date_from <= "XX-XX-XX XX:XX:XX") OR (date_from < "XX-XX-XX XX:XX:XX" AND date_to > "XX-XX-XX XX:XX:XX")) AND `id_customer` IN (XX,XX) LIMIT XX
2 queries
            SELECT *
            FROM `hgtXX_currency` c
             INNER JOIN hgtXX_currency_shop currency_shop
        ON (currency_shop.id_currency = c.id_currency AND currency_shop.id_shop = XX)
                WHERE c.`deleted` = XX AND c.`active` = XX ORDER BY `iso_code` ASC
2 queries
SELECT buttonXX FROM hgtXX_lgcookieslaw_lang WHERE id_lang = XX LIMIT XX

Tables stress

899 product
899 product_shop
596 specific_price
594 cart_product
592 product_attribute
592 image
592 image_shop
592 product_attribute_shop
440 category_lang
305 product_lang
299 stock_available
297 attribute_group
297 feature
297 feature_shop
297 feature_lang
297 product_attribute_combination
296 specific_price_priority
296 product_group_reduction_cache
296 pack
296 feature_product
296 feature_value_lang
296 image_lang
296 attribute
296 attribute_lang
144 category
120 category_shop
23 category_group
17 module
14 module_shop
12 hook
10 currency
8 currency_shop
7 lang
6 shop_url
5 hook_alias
5 image_type
5 lgcookieslaw_lang
4 shop
4 lang_shop
4 currency_lang
4 cart_rule
3 country
3 hook_module
3 group_shop
3 tax_rule
3 tax_rules_group
2 shop_group
2 configuration
2 country_lang
2 country_shop
2 module_group
2 hook_module_exceptions
2 group
2 category_product
2 cart_rule_lang
2 cms
2 cms_lang
2 cms_shop
2 psgdpr_consent
1 configuration_lang
1 meta
1 meta_lang
1 group_lang
1 feature_flag
1 address_format
1 required_field
1 revslider_sliders
1 carrier
1 carrier_shop
1 carrier_lang
1 carrier_zone
1 carrier_group
1 range_price
1 delivery
1 layered_category
1 attribute_group_shop
1 attribute_group_lang
1 layered_indexable_attribute_group
1 layered_indexable_attribute_group_lang_value
1 layered_indexable_feature
1 layered_indexable_feature_lang_value
1 product_sale
1 layered_filter_block
1 manufacturer
1 tax
1 tax_lang
1 iqit_elementor_category
1 cart_rule_group
1 iqitmegamenu_tabs_shop
1 iqitmegamenu_tabs
1 iqitmegamenu_tabs_lang
1 psgdpr_consent_lang
1 connections

ObjectModel instances

Name Instances Source
Product 312 /classes/Link.php:113 (__construct) [id: 2818]
/classes/Link.php:113 (__construct) [id: 10067]
/classes/Link.php:113 (__construct) [id: 10068]
/classes/Link.php:113 (__construct) [id: 10069]
/classes/Link.php:113 (__construct) [id: 10070]
/classes/Link.php:113 (__construct) [id: 10071]
/classes/Link.php:113 (__construct) [id: 10072]
/classes/Link.php:113 (__construct) [id: 10073]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 7543]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 7542]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 7541]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 7540]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 7539]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 6727]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 5148]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 5147]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 5146]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 5145]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 5144]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 5143]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 5142]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 5141]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 5140]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 5139]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 5138]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 5137]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 5136]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 5135]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 5134]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 5133]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4902]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3743]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3741]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3740]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3587]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2893]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2694]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2660]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2652]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2651]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2623]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2767]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2768]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2769]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2770]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2773]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2774]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2775]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2776]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2766]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2765]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2661]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2690]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2691]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2692]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2693]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2771]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2738]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2764]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2777]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2778]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2779]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2795]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2797]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2798]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2799]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2800]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3178]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3075]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3176]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2794]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2793]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2780]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2781]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3179]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2788]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2789]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2790]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2791]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2792]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3177]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2659]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2635]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2631]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2632]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2633]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2634]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2782]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2636]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2637]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2638]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2639]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2630]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2629]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2628]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3477]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2620]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3459]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2622]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3458]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2624]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2625]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2626]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2627]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2640]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2641]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2656]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2648]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2657]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3456]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2649]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2658]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2647]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2646]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2642]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2643]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2655]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2644]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2645]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3252]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3254]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3255]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3256]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3264]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3265]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3326]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3155]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2818]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2892]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3099]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3107]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3132]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3327]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2490]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2621]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2733]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2650]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2654]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3454]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3455]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3484]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3556]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3557]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3558]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3559]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3584]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3585]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3586]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3639]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3689]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3745]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3746]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3747]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3748]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3749]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3750]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3751]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3752]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3753]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3754]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3755]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3756]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3757]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3763]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3764]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3765]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3766]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3771]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3775]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3776]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3777]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3804]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3805]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3806]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3807]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3808]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3936]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4256]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4574]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4575]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4932]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4934]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4935]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4942]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4943]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4944]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4962]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4963]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4964]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4965]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4966]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 5265]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 5266]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 5267]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 5282]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 5283]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 5284]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 5293]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 5296]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 5335]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 5350]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 5093]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 5589]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 5590]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 5591]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 5592]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 5774]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 5970]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 5971]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 5972]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 5973]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 6047]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 6106]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 6107]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 6108]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 6129]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 6172]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 6173]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 6174]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 6176]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 6177]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 6178]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 6179]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 6180]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 6181]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 6182]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 6183]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 6184]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 6185]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 6186]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 6187]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 6188]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 6189]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 6191]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 6192]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 6193]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 6194]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 6195]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 6499]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 6500]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 6501]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 7938]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 7940]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 7941]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 7942]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 7943]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 7944]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 7945]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 7946]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 7769]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 7779]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 7773]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 8392]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 8393]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 8394]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 8395]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 8396]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 8397]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 8401]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 8417]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 8418]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 8419]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 8420]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 8975]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 8976]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 9055]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 9306]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 9321]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 9323]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 9324]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 9325]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 9535]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 9596]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 9597]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 9598]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 9687]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 9686]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 9688]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 9689]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 9690]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 9691]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 9692]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 9693]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 9694]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 9695]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 9697]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 10067]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 10068]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 10069]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 10070]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 10071]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 10072]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 10073]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 10111]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 10297]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 10298]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 10299]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 10302]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 10303]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 10304]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 10305]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 12552]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 12551]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 11001]
/classes/Link.php:113 (__construct) [id: 2818]
/classes/Link.php:113 (__construct) [id: 10067]
/classes/Link.php:113 (__construct) [id: 10068]
/classes/Link.php:113 (__construct) [id: 10069]
/classes/Link.php:113 (__construct) [id: 10070]
/classes/Link.php:113 (__construct) [id: 10071]
/classes/Link.php:113 (__construct) [id: 10072]
/classes/Link.php:113 (__construct) [id: 10073]
Category 105 /controllers/front/listing/CategoryController.php:78 (__construct) [id: 2]
/controllers/front/listing/CategoryController.php:216 (__construct) [id: 33]
/controllers/front/listing/CategoryController.php:216 (__construct) [id: 34]
/controllers/front/listing/CategoryController.php:216 (__construct) [id: 35]
/controllers/front/listing/CategoryController.php:216 (__construct) [id: 36]
/controllers/front/listing/CategoryController.php:216 (__construct) [id: 37]
/controllers/front/listing/CategoryController.php:216 (__construct) [id: 38]
/controllers/front/listing/CategoryController.php:216 (__construct) [id: 39]
/controllers/front/listing/CategoryController.php:216 (__construct) [id: 40]
/controllers/front/listing/CategoryController.php:216 (__construct) [id: 44]
/controllers/front/listing/CategoryController.php:216 (__construct) [id: 319]
/controllers/front/listing/CategoryController.php:216 (__construct) [id: 11]
/controllers/front/listing/CategoryController.php:216 (__construct) [id: 12]
/controllers/front/listing/CategoryController.php:216 (__construct) [id: 13]
/controllers/front/listing/CategoryController.php:216 (__construct) [id: 18]
/controllers/front/listing/CategoryController.php:216 (__construct) [id: 19]
/controllers/front/listing/CategoryController.php:216 (__construct) [id: 20]
/classes/Meta.php:380 (__construct) [id: 2]
/classes/PrestaShopCollection.php:385 (hydrateCollection) [id: ]
/classes/Link.php:402 (__construct) [id: 2]
/classes/Link.php:402 (__construct) [id: 2]
/modules/iqitmegamenu/iqitmegamenu.php:3282 (__construct) [id: 40]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 40]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 55]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 71]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 165]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 169]
/modules/iqitmegamenu/iqitmegamenu.php:3282 (__construct) [id: 38]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 38]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 50]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 62]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 72]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 172]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 175]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 185]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 186]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 190]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 334]
/modules/iqitmegamenu/iqitmegamenu.php:3282 (__construct) [id: 34]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 344]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 45]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 46]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 54]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 70]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 78]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 199]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 200]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 35]
/modules/iqitmegamenu/iqitmegamenu.php:3282 (__construct) [id: 216]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 44]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 51]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 56]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 192]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 195]
/modules/iqitmegamenu/iqitmegamenu.php:3282 (__construct) [id: 37]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 37]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 48]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 53]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 73]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 74]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 161]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 162]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 163]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 260]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 261]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 262]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 263]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 264]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 265]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 266]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 307]
/modules/iqitmegamenu/iqitmegamenu.php:3282 (__construct) [id: 35]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 35]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 49]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 59]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 60]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 65]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 81]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 82]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 96]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 145]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 196]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 197]
/modules/iqitmegamenu/iqitmegamenu.php:3282 (__construct) [id: 33]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 33]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 61]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 66]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 79]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 80]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 191]
/modules/iqitmegamenu/iqitmegamenu.php:3282 (__construct) [id: 36]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 36]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 42]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 47]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 76]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 77]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 217]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 221]
/modules/iqitmegamenu/iqitmegamenu.php:3282 (__construct) [id: 39]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 39]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 83]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 84]
/classes/Link.php:402 (__construct) [id: 2]
/classes/Link.php:402 (__construct) [id: 2]
/modules/ps_categorytree/ps_categorytree.php:364 (getParentsCategories) [id: 2]
Currency 4 /src/Adapter/Currency/CurrencyDataProvider.php:101 (__construct) [id: 1]
/src/Adapter/Currency/CurrencyDataProvider.php:101 (__construct) [id: 2]
/classes/Tools.php:690 (getCurrencyInstance) [id: 1]
/modules/ps_currencyselector/ps_currencyselector.php:112 (getCurrencies) [id: 2]
Address 4 /classes/shop/Shop.php:486 (__construct) [id: ]
/classes/Product.php:3694 (initialize) [id: ]
/classes/Product.php:3804 (__construct) [id: ]
/classes/Product.php:5964 (__construct) [id: ]
Country 3 /config/config.inc.php:146 (__construct) [id: 8]
/classes/AddressFormat.php:404 (__construct) [id: 8]
/classes/controller/FrontController.php:1779 (__construct) [id: 8]
ShopUrl 2 /classes/PrestaShopCollection.php:385 (hydrateCollection) [id: ]
/classes/PrestaShopCollection.php:385 (hydrateCollection) [id: ]
Language 2 /config/config.inc.php:211 (__construct) [id: 1]
/classes/Tools.php:560 (__construct) [id: 1]
Cart 2 /classes/controller/FrontController.php:467 (__construct) [id: ]
/classes/controller/FrontController.php:541 (__construct) [id: ]
Tax 2 /classes/tax/TaxRulesTaxManager.php:116 (__construct) [id: 1]
/classes/tax/TaxRulesTaxManager.php:116 (__construct) [id: 1]
Carrier 2 /modules/colissimo_simplicite/colissimo_simplicite.php:84 (__construct) [id: 282]
/modules/colissimo_simplicite/colissimo_simplicite.php:1394 (__construct) [id: 282]
Shop 1 /config/config.inc.php:117 (initialize) [id: 1]
CMS 1 /classes/Link.php:555 (__construct) [id: 2]
IqitElementorCategory 1 /modules/iqitelementor/iqitelementor.php:853 (isJustElementor) [id: ]
Risk 1 /classes/controller/FrontController.php:1705 (__construct) [id: ]
State 1 /classes/controller/FrontController.php:1778 (__construct) [id: 0]
AddressFormat 1 /classes/controller/FrontController.php:1773 (generateAddress) [id: ]
Gender 1 /classes/controller/FrontController.php:1702 (__construct) [id: 0]
Group 1 /classes/Cart.php:249 (getCurrent) [id: 1]
Customer 1 /config/config.inc.php:264 (__construct) [id: ]
ShopGroup 1 /classes/shop/Shop.php:561 (__construct) [id: 1]
ConnectionsSource 1 /modules/statsdata/statsdata.php:119 (logHttpReferer) [id: ]

Included Files

# Filename
0 /index.php
1 /config/config.inc.php
2 /config/defines.inc.php
3 /config/autoload.php
4 /vendor/autoload.php
5 /vendor/composer/autoload_real.php
6 /vendor/composer/platform_check.php
7 /vendor/composer/ClassLoader.php
8 /vendor/composer/include_paths.php
9 /vendor/composer/autoload_static.php
10 /vendor/symfony/polyfill-php72/bootstrap.php
11 /vendor/symfony/polyfill-mbstring/bootstrap.php
12 /vendor/symfony/polyfill-mbstring/bootstrap80.php
13 /vendor/symfony/polyfill-intl-normalizer/bootstrap.php
14 /vendor/symfony/polyfill-intl-normalizer/bootstrap80.php
15 /vendor/symfony/polyfill-intl-idn/bootstrap.php
16 /vendor/symfony/deprecation-contracts/function.php
17 /vendor/ralouphie/getallheaders/src/getallheaders.php
18 /vendor/symfony/polyfill-ctype/bootstrap.php
19 /vendor/symfony/polyfill-ctype/bootstrap80.php
20 /vendor/symfony/polyfill-php80/bootstrap.php
21 /vendor/guzzlehttp/promises/src/functions_include.php
22 /vendor/guzzlehttp/promises/src/functions.php
23 /vendor/guzzlehttp/guzzle/src/functions_include.php
24 /vendor/guzzlehttp/guzzle/src/functions.php
25 /vendor/symfony/polyfill-iconv/bootstrap.php
26 /vendor/ezyang/htmlpurifier/library/HTMLPurifier.composer.php
27 /vendor/jakeasmith/http_build_url/src/http_build_url.php
28 /vendor/lcobucci/jwt/compat/class-aliases.php
29 /vendor/lcobucci/jwt/src/Token.php
30 /vendor/lcobucci/jwt/src/Signature.php
31 /vendor/lcobucci/jwt/compat/json-exception-polyfill.php
32 /vendor/lcobucci/jwt/compat/lcobucci-clock-polyfill.php
33 /vendor/swiftmailer/swiftmailer/lib/swift_required.php
34 /vendor/swiftmailer/swiftmailer/lib/classes/Swift.php
35 /vendor/symfony/polyfill-intl-icu/bootstrap.php
36 /vendor/symfony/polyfill-php73/bootstrap.php
37 /vendor/symfony/polyfill-php81/bootstrap.php
38 /vendor/api-platform/core/src/deprecation.php
39 /vendor/api-platform/core/src/Api/FilterInterface.php
40 /vendor/api-platform/core/src/Api/ResourceClassResolverInterface.php
41 /vendor/api-platform/core/src/deprecated_interfaces.php
42 /vendor/api-platform/core/src/Metadata/Property/Factory/PropertyNameCollectionFactoryInterface.php
43 /vendor/api-platform/core/src/Metadata/Resource/Factory/ResourceNameCollectionFactoryInterface.php
44 /vendor/api-platform/core/src/Metadata/Extractor/ResourceExtractorInterface.php
45 /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/DateFilterInterface.php
46 /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/ExistsFilterInterface.php
47 /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/OrderFilterInterface.php
48 /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/RangeFilterInterface.php
49 /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/SearchFilterInterface.php
50 /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Extension/AggregationCollectionExtensionInterface.php
51 /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Extension/AggregationItemExtensionInterface.php
52 /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Extension/AggregationResultCollectionExtensionInterface.php
53 /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Extension/AggregationResultItemExtensionInterface.php
54 /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Filter/FilterInterface.php
55 /vendor/api-platform/core/src/Doctrine/Orm/QueryAwareInterface.php
56 /vendor/api-platform/core/src/Doctrine/Orm/Util/QueryNameGeneratorInterface.php
57 /vendor/api-platform/core/src/Elasticsearch/Metadata/Document/Factory/DocumentMetadataFactoryInterface.php
58 /vendor/api-platform/core/src/Symfony/Validator/ValidationGroupsGeneratorInterface.php
59 /vendor/api-platform/core/src/Symfony/Validator/Exception/ConstraintViolationListAwareExceptionInterface.php
60 /vendor/api-platform/core/src/Exception/ExceptionInterface.php
61 /vendor/api-platform/core/src/Core/Bridge/Symfony/Validator/Metadata/Property/Restriction/PropertySchemaRestrictionMetadataInterface.php
62 /vendor/api-platform/core/src/State/Pagination/PaginatorInterface.php
63 /vendor/api-platform/core/src/State/Pagination/PartialPaginatorInterface.php
64 /vendor/api-platform/core/src/Documentation/DocumentationInterface.php
65 /vendor/api-platform/core/src/JsonLd/AnonymousContextBuilderInterface.php
66 /vendor/api-platform/core/src/JsonLd/ContextBuilderInterface.php
67 /vendor/api-platform/core/src/Core/JsonSchema/SchemaFactoryInterface.php
68 /vendor/api-platform/core/src/JsonSchema/TypeFactoryInterface.php
69 /vendor/api-platform/core/src/OpenApi/Factory/OpenApiFactoryInterface.php
70 /vendor/api-platform/core/src/PathResolver/OperationPathResolverInterface.php
71 /vendor/api-platform/core/src/Symfony/Security/ResourceAccessCheckerInterface.php
72 /vendor/api-platform/core/src/Serializer/Filter/FilterInterface.php
73 /vendor/api-platform/core/src/Serializer/SerializerContextBuilderInterface.php
74 /vendor/api-platform/core/src/Validator/ValidatorInterface.php
75 /vendor/api-platform/core/src/Api/UrlGeneratorInterface.php
76 /vendor/api-platform/core/src/GraphQl/ExecutorInterface.php
77 /vendor/api-platform/core/src/GraphQl/Error/ErrorHandlerInterface.php
78 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/ValidateStageInterface.php
79 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/ReadStageInterface.php
80 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/SecurityPostDenormalizeStageInterface.php
81 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/SecurityStageInterface.php
82 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/WriteStageInterface.php
83 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/SerializeStageInterface.php
84 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/DeserializeStageInterface.php
85 /vendor/api-platform/core/src/GraphQl/Resolver/QueryItemResolverInterface.php
86 /vendor/api-platform/core/src/GraphQl/Resolver/QueryCollectionResolverInterface.php
87 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Factory/ResolverFactoryInterface.php
88 /vendor/api-platform/core/src/GraphQl/Resolver/MutationResolverInterface.php
89 /vendor/api-platform/core/src/Core/GraphQl/Subscription/MercureSubscriptionIriGeneratorInterface.php
90 /vendor/api-platform/core/src/Core/GraphQl/Subscription/SubscriptionIdentifierGeneratorInterface.php
91 /vendor/api-platform/core/src/Core/GraphQl/Subscription/SubscriptionManagerInterface.php
92 /vendor/api-platform/core/src/Core/GraphQl/Serializer/SerializerContextBuilderInterface.php
93 /vendor/api-platform/core/src/GraphQl/Type/TypesFactoryInterface.php
94 /vendor/api-platform/core/src/GraphQl/Type/Definition/TypeInterface.php
95 /vendor/api-platform/core/src/GraphQl/Type/TypesContainerInterface.php
96 /vendor/psr/container/src/ContainerInterface.php
97 /vendor/api-platform/core/src/Operation/PathSegmentNameGeneratorInterface.php
98 /vendor/ircmaxell/password-compat/lib/password.php
99 /vendor/martinlindhe/php-mb-helpers/src/mb_helpers.php
100 /vendor/prestashop/laminas-code-lts/polyfill/ReflectionEnumPolyfill.php
101 /src/Core/Version.php
102 /config/alias.php
103 /vendor/prestashop/autoload/src/PrestashopAutoload.php
104 /vendor/prestashop/autoload/src/LegacyClassLoader.php
105 /vendor/symfony/symfony/src/Symfony/Component/Filesystem/Filesystem.php
106 /vendor/prestashop/autoload/src/Autoloader.php
107 /config/bootstrap.php
108 /src/Core/ContainerBuilder.php
109 /src/Core/Foundation/IoC/Container.php
110 /src/Adapter/ServiceLocator.php
111 /var/cache/prod/appParameters.php
114 /var/cache/prod/class_index.php
115 /classes/controller/Controller.php
117 /classes/ObjectModel.php
118 /src/Core/Foundation/Database/EntityInterface.php
120 /classes/db/Db.php
122 /classes/Hook.php
124 /classes/module/Module.php
125 /src/Core/Module/Legacy/ModuleInterface.php
127 /classes/Tools.php
128 /classes/Context.php
129 /classes/shop/Shop.php
130 /src/Core/Security/PasswordGenerator.php
131 /classes/db/DbPDO.php
132 /classes/AddressFormat.php
133 /classes/Configuration.php
134 /classes/Validate.php
135 /classes/cache/Cache.php
136 /src/Adapter/EntityMapper.php
137 /classes/db/DbQuery.php
138 /src/Core/Addon/Theme/ThemeManagerBuilder.php
139 /vendor/psr/log/Psr/Log/NullLogger.php
140 /vendor/psr/log/Psr/Log/AbstractLogger.php
141 /vendor/psr/log/Psr/Log/LoggerInterface.php
142 /src/Adapter/Configuration.php
143 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/ParameterBag.php
144 /src/Core/Domain/Configuration/ShopConfigurationInterface.php
145 /src/Core/ConfigurationInterface.php
146 /src/Core/Addon/Theme/ThemeRepository.php
147 /src/Core/Addon/AddonRepositoryInterface.php
148 /src/Core/Domain/Shop/ValueObject/ShopConstraint.php
149 /src/Core/Addon/Theme/Theme.php
150 /src/Core/Addon/AddonInterface.php
151 /src/Core/Util/ArrayFinder.php
152 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyAccess.php
153 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyAccessorBuilder.php
154 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyAccessor.php
155 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyAccessorInterface.php
156 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyPath.php
157 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyPathInterface.php
158 /config/defines_uri.inc.php
159 /classes/Language.php
160 /src/Core/Language/LanguageInterface.php
161 /classes/Country.php
162 /classes/PrestaShopCollection.php
163 /classes/shop/ShopGroup.php
164 /classes/Cookie.php
165 /classes/PhpEncryption.php
166 /classes/PhpEncryptionEngine.php
167 /vendor/defuse/php-encryption/src/Key.php
168 /vendor/defuse/php-encryption/src/Encoding.php
169 /vendor/defuse/php-encryption/src/Core.php
170 /vendor/defuse/php-encryption/src/Crypto.php
171 /vendor/defuse/php-encryption/src/KeyOrPassword.php
172 /vendor/defuse/php-encryption/src/RuntimeTests.php
173 /vendor/defuse/php-encryption/src/DerivedKeys.php
174 /vendor/defuse/php-encryption/src/Exception/WrongKeyOrModifiedCiphertextException.php
175 /vendor/defuse/php-encryption/src/Exception/CryptoException.php
176 /src/Core/Session/SessionHandler.php
177 /src/Core/Session/SessionHandlerInterface.php
178 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Session.php
179 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Attribute/AttributeBag.php
180 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Attribute/AttributeBagInterface.php
181 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/SessionBagInterface.php
182 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Flash/FlashBag.php
183 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Flash/FlashBagInterface.php
184 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/SessionBagProxy.php
185 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/SessionInterface.php
186 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/PhpBridgeSessionStorage.php
187 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/NativeSessionStorage.php
188 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/MetadataBag.php
189 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/Handler/StrictSessionHandler.php
190 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/Handler/AbstractSessionHandler.php
191 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/Proxy/SessionHandlerProxy.php
192 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/Proxy/AbstractProxy.php
193 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/SessionStorageInterface.php
194 /config/smarty.config.inc.php
195 /vendor/smarty/smarty/libs/Smarty.class.php
196 /vendor/smarty/smarty/libs/functions.php
197 /vendor/smarty/smarty/libs/Autoloader.php
198 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_data.php
199 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_extension_handler.php
200 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php
201 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php
202 /vendor/smarty/smarty/libs/sysplugins/smarty_resource.php
203 /vendor/smarty/smarty/libs/sysplugins/smarty_variable.php
204 /vendor/smarty/smarty/libs/sysplugins/smarty_template_source.php
205 /vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php
206 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_resource_file.php
207 /config/smartyfront.config.inc.php
208 /classes/Smarty/SmartyResourceModule.php
209 /vendor/smarty/smarty/libs/sysplugins/smarty_resource_custom.php
210 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_method_registerresource.php
211 /classes/Smarty/SmartyResourceParent.php
212 /classes/Smarty/SmartyLazyRegister.php
213 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_method_registerplugin.php
214 /vendor/smarty/smarty/libs/plugins/modifier.truncate.php
215 /classes/Customer.php
216 /classes/Group.php
217 /classes/Link.php
218 /classes/shop/ShopUrl.php
219 /classes/Dispatcher.php
220 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Request.php
221 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/AcceptHeader.php
222 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/AcceptHeaderItem.php
223 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/FileBag.php
224 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/HeaderBag.php
225 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/HeaderUtils.php
226 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/ServerBag.php
227 /src/Adapter/SymfonyContainer.php
228 /vendor/mobiledetect/mobiledetectlib/Mobile_Detect.php
229 /config/db_slave_server.inc.php
230 /src/Adapter/ContainerBuilder.php
231 /src/Adapter/Environment.php
232 /src/Core/EnvironmentInterface.php
233 /vendor/symfony/symfony/src/Symfony/Component/Config/ConfigCache.php
234 /vendor/symfony/symfony/src/Symfony/Component/Config/ResourceCheckerConfigCache.php
235 /vendor/symfony/symfony/src/Symfony/Component/Config/ConfigCacheInterface.php
236 /vendor/symfony/symfony/src/Symfony/Component/Cache/DoctrineProvider.php
237 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/CacheProvider.php
238 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/Cache.php
239 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/FlushableCache.php
240 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/ClearableCache.php
241 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/MultiOperationCache.php
242 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/MultiGetCache.php
243 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/MultiDeleteCache.php
244 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/MultiPutCache.php
245 /vendor/symfony/symfony/src/Symfony/Component/Cache/PruneableInterface.php
246 /vendor/symfony/symfony/src/Symfony/Component/Cache/ResettableInterface.php
247 /vendor/symfony/contracts/Service/ResetInterface.php
248 /vendor/symfony/symfony/src/Symfony/Component/Cache/Adapter/ArrayAdapter.php
249 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/ArrayTrait.php
250 /vendor/psr/log/Psr/Log/LoggerAwareTrait.php
251 /vendor/symfony/symfony/src/Symfony/Component/Cache/Adapter/AdapterInterface.php
252 /vendor/symfony/symfony/src/Symfony/Component/Cache/CacheItem.php
253 /vendor/symfony/contracts/Cache/ItemInterface.php
254 /vendor/psr/cache/src/CacheItemInterface.php
255 /vendor/psr/cache/src/CacheItemPoolInterface.php
256 /vendor/symfony/contracts/Cache/CacheInterface.php
257 /vendor/psr/log/Psr/Log/LoggerAwareInterface.php
258 /vendor/doctrine/orm/lib/Doctrine/ORM/Tools/Setup.php
259 /vendor/doctrine/deprecations/lib/Doctrine/Deprecations/Deprecation.php
260 /vendor/doctrine/orm/lib/Doctrine/ORM/Configuration.php
261 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Configuration.php
262 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/Psr6/CacheAdapter.php
263 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/Psr6/DoctrineProvider.php
264 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/AnnotationReader.php
265 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/Reader.php
266 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/AnnotationRegistry.php
267 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Driver/DoctrineAnnotations.php
268 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Annotation.php
269 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Entity.php
270 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Embeddable.php
271 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Embedded.php
272 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/MappedSuperclass.php
273 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/InheritanceType.php
274 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/DiscriminatorColumn.php
275 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/DiscriminatorMap.php
276 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Id.php
277 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/GeneratedValue.php
278 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Version.php
279 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/JoinColumn.php
280 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/JoinColumns.php
281 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Column.php
282 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/OneToOne.php
283 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/OneToMany.php
284 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/ManyToOne.php
285 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/ManyToMany.php
286 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Table.php
287 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/UniqueConstraint.php
288 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Index.php
289 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/JoinTable.php
290 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/SequenceGenerator.php
291 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/CustomIdGenerator.php
292 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/ChangeTrackingPolicy.php
293 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/OrderBy.php
294 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/NamedQueries.php
295 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/NamedQuery.php
296 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/HasLifecycleCallbacks.php
297 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PrePersist.php
298 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PostPersist.php
299 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PreUpdate.php
300 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PostUpdate.php
301 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PreRemove.php
302 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PostRemove.php
303 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PostLoad.php
304 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PreFlush.php
305 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/FieldResult.php
306 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/ColumnResult.php
307 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/EntityResult.php
308 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/NamedNativeQuery.php
309 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/NamedNativeQueries.php
310 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/SqlResultSetMapping.php
311 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/SqlResultSetMappings.php
312 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/AssociationOverride.php
313 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/AssociationOverrides.php
314 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/AttributeOverride.php
315 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/AttributeOverrides.php
316 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/EntityListeners.php
317 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Cache.php
318 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/SimpleAnnotationReader.php
319 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/DocParser.php
320 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/DocLexer.php
321 /vendor/doctrine/lexer/lib/Doctrine/Common/Lexer/AbstractLexer.php
322 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/Annotation/Target.php
323 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Driver/AnnotationDriver.php
324 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Driver/CompatibilityAnnotationDriver.php
325 /vendor/doctrine/persistence/src/Persistence/Mapping/Driver/MappingDriver.php
326 /vendor/doctrine/persistence/src/Persistence/Mapping/Driver/ColocatedMappingDriver.php
327 /var/cache/prod/FrontContainer.php
328 /src/Adapter/Container/LegacyContainer.php
329 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/Container.php
330 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/Argument/RewindableGenerator.php
331 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/Argument/ServiceLocator.php
332 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/ServiceLocator.php
333 /vendor/symfony/contracts/Service/ServiceLocatorTrait.php
334 /vendor/psr/container/src/ContainerExceptionInterface.php
335 /vendor/psr/container/src/NotFoundExceptionInterface.php
336 /vendor/symfony/contracts/Service/ServiceProviderInterface.php
337 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/ResettableContainerInterface.php
338 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/ContainerInterface.php
339 /src/Adapter/Container/LegacyContainerInterface.php
340 /modules/blockwishlist/vendor/autoload.php
341 /modules/blockwishlist/vendor/composer/autoload_real.php
342 /modules/blockwishlist/vendor/composer/autoload_static.php
343 /modules/contactform/vendor/autoload.php
344 /modules/contactform/vendor/composer/autoload_real.php
345 /modules/contactform/vendor/composer/autoload_static.php
346 /modules/dashactivity/vendor/autoload.php
347 /modules/dashactivity/vendor/composer/autoload_real.php
348 /modules/dashactivity/vendor/composer/autoload_static.php
349 /modules/dashtrends/vendor/autoload.php
350 /modules/dashtrends/vendor/composer/autoload_real.php
351 /modules/dashtrends/vendor/composer/autoload_static.php
352 /modules/dashgoals/vendor/autoload.php
353 /modules/dashgoals/vendor/composer/autoload_real.php
354 /modules/dashgoals/vendor/composer/autoload_static.php
355 /modules/dashproducts/vendor/autoload.php
356 /modules/dashproducts/vendor/composer/autoload_real.php
357 /modules/dashproducts/vendor/composer/autoload_static.php
358 /modules/graphnvd3/vendor/autoload.php
359 /modules/graphnvd3/vendor/composer/autoload_real.php
360 /modules/graphnvd3/vendor/composer/autoload_static.php
361 /modules/gridhtml/vendor/autoload.php
362 /modules/gridhtml/vendor/composer/autoload_real.php
363 /modules/gridhtml/vendor/composer/autoload_static.php
364 /modules/gsitemap/vendor/autoload.php
365 /modules/gsitemap/vendor/composer/autoload_real.php
366 /modules/gsitemap/vendor/composer/autoload_static.php
367 /modules/pagesnotfound/vendor/autoload.php
368 /modules/pagesnotfound/vendor/composer/autoload_real.php
369 /modules/pagesnotfound/vendor/composer/autoload_static.php
370 /modules/productcomments/vendor/autoload.php
371 /modules/productcomments/vendor/composer/autoload_real.php
372 /modules/productcomments/vendor/composer/autoload_static.php
373 /modules/ps_categorytree/vendor/autoload.php
374 /modules/ps_categorytree/vendor/composer/autoload_real.php
375 /modules/ps_categorytree/vendor/composer/autoload_static.php
376 /modules/ps_checkpayment/vendor/autoload.php
377 /modules/ps_checkpayment/vendor/composer/autoload_real.php
378 /modules/ps_checkpayment/vendor/composer/autoload_static.php
379 /modules/ps_contactinfo/vendor/autoload.php
380 /modules/ps_contactinfo/vendor/composer/autoload_real.php
381 /modules/ps_contactinfo/vendor/composer/autoload_static.php
382 /modules/ps_crossselling/vendor/autoload.php
383 /modules/ps_crossselling/vendor/composer/autoload_real.php
384 /modules/ps_crossselling/vendor/composer/autoload_static.php
385 /modules/ps_currencyselector/vendor/autoload.php
386 /modules/ps_currencyselector/vendor/composer/autoload_real.php
387 /modules/ps_currencyselector/vendor/composer/autoload_static.php
388 /modules/ps_customeraccountlinks/vendor/autoload.php
389 /modules/ps_customeraccountlinks/vendor/composer/autoload_real.php
390 /modules/ps_customeraccountlinks/vendor/composer/autoload_static.php
391 /modules/ps_customtext/vendor/autoload.php
392 /modules/ps_customtext/vendor/composer/autoload_real.php
393 /modules/ps_customtext/vendor/composer/autoload_static.php
394 /modules/ps_dataprivacy/vendor/autoload.php
395 /modules/ps_dataprivacy/vendor/composer/autoload_real.php
396 /modules/ps_dataprivacy/vendor/composer/autoload_static.php
397 /modules/ps_emailsubscription/vendor/autoload.php
398 /modules/ps_emailsubscription/vendor/composer/autoload_real.php
399 /modules/ps_emailsubscription/vendor/composer/autoload_static.php
400 /modules/ps_faviconnotificationbo/vendor/autoload.php
401 /modules/ps_faviconnotificationbo/vendor/composer/autoload_real.php
402 /modules/ps_faviconnotificationbo/vendor/composer/autoload_static.php
403 /modules/ps_featuredproducts/vendor/autoload.php
404 /modules/ps_featuredproducts/vendor/composer/autoload_real.php
405 /modules/ps_featuredproducts/vendor/composer/autoload_static.php
406 /modules/ps_imageslider/vendor/autoload.php
407 /modules/ps_imageslider/vendor/composer/autoload_real.php
408 /modules/ps_imageslider/vendor/composer/autoload_static.php
409 /modules/ps_languageselector/vendor/autoload.php
410 /modules/ps_languageselector/vendor/composer/autoload_real.php
411 /modules/ps_languageselector/vendor/composer/autoload_static.php
412 /modules/ps_linklist/vendor/autoload.php
413 /modules/ps_linklist/vendor/composer/autoload_real.php
414 /modules/ps_linklist/vendor/composer/autoload_static.php
415 /modules/ps_mainmenu/vendor/autoload.php
416 /modules/ps_mainmenu/vendor/composer/autoload_real.php
417 /modules/ps_mainmenu/vendor/composer/autoload_static.php
418 /modules/ps_searchbar/vendor/autoload.php
419 /modules/ps_searchbar/vendor/composer/autoload_real.php
420 /modules/ps_searchbar/vendor/composer/platform_check.php
421 /modules/ps_searchbar/vendor/composer/autoload_static.php
422 /modules/ps_sharebuttons/vendor/autoload.php
423 /modules/ps_sharebuttons/vendor/composer/autoload_real.php
424 /modules/ps_sharebuttons/vendor/composer/platform_check.php
425 /modules/ps_sharebuttons/vendor/composer/autoload_static.php
426 /modules/ps_shoppingcart/vendor/autoload.php
427 /modules/ps_shoppingcart/vendor/composer/autoload_real.php
428 /modules/ps_shoppingcart/vendor/composer/autoload_static.php
429 /modules/ps_socialfollow/vendor/autoload.php
430 /modules/ps_socialfollow/vendor/composer/autoload_real.php
431 /modules/ps_socialfollow/vendor/composer/autoload_static.php
432 /modules/ps_themecusto/vendor/autoload.php
433 /modules/ps_themecusto/vendor/composer/autoload_real.php
434 /modules/ps_themecusto/vendor/composer/autoload_static.php
435 /modules/ps_wirepayment/vendor/autoload.php
436 /modules/ps_wirepayment/vendor/composer/autoload_real.php
437 /modules/ps_wirepayment/vendor/composer/autoload_static.php
438 /modules/statsbestcustomers/vendor/autoload.php
439 /modules/statsbestcustomers/vendor/composer/autoload_real.php
440 /modules/statsbestcustomers/vendor/composer/autoload_static.php
441 /modules/statsbestsuppliers/vendor/autoload.php
442 /modules/statsbestsuppliers/vendor/composer/autoload_real.php
443 /modules/statsbestsuppliers/vendor/composer/autoload_static.php
444 /modules/statscatalog/vendor/autoload.php
445 /modules/statscatalog/vendor/composer/autoload_real.php
446 /modules/statscatalog/vendor/composer/autoload_static.php
447 /modules/statscheckup/vendor/autoload.php
448 /modules/statscheckup/vendor/composer/autoload_real.php
449 /modules/statscheckup/vendor/composer/autoload_static.php
450 /modules/statsdata/vendor/autoload.php
451 /modules/statsdata/vendor/composer/autoload_real.php
452 /modules/statsdata/vendor/composer/autoload_static.php
453 /modules/statsproduct/vendor/autoload.php
454 /modules/statsproduct/vendor/composer/autoload_real.php
455 /modules/statsproduct/vendor/composer/autoload_static.php
456 /modules/statsstock/vendor/autoload.php
457 /modules/statsstock/vendor/composer/autoload_real.php
458 /modules/statsstock/vendor/composer/autoload_static.php
459 /modules/psgdpr/vendor/autoload.php
460 /modules/psgdpr/vendor/composer/autoload_real.php
461 /modules/psgdpr/vendor/composer/autoload_static.php
462 /modules/blockreassurance/vendor/autoload.php
463 /modules/blockreassurance/vendor/composer/autoload_real.php
464 /modules/blockreassurance/vendor/composer/autoload_static.php
465 /modules/ps_facetedsearch/vendor/autoload.php
466 /modules/ps_facetedsearch/vendor/composer/autoload_real.php
467 /modules/ps_facetedsearch/vendor/composer/autoload_static.php
468 /modules/nkmgls/vendor/autoload.php
469 /modules/nkmgls/vendor/composer/autoload_real.php
470 /modules/nkmgls/vendor/composer/platform_check.php
471 /modules/nkmgls/vendor/composer/autoload_static.php
472 /modules/nkmgls/vendor/nukium/gls-prestashop/lib/NkmHelper.php
473 /modules/paybox/vendor/autoload.php
474 /modules/paybox/vendor/composer/autoload_real.php
475 /modules/paybox/vendor/composer/platform_check.php
476 /modules/paybox/vendor/composer/autoload_static.php
477 /modules/paybox/vendor/clue/stream-filter/src/functions_include.php
478 /modules/paybox/vendor/clue/stream-filter/src/functions.php
479 /modules/paybox/vendor/php-http/message/src/filters.php
480 /modules/iqitsociallogin/vendor/autoload.php
481 /modules/iqitsociallogin/vendor/composer/autoload_real.php
482 /modules/iqitsociallogin/vendor/composer/platform_check.php
483 /modules/iqitsociallogin/vendor/composer/autoload_static.php
484 /modules/ps_eventbus/vendor/autoload.php
485 /modules/ps_eventbus/vendor/composer/autoload_real.php
486 /modules/ps_eventbus/vendor/composer/autoload_static.php
487 /modules/ps_accounts/vendor/autoload.php
488 /modules/ps_accounts/vendor/composer/autoload_real.php
489 /modules/ps_accounts/vendor/composer/platform_check.php
490 /modules/ps_accounts/vendor/composer/autoload_static.php
491 /modules/ps_accounts/vendor/paragonie/random_compat/lib/random.php
492 /modules/ps_accounts/vendor/symfony/polyfill-ctype/bootstrap.php
493 /modules/ps_accounts/vendor/lcobucci/jwt/compat/class-aliases.php
494 /modules/ps_accounts/vendor/lcobucci/jwt/src/Token.php
495 /modules/ps_accounts/vendor/lcobucci/jwt/src/Signature.php
496 /modules/ps_accounts/vendor/lcobucci/jwt/compat/json-exception-polyfill.php
497 /modules/ps_accounts/vendor/lcobucci/jwt/compat/lcobucci-clock-polyfill.php
498 /modules/ps_accounts/vendor/phpseclib/phpseclib/phpseclib/bootstrap.php
499 /modules/ps_accounts/vendor/ramsey/uuid/src/functions.php
500 /modules/ps_accounts/vendor/segmentio/analytics-php/lib/Segment.php
501 /modules/ps_accounts/vendor/segmentio/analytics-php/lib/Segment/Client.php
502 /modules/ps_accounts/vendor/segmentio/analytics-php/lib/Segment/Consumer.php
503 /modules/ps_accounts/vendor/segmentio/analytics-php/lib/Segment/QueueConsumer.php
504 /modules/ps_accounts/vendor/segmentio/analytics-php/lib/Segment/Consumer/File.php
505 /modules/ps_accounts/vendor/segmentio/analytics-php/lib/Segment/Consumer/ForkCurl.php
506 /modules/ps_accounts/vendor/segmentio/analytics-php/lib/Segment/Consumer/LibCurl.php
507 /modules/ps_accounts/vendor/segmentio/analytics-php/lib/Segment/Consumer/Socket.php
508 /modules/ps_accounts/vendor/segmentio/analytics-php/lib/Segment/Version.php
509 /modules/ps_emailalerts/vendor/autoload.php
510 /modules/ps_emailalerts/vendor/composer/autoload_real.php
511 /modules/ps_emailalerts/vendor/composer/autoload_static.php
512 /modules/ps_checkout/vendor/autoload.php
513 /modules/ps_checkout/vendor/composer/autoload_real.php
514 /modules/ps_checkout/vendor/composer/platform_check.php
515 /modules/ps_checkout/vendor/composer/autoload_static.php
516 /modules/ps_checkout/vendor/ramsey/uuid/src/functions.php
517 /modules/autoupgrade/vendor/autoload.php
518 /modules/autoupgrade/vendor/composer/autoload_real.php
519 /modules/autoupgrade/vendor/composer/autoload_static.php
520 /modules/sendinblue/vendor/autoload.php
521 /modules/sendinblue/vendor/composer/autoload_real.php
522 /modules/sendinblue/vendor/composer/platform_check.php
523 /modules/sendinblue/vendor/composer/autoload_static.php
524 /src/Core/Hook/HookModuleFilter.php
525 /src/Core/Hook/HookModuleFilterInterface.php
526 /modules/ps_checkout/ps_checkout.php
527 /classes/PaymentModule.php
528 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_method_createdata.php
529 /vendor/smarty/smarty/libs/sysplugins/smarty_data.php
530 /classes/Translate.php
531 /modules/ps_checkout/translations/fr.php
532 /src/PrestaShopBundle/Translation/TranslatorComponent.php
533 /vendor/symfony/symfony/src/Symfony/Component/Translation/Translator.php
534 /vendor/symfony/symfony/src/Symfony/Component/Translation/TranslatorInterface.php
535 /vendor/symfony/contracts/Translation/LocaleAwareInterface.php
536 /vendor/symfony/contracts/Translation/TranslatorInterface.php
537 /vendor/symfony/symfony/src/Symfony/Component/Translation/TranslatorBagInterface.php
538 /src/PrestaShopBundle/Translation/PrestaShopTranslatorTrait.php
539 /src/PrestaShopBundle/Translation/TranslatorLanguageTrait.php
540 /src/PrestaShopBundle/Translation/TranslatorInterface.php
541 /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/MessageFormatter.php
542 /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/IntlFormatter.php
543 /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/IntlFormatterInterface.php
544 /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/MessageFormatterInterface.php
545 /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/ChoiceMessageFormatterInterface.php
546 /vendor/symfony/symfony/src/Symfony/Component/Translation/IdentityTranslator.php
547 /vendor/symfony/contracts/Translation/TranslatorTrait.php
548 /vendor/symfony/symfony/src/Symfony/Component/Config/ConfigCacheFactory.php
549 /vendor/symfony/symfony/src/Symfony/Component/Config/ConfigCacheFactoryInterface.php
550 /var/cache/prod/translations/catalogue.fr-FR.NXhscRe.php
551 /vendor/symfony/symfony/src/Symfony/Component/Translation/MessageCatalogue.php
552 /vendor/symfony/symfony/src/Symfony/Component/Translation/MessageCatalogueInterface.php
553 /vendor/symfony/symfony/src/Symfony/Component/Translation/MetadataAwareInterface.php
554 /controllers/front/listing/CategoryController.php
555 /classes/controller/ProductListingFrontController.php
556 /classes/controller/ProductPresentingFrontController.php
557 /classes/controller/FrontController.php
558 /src/Adapter/Presenter/Object/ObjectPresenter.php
559 /src/Adapter/Presenter/PresenterInterface.php
560 /src/Adapter/Presenter/Cart/CartPresenter.php
561 /src/Adapter/Image/ImageRetriever.php
562 /classes/tax/TaxConfiguration.php
563 /classes/Smarty/TemplateFinder.php
564 /classes/assets/StylesheetManager.php
565 /classes/assets/AbstractAssetManager.php
566 /src/Adapter/Assets/AssetUrlGeneratorTrait.php
567 /classes/assets/JavascriptManager.php
568 /classes/assets/CccReducer.php
569 /modules/iqitthemeeditor/iqitthemeeditor.php
570 /modules/iqitthemeeditor/src/IqitSmartyModifiers.php
571 /modules/iqitthemeeditor/translations/fr.php
572 /classes/Category.php
573 /classes/webservice/WebserviceRequest.php
574 /src/Core/Localization/Locale/Repository.php
575 /src/Core/Localization/Locale/RepositoryInterface.php
576 /src/Core/Localization/CLDR/LocaleRepository.php
577 /src/Core/Localization/CLDR/LocaleDataSource.php
578 /src/Core/Localization/CLDR/DataLayer/LocaleCache.php
579 /src/Core/Data/Layer/AbstractDataLayer.php
580 /src/Core/Localization/CLDR/LocaleDataLayerInterface.php
581 /vendor/symfony/symfony/src/Symfony/Component/Cache/Adapter/FilesystemAdapter.php
582 /vendor/symfony/symfony/src/Symfony/Component/Cache/Adapter/AbstractAdapter.php
583 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/AbstractAdapterTrait.php
584 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/AbstractTrait.php
585 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/ContractsTrait.php
586 /vendor/symfony/contracts/Cache/CacheTrait.php
587 /vendor/psr/cache/src/InvalidArgumentException.php
588 /vendor/psr/cache/src/CacheException.php
589 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/FilesystemTrait.php
590 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/FilesystemCommonTrait.php
591 /vendor/symfony/symfony/src/Symfony/Component/Cache/Marshaller/DefaultMarshaller.php
592 /vendor/symfony/symfony/src/Symfony/Component/Cache/Marshaller/MarshallerInterface.php
593 /src/Core/Localization/CLDR/DataLayer/LocaleReference.php
594 /src/Core/Localization/CLDR/Reader.php
595 /src/Core/Localization/CLDR/ReaderInterface.php
596 /src/Core/Localization/Currency/Repository.php
597 /src/Core/Localization/Currency/RepositoryInterface.php
598 /src/Core/Localization/Currency/CurrencyDataSource.php
599 /src/Core/Localization/Currency/DataSourceInterface.php
600 /src/Core/Localization/Currency/DataLayer/CurrencyCache.php
601 /src/Core/Localization/Currency/CurrencyDataLayerInterface.php
602 /src/Core/Localization/Currency/DataLayer/CurrencyDatabase.php
603 /src/Adapter/Currency/CurrencyDataProvider.php
604 /src/Core/Currency/CurrencyDataProviderInterface.php
605 /src/Adapter/LegacyContext.php
606 /src/Adapter/Tools.php
607 /src/Core/Localization/Currency/DataLayer/CurrencyReference.php
608 /src/Core/Localization/Currency/DataLayer/CurrencyInstalled.php
609 /vendor/prestashop/decimal/src/Operation/Rounding.php
610 /src/Core/Localization/Locale.php
611 /src/Core/Localization/LocaleInterface.php
612 /src/Core/Localization/Specification/Price.php
613 /src/Core/Localization/Specification/Number.php
614 /src/Core/Localization/Specification/NumberInterface.php
615 /src/Core/Localization/Specification/Factory.php
616 /src/Core/Localization/CLDR/LocaleData.php
617 /src/Core/Localization/CLDR/NumberSymbolsData.php
618 /src/Core/Localization/CLDR/CurrencyData.php
619 /src/Core/Localization/CLDR/Locale.php
620 /src/Core/Localization/CLDR/LocaleInterface.php
621 /src/Core/Localization/Specification/NumberSymbolList.php
622 /classes/Currency.php
623 /src/Core/Localization/Currency/LocalizedCurrencyId.php
624 /src/Core/Localization/Currency/CurrencyData.php
625 /src/Core/Localization/Currency/CurrencyCollection.php
626 /src/Core/Localization/Currency.php
627 /src/Core/Localization/CurrencyInterface.php
628 /src/Core/Localization/Specification/NumberCollection.php
629 /src/Core/Localization/Number/Formatter.php
630 /classes/Cart.php
631 /src/Adapter/AddressFactory.php
632 /classes/CartRule.php
633 /classes/Product.php
634 /src/Core/Domain/Product/ValueObject/RedirectType.php
635 /src/Core/Util/DateTime/DateTime.php
636 /src/Core/Domain/Product/Stock/ValueObject/OutOfStockType.php
637 /src/Core/Domain/Product/Pack/ValueObject/PackStockType.php
638 /src/Core/Domain/Product/ValueObject/ProductType.php
639 /src/Core/Domain/Product/ValueObject/Reference.php
640 /src/Core/Domain/Product/ValueObject/Ean13.php
641 /src/Core/Domain/Product/ValueObject/Isbn.php
642 /src/Core/Domain/Product/ValueObject/Upc.php
643 /src/Core/Domain/Product/ProductSettings.php
644 /src/Core/Image/ImageFormatConfiguration.php
645 /src/Core/Image/ImageFormatConfigurationInterface.php
646 /classes/FeatureFlag.php
647 /src/Core/FeatureFlag/FeatureFlagSettings.php
648 /classes/ImageType.php
649 /src/Core/Domain/Shop/ValueObject/ShopId.php
650 /src/Core/Domain/Shop/ValueObject/ShopIdInterface.php
651 /modules/ps_emailsubscription/ps_emailsubscription.php
652 /src/Core/Module/WidgetInterface.php
653 /src/PrestaShopBundle/Translation/DomainNormalizer.php
654 /classes/Media.php
655 /modules/blockreassurance/blockreassurance.php
656 /modules/nkmgls/nkmgls.php
657 /modules/nkmgls/controllers/admin/AdminGlsOrderController.php
658 /classes/controller/ModuleAdminController.php
659 /classes/controller/AdminController.php
660 /modules/nkmgls/controllers/admin/AdminGlsAjaxController.php
661 /modules/nkmgls/controllers/admin/AdminGlsLabelController.php
662 /modules/nkmgls/controllers/admin/AdminGlsPackingListController.php
663 /classes/module/CarrierModule.php
664 /modules/nkmgls/translations/fr.php
665 /modules/nkmgls/vendor/nukium/gls-prestashop/src/Service/Init/PrestashopGlsInit.php
666 /modules/nkmgls/vendor/nukium/gls-common/src/Service/Init/GlsInit.php
667 /modules/nkmgls/vendor/nukium/gls-common/src/Util/ServiceInstantiationTrait.php
668 /modules/nkmgls/vendor/nukium/gls-common/src/Service/Container.php
669 /modules/nkmgls/vendor/nukium/gls-common/src/Service/ContainerInterface.php
670 /modules/nkmgls/vendor/nukium/gls-common/src/Service/Init/ShipItAdapterResolutionInit.php
671 /modules/nkmgls/vendor/nukium/gls-prestashop/src/Service/Init/PrestashopAdapterInit.php
672 /modules/nkmgls/vendor/nukium/gls-common/src/Service/Init/AdapterInitInterface.php
673 /modules/nkmgls/vendor/nukium/gls-common/src/Service/Repository/Cache/CacheRepositoryFactory.php
674 /modules/nkmgls/vendor/nukium/gls-prestashop/src/Service/Repository/Cache/PrestashopCacheRepository.php
675 /modules/nkmgls/vendor/nukium/gls-prestashop/src/Service/Repository/AbstractRepository.php
676 /modules/nkmgls/vendor/nukium/gls-common/src/Service/Repository/Cache/CacheRepositoryInterface.php
677 /modules/nkmgls/vendor/nukium/gls-prestashop/classes/GlsCacheClass.php
678 /modules/nkmgls/vendor/nukium/gls-common/src/Entity/CacheInterface.php
679 /modules/nkmgls/vendor/nukium/gls-common/src/Service/Handler/DTO/Adapter/Address/AddressHandlerFactory.php
680 /modules/nkmgls/vendor/nukium/gls-prestashop/src/Service/Handler/DTO/Adapter/Address/PrestashopAddressHandler.php
681 /modules/nkmgls/vendor/nukium/gls-common/src/Service/Handler/DTO/Adapter/Address/AddressHandler.php
682 /modules/nkmgls/vendor/nukium/gls-common/src/Service/Handler/DTO/Adapter/Carrier/CarrierHandlerFactory.php
683 /modules/nkmgls/vendor/nukium/gls-prestashop/src/Service/Handler/DTO/Adapter/Carrier/PrestashopCarrierHandler.php
684 /modules/nkmgls/vendor/nukium/gls-common/src/Service/Handler/DTO/Adapter/Carrier/CarrierHandler.php
685 /modules/nkmgls/vendor/nukium/gls-prestashop/src/Service/Helper/ModuleHelper.php
686 /modules/nkmgls/vendor/nukium/gls-prestashop/src/Service/Adapter/Config/PrestashopConfig.php
687 /modules/nkmgls/vendor/nukium/gls-common/src/Service/Adapter/Config/ConfigInterface.php
688 /modules/nkmgls/vendor/nukium/gls-prestashop/src/Service/Repository/Carrier/PrestashopCarrierRepository.php
689 /classes/Carrier.php
690 /modules/nkmgls/vendor/nukium/gls-common/src/Service/Handler/Entity/Cache/CacheHandlerFactory.php
691 /modules/nkmgls/vendor/nukium/gls-prestashop/src/Service/Handler/Entity/Cache/PrestashopCacheHandler.php
692 /modules/nkmgls/vendor/nukium/gls-common/src/Service/Handler/Entity/Cache/CacheHandler.php
693 /modules/nkmgls/vendor/nukium/gls-common/src/Service/Adapter/Config/ConfigFactory.php
694 /modules/nkmgls/vendor/nukium/gls-common/src/Service/Adapter/EntityManager/EntityManagerFactory.php
695 /modules/nkmgls/vendor/nukium/gls-prestashop/src/Service/Adapter/EntityManager/PrestashopEntityManager.php
696 /modules/nkmgls/vendor/nukium/gls-common/src/Service/Adapter/EntityManager/EntityManagerInterface.php
697 /modules/nkmgls/vendor/nukium/gls-common/src/Service/Adapter/Shop/ShopFactory.php
698 /modules/nkmgls/vendor/nukium/gls-prestashop/src/Service/Adapter/Shop/PrestashopShop.php
699 /modules/nkmgls/vendor/nukium/gls-common/src/Service/Adapter/Shop/ShopInterface.php
700 /modules/nkmgls/vendor/nukium/gls-common/src/Service/Adapter/Translator/TranslatorFactory.php
701 /modules/nkmgls/vendor/nukium/gls-prestashop/src/Service/Adapter/Translator/PrestashopTranslator.php
702 /modules/nkmgls/vendor/nukium/gls-common/src/Service/Adapter/Translator/TranslatorInterface.php
703 /modules/nkmgls/vendor/nukium/gls-common/src/Service/Adapter/Utility/UtilityFactory.php
704 /modules/nkmgls/vendor/nukium/gls-prestashop/src/Service/Adapter/Utility/PrestashopUtility.php
705 /modules/nkmgls/vendor/nukium/gls-common/src/Service/Adapter/Utility/Component/DefaultUtility.php
706 /modules/nkmgls/vendor/nukium/gls-prestashop/src/Service/Patch/PatchSystem.php
707 /modules/nkmgls/vendor/nukium/gls-common/src/Service/Adapter/Logger/Component/DefaultLogger.php
708 /modules/nkmgls/vendor/nukium/gls-prestashop/src/Service/Patch/Component/AddOriginalAddressPatch.php
709 /modules/nkmgls/vendor/nukium/gls-prestashop/src/Service/Patch/PatchComponentInterface.php
710 /modules/nkmgls/vendor/nukium/gls-common/src/Service/ShipIt/ShipItAdapterResolution.php
711 /modules/nkmgls/vendor/nukium/gls-common/src/Service/ShipIt/Adapter/NoShipItAdapter.php
712 /modules/nkmgls/vendor/nukium/gls-common/src/Service/ShipIt/ShipItAdapterInterface.php
713 /modules/nkmgls/vendor/nukium/gls-common/src/Service/ShipIt/Adapter/LabelAdapter.php
714 /modules/nkmgls/vendor/nukium/gls-common/src/Service/ShipIt/Adapter/AbstractAdapter.php
715 /modules/nkmgls/vendor/nukium/gls-common/src/Service/ShipIt/Adapter/Component/AuthErrorComponent.php
716 /modules/nkmgls/vendor/nukium/gls-common/src/Service/ShipIt/ShipItComponentInterface.php
717 /modules/nkmgls/vendor/nukium/gls-common/src/Service/ShipIt/Adapter/Component/DefaultErrorComponent.php
718 /modules/nkmgls/vendor/nukium/gls-common/src/Service/Adapter/Logger/LoggerFactory.php
719 /modules/nkmgls/vendor/nukium/gls-common/src/Service/ShipIt/Adapter/Component/LabelInternationalComponent.php
720 /modules/nkmgls/vendor/nukium/gls-common/src/Service/ShipIt/Routine/ShipItErrorRoutine.php
721 /modules/nkmgls/vendor/nukium/gls-common/src/Service/API/ShipmentApi.php
722 /modules/nkmgls/vendor/nukium/gls-common/src/Service/HttpClient/LegacyClient.php
723 /modules/nkmgls/vendor/nukium/gls-common/src/Service/Handler/Legacy/GlsApiHandler.php
724 /modules/nkmgls/vendor/nukium/gls-common/src/Service/HttpClient/GlsCurlClient.php
725 /modules/nkmgls/vendor/nukium/gls-common/src/Service/Helper/GlsHelper.php
726 /modules/nkmgls/vendor/nukium/gls-common/src/Service/ShipIt/Adapter/Component/LabelErrorComponent.php
727 /modules/nkmgls/vendor/nukium/gls-common/src/Service/ShipIt/Adapter/Component/LabelComponent.php
728 /modules/nkmgls/vendor/nukium/gls-common/src/Service/ShipIt/Adapter/RelayAdapter.php
729 /modules/nkmgls/vendor/nukium/gls-common/src/Service/ShipIt/Adapter/Component/RelayComponent.php
730 /modules/nkmgls/vendor/nukium/gls-common/src/Service/ShipIt/Adapter/TrackingAdapter.php
731 /modules/nkmgls/vendor/nukium/gls-common/src/Service/ShipIt/Adapter/Component/TrackingComponent.php
732 /modules/nkmgls/vendor/nukium/gls-common/src/Service/API/TrackingApi.php
733 /modules/nkmgls/vendor/nukium/gls-prestashop/src/Service/Handler/Carrier/GlsExpressHandler.php
734 /modules/nkmgls/vendor/nukium/gls-prestashop/src/Service/Helper/FtpHelper.php
735 /modules/nkmgls/vendor/nukium/gls-prestashop/src/Service/Helper/EnvHelper.php
736 /modules/nkmgls/vendor/nukium/gls-common/src/Service/Routine/AllowedServicesRoutine.php
737 /modules/nkmgls/vendor/nukium/gls-common/src/Service/DataLoader/AllowedServicesLoader.php
738 /modules/nkmgls/vendor/nukium/gls-common/src/Service/Handler/DTO/GLS/AllowedServicesHandler.php
739 /modules/nkmgls/vendor/nukium/gls-common/src/Service/API/AllowedServicesApi.php
740 /modules/nkmgls/vendor/nukium/gls-common/src/Service/Routine/CacheRoutine.php
741 /modules/nkmgls/vendor/nukium/gls-common/src/Service/DataLoader/CacheLoader.php
742 /modules/paybox/paybox.php
743 /modules/paybox/src/Configuration/Settings.php
744 /modules/paybox/vendor/netresearch/jsonmapper/src/JsonMapper.php
745 /modules/paybox/src/Configuration/Account.php
746 /modules/paybox/src/Configuration/DemoAccount.php
747 /modules/paybox/src/Configuration/PaymentConfiguration.php
748 /modules/paybox/src/Configuration/SubscriptionConfiguration.php
749 /modules/paybox/src/Configuration/InstalmentConfiguration.php
750 /modules/paybox/src/Configuration/Instalment.php
751 /modules/paybox/src/Configuration/Contract.php
752 /modules/paybox/src/Utils/Tools.php
753 /vendor/monolog/monolog/src/Monolog/Logger.php
754 /vendor/monolog/monolog/src/Monolog/ResettableInterface.php
755 /vendor/monolog/monolog/src/Monolog/Handler/RotatingFileHandler.php
756 /vendor/monolog/monolog/src/Monolog/Handler/StreamHandler.php
757 /vendor/monolog/monolog/src/Monolog/Handler/AbstractProcessingHandler.php
758 /vendor/monolog/monolog/src/Monolog/Handler/AbstractHandler.php
759 /vendor/monolog/monolog/src/Monolog/Handler/HandlerInterface.php
760 /vendor/monolog/monolog/src/Monolog/Utils.php
761 /modules/paybox/translations/fr.php
762 /modules/ps_emailalerts/ps_emailalerts.php
763 /modules/ps_emailalerts/MailAlert.php
764 /modules/ps_checkout/vendor/prestashop/module-lib-service-container/src/DependencyInjection/ServiceContainer.php
765 /modules/ps_checkout/vendor/prestashop/module-lib-cache-directory-provider/src/Cache/CacheDirectoryProvider.php
766 /modules/ps_checkout/vendor/prestashop/module-lib-service-container/src/DependencyInjection/ContainerProvider.php
767 /var/cache/prod/Ps_checkout8440FrontContainer.php
768 /modules/ps_checkout/src/Validator/FrontControllerValidator.php
769 /modules/ps_checkout/src/Validator/MerchantValidator.php
770 /modules/ps_checkout/src/PayPal/PayPalConfiguration.php
771 /modules/ps_checkout/src/Configuration/PrestaShopConfiguration.php
772 /modules/ps_checkout/src/Configuration/PrestaShopConfigurationOptionsResolver.php
773 /modules/ps_checkout/src/Shop/ShopProvider.php
774 /vendor/symfony/symfony/src/Symfony/Component/OptionsResolver/OptionsResolver.php
775 /vendor/symfony/symfony/src/Symfony/Component/OptionsResolver/Options.php
776 /modules/ps_checkout/src/Repository/PayPalCodeRepository.php
777 /modules/ps_checkout/src/Repository/PsAccountRepository.php
778 /modules/ps_checkout/vendor/prestashop/prestashop-accounts-installer/src/Installer/Facade/PsAccounts.php
779 /modules/ps_checkout/vendor/prestashop/prestashop-accounts-installer/src/Installer/Installer.php
780 /src/Core/Addon/Module/ModuleManagerBuilder.php
781 /src/Core/Util/File/YamlParser.php
782 /vendor/symfony/symfony/src/Symfony/Component/Config/Resource/SelfCheckingResourceChecker.php
783 /vendor/symfony/symfony/src/Symfony/Component/Config/ResourceCheckerInterface.php
784 /vendor/symfony/symfony/src/Symfony/Component/Config/Resource/FileResource.php
785 /vendor/symfony/symfony/src/Symfony/Component/Config/Resource/SelfCheckingResourceInterface.php
786 /vendor/symfony/symfony/src/Symfony/Component/Config/Resource/ResourceInterface.php
787 /var/cache/prod/yaml/4b591b7a28d98961575010499c0558f3.php
788 /src/Adapter/LegacyLogger.php
789 /src/PrestaShopBundle/Service/DataProvider/Admin/CategoriesProvider.php
790 /src/Adapter/Module/ModuleDataProvider.php
791 /src/Adapter/Module/AdminModuleDataProvider.php
792 /src/PrestaShopBundle/Service/DataProvider/Admin/ModuleInterface.php
793 /src/Adapter/Module/Module.php
794 /src/Core/Module/ModuleInterface.php
795 /vendor/symfony/symfony/src/Symfony/Component/Config/FileLocator.php
796 /vendor/symfony/symfony/src/Symfony/Component/Config/FileLocatorInterface.php
797 /vendor/symfony/symfony/src/Symfony/Component/Routing/Loader/YamlFileLoader.php
798 /vendor/symfony/symfony/src/Symfony/Component/Config/Loader/FileLoader.php
799 /vendor/symfony/symfony/src/Symfony/Component/Config/Loader/Loader.php
800 /vendor/symfony/symfony/src/Symfony/Component/Config/Loader/LoaderInterface.php
801 /vendor/symfony/symfony/src/Symfony/Component/Routing/Router.php
802 /vendor/symfony/symfony/src/Symfony/Component/Routing/RouterInterface.php
803 /vendor/symfony/symfony/src/Symfony/Component/Routing/Matcher/UrlMatcherInterface.php
804 /vendor/symfony/symfony/src/Symfony/Component/Routing/RequestContextAwareInterface.php
805 /vendor/symfony/symfony/src/Symfony/Component/Routing/Generator/UrlGeneratorInterface.php
806 /vendor/symfony/symfony/src/Symfony/Component/Routing/Matcher/RequestMatcherInterface.php
807 /vendor/symfony/symfony/src/Symfony/Component/Routing/RequestContext.php
808 /src/Adapter/Module/ModuleDataUpdater.php
809 /src/Core/Module/ModuleManager.php
810 /src/Core/Module/ModuleManagerInterface.php
811 /src/Core/Module/ModuleRepository.php
812 /src/Core/Module/ModuleRepositoryInterface.php
813 /src/Adapter/HookManager.php
814 /src/Core/Module/SourceHandler/SourceHandlerFactory.php
815 /src/PrestaShopBundle/Event/Dispatcher/NullDispatcher.php
816 /vendor/symfony/symfony/src/Symfony/Component/EventDispatcher/EventDispatcherInterface.php
817 /vendor/symfony/contracts/EventDispatcher/EventDispatcherInterface.php
818 /src/Core/Hook/HookDispatcherInterface.php
819 /modules/ps_accounts/ps_accounts.php
820 /modules/ps_accounts/src/Hook/HookableTrait.php
821 /modules/ps_accounts/src/Module/Install.php
822 /modules/ps_accounts/translations/fr.php
823 /modules/ps_accounts/src/ServiceContainer/PsAccountsContainer.php
824 /modules/ps_accounts/vendor/prestashopcorp/lightweight-container/src/ServiceContainer/ServiceContainer.php
825 /modules/ps_accounts/config.php
826 /modules/ps_accounts/src/Log/Logger.php
827 /modules/ps_accounts/vendor/monolog/monolog/src/Monolog/Logger.php
828 /modules/ps_accounts/vendor/psr/log/Psr/Log/LoggerInterface.php
829 /modules/ps_accounts/vendor/monolog/monolog/src/Monolog/ResettableInterface.php
830 /modules/ps_accounts/vendor/monolog/monolog/src/Monolog/Handler/RotatingFileHandler.php
831 /modules/ps_accounts/vendor/monolog/monolog/src/Monolog/Handler/StreamHandler.php
832 /modules/ps_accounts/vendor/monolog/monolog/src/Monolog/Handler/AbstractProcessingHandler.php
833 /modules/ps_accounts/vendor/monolog/monolog/src/Monolog/Handler/AbstractHandler.php
834 /modules/ps_accounts/vendor/monolog/monolog/src/Monolog/Handler/HandlerInterface.php
835 /modules/ps_accounts/vendor/monolog/monolog/src/Monolog/Utils.php
836 /modules/ps_accounts/src/ServiceProvider/ApiClientProvider.php
837 /modules/ps_accounts/vendor/prestashopcorp/lightweight-container/src/ServiceContainer/Contract/IServiceProvider.php
838 /modules/ps_accounts/src/ServiceProvider/CommandProvider.php
839 /modules/ps_accounts/src/ServiceProvider/DefaultProvider.php
840 /modules/ps_accounts/src/ServiceProvider/OAuth2Provider.php
841 /modules/ps_accounts/src/ServiceProvider/RepositoryProvider.php
842 /modules/ps_accounts/src/ServiceProvider/SessionProvider.php
843 /modules/ps_accounts/src/Service/PsAccountsService.php
844 /modules/ps_accounts/src/Account/Session/ShopSession.php
845 /modules/ps_accounts/src/Account/Session/Session.php
846 /modules/ps_accounts/src/Account/Session/SessionInterface.php
847 /modules/ps_accounts/src/Repository/ConfigurationRepository.php
848 /modules/ps_accounts/src/Adapter/Configuration.php
849 /modules/ps_accounts/src/Service/OAuth2/OAuth2Service.php
850 /modules/ps_accounts/src/Http/Client/ClientConfig.php
851 /modules/ps_accounts/src/Http/Client/ConfigObject.php
852 /modules/ps_accounts/src/Type/Enum.php
853 /modules/ps_accounts/src/Service/OAuth2/OAuth2Client.php
854 /modules/ps_accounts/src/Adapter/Link.php
855 /modules/ps_accounts/src/Context/ShopContext.php
856 /modules/ps_accounts/vendor/ramsey/uuid/src/Uuid.php
857 /modules/ps_accounts/vendor/ramsey/uuid/src/UuidInterface.php
858 /modules/ps_accounts/vendor/ramsey/uuid/src/UuidFactory.php
859 /modules/ps_accounts/vendor/ramsey/uuid/src/UuidFactoryInterface.php
860 /modules/ps_accounts/vendor/ramsey/uuid/src/FeatureSet.php
861 /modules/ps_accounts/vendor/ramsey/uuid/src/Converter/Number/DegradedNumberConverter.php
862 /modules/ps_accounts/vendor/ramsey/uuid/src/Converter/NumberConverterInterface.php
863 /modules/ps_accounts/vendor/ramsey/uuid/src/Builder/DefaultUuidBuilder.php
864 /modules/ps_accounts/vendor/ramsey/uuid/src/Builder/UuidBuilderInterface.php
865 /modules/ps_accounts/vendor/ramsey/uuid/src/Codec/StringCodec.php
866 /modules/ps_accounts/vendor/ramsey/uuid/src/Codec/CodecInterface.php
867 /modules/ps_accounts/vendor/ramsey/uuid/src/Provider/Node/FallbackNodeProvider.php
868 /modules/ps_accounts/vendor/ramsey/uuid/src/Provider/NodeProviderInterface.php
869 /modules/ps_accounts/vendor/ramsey/uuid/src/Provider/Node/SystemNodeProvider.php
870 /modules/ps_accounts/vendor/ramsey/uuid/src/Provider/Node/RandomNodeProvider.php
871 /modules/ps_accounts/vendor/ramsey/uuid/src/Generator/RandomGeneratorFactory.php
872 /modules/ps_accounts/vendor/ramsey/uuid/src/Generator/RandomBytesGenerator.php
873 /modules/ps_accounts/vendor/ramsey/uuid/src/Generator/RandomGeneratorInterface.php
874 /modules/ps_accounts/vendor/ramsey/uuid/src/Provider/Time/SystemTimeProvider.php
875 /modules/ps_accounts/vendor/ramsey/uuid/src/Provider/TimeProviderInterface.php
876 /modules/ps_accounts/vendor/ramsey/uuid/src/Generator/TimeGeneratorFactory.php
877 /modules/ps_accounts/vendor/ramsey/uuid/src/Converter/Time/PhpTimeConverter.php
878 /modules/ps_accounts/vendor/ramsey/uuid/src/Converter/TimeConverterInterface.php
879 /modules/ps_accounts/vendor/ramsey/uuid/src/Generator/DefaultTimeGenerator.php
880 /modules/ps_accounts/vendor/ramsey/uuid/src/Generator/TimeGeneratorInterface.php
881 /modules/ps_accounts/vendor/ramsey/uuid/src/BinaryUtils.php
882 /modules/ps_accounts/src/Service/OAuth2/CachedFile.php
883 /modules/ps_accounts/src/Account/LinkShop.php
884 /modules/ps_accounts/src/Cqrs/CommandBus.php
885 /modules/ps_accounts/src/Cqrs/Bus.php
886 /modules/ps_accounts/src/Account/Session/Firebase/ShopSession.php
887 /modules/ps_accounts/src/Account/Session/Firebase/FirebaseSession.php
888 /modules/ps_accounts/src/Account/Session/Firebase/OwnerSession.php
889 /modules/ps_checkout/src/Context/PrestaShopContext.php
890 /modules/ps_checkout/src/ExpressCheckout/ExpressCheckoutConfiguration.php
891 /modules/ps_checkout/src/PayPal/PayPalPayLaterConfiguration.php
892 /modules/ps_checkout/src/Version/Version.php
893 /modules/ps_accounts/src/Adapter/ConfigurationKeys.php
894 /src/Adapter/Presenter/Cart/CartLazyArray.php
895 /src/Adapter/Presenter/AbstractLazyArray.php
896 /src/Adapter/Product/PriceFormatter.php
897 /src/Core/Util/Inflector.php
898 /vendor/doctrine/inflector/lib/Doctrine/Inflector/InflectorFactory.php
899 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Language.php
900 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/English/InflectorFactory.php
901 /vendor/doctrine/inflector/lib/Doctrine/Inflector/GenericLanguageInflectorFactory.php
902 /vendor/doctrine/inflector/lib/Doctrine/Inflector/LanguageInflectorFactory.php
903 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/English/Rules.php
904 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Ruleset.php
905 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Transformations.php
906 /vendor/doctrine/inflector/lib/Doctrine/Inflector/WordInflector.php
907 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/English/Inflectible.php
908 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Transformation.php
909 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Pattern.php
910 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Patterns.php
911 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/English/Uninflected.php
912 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Substitutions.php
913 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Substitution.php
914 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Word.php
915 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Inflector.php
916 /vendor/doctrine/inflector/lib/Doctrine/Inflector/CachedWordInflector.php
917 /vendor/doctrine/inflector/lib/Doctrine/Inflector/RulesetInflector.php
918 /classes/Gender.php
919 /classes/Risk.php
920 /classes/Meta.php
921 /modules/revsliderprestashop/revsliderprestashop.php
922 /modules/revsliderprestashop/rev-loader.php
923 /modules/revsliderprestashop/includes/revslider_db.class.php
924 /modules/revsliderprestashop/includes/data.class.php
925 /modules/revsliderprestashop/includes/functions.class.php
926 /modules/revsliderprestashop/includes/em-integration.class.php
927 /modules/revsliderprestashop/includes/cssparser.class.php
928 /modules/revsliderprestashop/includes/woocommerce.class.php
929 /modules/revsliderprestashop/includes/wpml.class.php
930 /modules/revsliderprestashop/includes/colorpicker.class.php
931 /modules/revsliderprestashop/includes/navigation.class.php
932 /modules/revsliderprestashop/includes/object-library.class.php
933 /modules/revsliderprestashop/admin/includes/loadbalancer.class.php
934 /modules/revsliderprestashop/admin/includes/plugin-update.class.php
935 /modules/revsliderprestashop/includes/extension.class.php
936 /modules/revsliderprestashop/includes/favorite.class.php
937 /modules/revsliderprestashop/includes/aq-resizer.class.php
938 /modules/revsliderprestashop/includes/external-sources.class.php
939 /modules/revsliderprestashop/includes/page-template.class.php
940 /modules/revsliderprestashop/includes/slider.class.php
941 /modules/revsliderprestashop/includes/slide.class.php
942 /modules/revsliderprestashop/includes/output.class.php
943 /modules/revsliderprestashop/public/revslider-front.class.php
944 /modules/revsliderprestashop/includes/backwards.php
945 /modules/revsliderprestashop/admin/includes/class-pclzip.php
946 /modules/revsliderprestashop/admin/includes/license.class.php
947 /modules/revsliderprestashop/admin/includes/addons.class.php
948 /modules/revsliderprestashop/admin/includes/template.class.php
949 /modules/revsliderprestashop/admin/includes/functions-admin.class.php
950 /modules/revsliderprestashop/admin/includes/folder.class.php
951 /modules/revsliderprestashop/admin/includes/import.class.php
952 /modules/revsliderprestashop/admin/includes/export.class.php
953 /modules/revsliderprestashop/admin/includes/export-html.class.php
954 /modules/revsliderprestashop/admin/includes/newsletter.class.php
955 /modules/revsliderprestashop/admin/revslider-admin.class.php
956 /modules/revsliderprestashop/includes/update.class.php
957 /modules/revsliderprestashop/includes/resize-imag.php
958 /modules/revsliderprestashop/translations/fr.php
959 /classes/Address.php
960 /classes/State.php
961 /src/Core/Security/PasswordPolicyConfiguration.php
962 /src/Core/Configuration/DataConfigurationInterface.php
963 /src/Core/Security/Hashing.php
964 /src/Core/Filter/FrontEndObject/MainFilter.php
965 /src/Core/Filter/FilterInterface.php
966 /src/Core/Filter/FrontEndObject/CartFilter.php
967 /src/Core/Filter/HashMapWhitelistFilter.php
968 /src/Core/Filter/CollectionFilter.php
969 /src/Core/Filter/FrontEndObject/ProductFilter.php
970 /src/Core/Filter/FrontEndObject/EmbeddedAttributesFilter.php
971 /src/Core/Filter/FrontEndObject/CustomerFilter.php
972 /src/Core/Filter/FrontEndObject/ShopFilter.php
973 /src/Core/Filter/FrontEndObject/ConfigurationFilter.php
974 /modules/productcomments/productcomments.php
975 /modules/ps_shoppingcart/ps_shoppingcart.php
976 /modules/iqitcontactpage/iqitcontactpage.php
977 /modules/iqitcontactpage/translations/fr.php
978 /modules/iqitsociallogin/iqitsociallogin.php
979 /modules/iqitsociallogin/translations/fr.php
980 /modules/iqitmegamenu/iqitmegamenu.php
981 /modules/iqitmegamenu/models/IqitMenuTab.php
982 /modules/iqitmegamenu/models/IqitMenuHtml.php
983 /modules/iqitmegamenu/models/IqitMenuLinks.php
984 /modules/iqitmegamenu/translations/fr.php
985 /modules/iqitelementor/iqitelementor.php
986 /modules/iqitelementor/src/IqitElementorLanding.php
987 /modules/iqitelementor/src/IqitElementorTemplate.php
988 /modules/iqitelementor/src/IqitElementorProduct.php
989 /modules/iqitelementor/src/IqitElementorCategory.php
990 /modules/iqitelementor/src/IqitElementorContent.php
991 /modules/iqitelementor/src/iqitElementorWpHelper.php
992 /modules/iqitelementor/includes/plugin-elementor.php
993 /modules/iqitelementor/src/widgets/IqitElementorWidget_Brands.php
994 /modules/iqitelementor/src/widgets/IqitElementorWidget_ProductsList.php
995 /modules/iqitelementor/src/widgets/IqitElementorWidget_ProductsListTabs.php
996 /modules/iqitelementor/src/widgets/IqitElementorWidget_Modules.php
997 /modules/iqitelementor/src/widgets/IqitElementorWidget_CustomTpl.php
998 /modules/iqitelementor/src/widgets/IqitElementorWidget_Menu.php
999 /modules/iqitelementor/src/widgets/IqitElementorWidget_RevolutionSlider.php
1000 /modules/iqitelementor/src/widgets/IqitElementorWidget_Newsletter.php
1001 /modules/iqitelementor/src/widgets/IqitElementorWidget_Blog.php
1002 /modules/iqitelementor/src/widgets/IqitElementorWidget_Search.php
1003 /modules/iqitelementor/src/widgets/IqitElementorWidget_Links.php
1004 /modules/iqitelementor/src/widgets/IqitElementorWidget_ContactForm.php
1005 /modules/iqitelementor/translations/fr.php
1006 /modules/iqitfreedeliverycount/iqitfreedeliverycount.php
1007 /modules/iqitfreedeliverycount/translations/fr.php
1008 /modules/sendinblue/sendinblue.php
1009 /modules/sendinblue/translations/fr.php
1010 /modules/sendinblue/services/ConfigService.php
1011 /modules/colissimo_simplicite/colissimo_simplicite.php
1012 /modules/colissimo_simplicite/models/ColissimoDeliveryInfo.php
1013 /modules/colissimo_simplicite/models/ColissimoDeliveryPoint.php
1014 /modules/colissimo_simplicite/translations/fr.php
1015 /modules/lgcookieslaw/lgcookieslaw.php
1016 /modules/lgcookieslaw/translations/fr.php
1017 /src/Core/Product/Search/ProductSearchContext.php
1018 /src/Core/Product/Search/ProductSearchQuery.php
1019 /src/Core/Product/Search/SortOrder.php
1020 /modules/ps_facetedsearch/ps_facetedsearch.php
1021 /modules/ps_facetedsearch/src/HookDispatcher.php
1022 /modules/ps_facetedsearch/src/Hook/Attribute.php
1023 /modules/ps_facetedsearch/src/Hook/AbstractHook.php
1024 /modules/ps_facetedsearch/src/Hook/AttributeGroup.php
1025 /modules/ps_facetedsearch/src/Hook/Category.php
1026 /modules/ps_facetedsearch/src/Hook/Configuration.php
1027 /modules/ps_facetedsearch/src/Hook/Design.php
1028 /modules/ps_facetedsearch/src/Hook/Feature.php
1029 /modules/ps_facetedsearch/src/Form/Feature/FormModifier.php
1030 /modules/ps_facetedsearch/src/Form/Feature/FormDataProvider.php
1031 /modules/ps_facetedsearch/src/Hook/FeatureValue.php
1032 /modules/ps_facetedsearch/src/Form/FeatureValue/FormModifier.php
1033 /modules/ps_facetedsearch/src/Form/FeatureValue/FormDataProvider.php
1034 /modules/ps_facetedsearch/src/Hook/Product.php
1035 /modules/ps_facetedsearch/src/Hook/ProductSearch.php
1036 /modules/ps_facetedsearch/src/Hook/SpecificPrice.php
1037 /modules/ps_facetedsearch/src/Filters/Provider.php
1038 /modules/ps_facetedsearch/src/URLSerializer.php
1039 /modules/ps_facetedsearch/src/Filters/DataAccessor.php
1040 /modules/ps_facetedsearch/src/Product/SearchProvider.php
1041 /src/Core/Product/Search/FacetsRendererInterface.php
1042 /src/Core/Product/Search/ProductSearchProviderInterface.php
1043 /modules/ps_facetedsearch/src/Filters/Converter.php
1044 /modules/ps_facetedsearch/src/Product/SearchFactory.php
1045 /src/Core/Product/Search/ProductSearchResult.php
1046 /classes/Combination.php
1047 /modules/ps_facetedsearch/src/Definition/Availability.php
1048 /modules/ps_facetedsearch/src/Product/Search.php
1049 /modules/ps_facetedsearch/src/Adapter/MySQL.php
1050 /modules/ps_facetedsearch/src/Adapter/AbstractAdapter.php
1051 /modules/ps_facetedsearch/src/Adapter/InterfaceAdapter.php
1052 /vendor/doctrine/collections/lib/Doctrine/Common/Collections/ArrayCollection.php
1053 /vendor/doctrine/collections/lib/Doctrine/Common/Collections/Collection.php
1054 /vendor/doctrine/collections/lib/Doctrine/Common/Collections/ReadableCollection.php
1055 /vendor/doctrine/collections/lib/Doctrine/Common/Collections/Selectable.php
1056 /modules/ps_facetedsearch/src/Filters/Products.php
1057 /classes/stock/StockAvailable.php
1058 /modules/ps_facetedsearch/src/Filters/Block.php
1059 /src/Core/Product/Search/Facet.php
1060 /src/Core/Product/Search/Filter.php
1061 /vendor/prestashop/decimal/src/DecimalNumber.php
1062 /vendor/prestashop/decimal/src/Builder.php
1063 /src/Core/Product/Search/FacetCollection.php
1064 /classes/ProductAssembler.php
1065 /classes/tax/Tax.php
1066 /classes/Manufacturer.php
1067 /classes/SpecificPrice.php
1068 /classes/tax/TaxManagerFactory.php
1069 /classes/tax/TaxRulesTaxManager.php
1070 /classes/tax/TaxManagerInterface.php
1071 /classes/tax/TaxCalculator.php
1072 /classes/GroupReduction.php
1073 /src/Core/Localization/CLDR/ComputingPrecision.php
1074 /src/Core/Localization/CLDR/ComputingPrecisionInterface.php
1075 /classes/Pack.php
1076 /classes/order/Order.php
1077 /classes/Feature.php
1078 /classes/ProductPresenterFactory.php
1079 /src/Adapter/Presenter/Product/ProductListingPresenter.php
1080 /src/Adapter/Presenter/Product/ProductPresenter.php
1081 /src/Adapter/Product/ProductColorsRetriever.php
1082 /src/Core/Product/ProductPresentationSettings.php
1083 /src/Adapter/Presenter/Product/ProductListingLazyArray.php
1084 /src/Adapter/Presenter/Product/ProductLazyArray.php
1085 /classes/Image.php
1086 /vendor/prestashop/decimal/src/Operation/Division.php
1087 /vendor/prestashop/decimal/src/Operation/Multiplication.php
1088 /vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php
1089 /var/cache/prod/smarty/compile/warehouse/d4/1d/65/d41d65d76b9471b5d365fe06cf1737c89a53af9f_2.module.ps_facetedsearchviewstemplatesfrontcatalogfacets.tpl.php
1090 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_block.php
1091 /vendor/smarty/smarty/libs/plugins/modifier.count.php
1092 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php
1093 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_foreach.php
1094 /var/cache/prod/smarty/compile/warehouse/2e/80/73/2e807335546cfa2360c36327ac89dd2fcb054379_2.module.ps_facetedsearchviewstemplatesfrontcatalogactivefilters.tpl.php
1095 /src/Core/Product/Search/Pagination.php
1096 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/bb/85/6b/bb856bc456eeb8d3881b4b16559692931100cee3_2.file.category.tpl.php
1097 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_capture.php
1098 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/92/5b/54/925b5420d64b948b3229da21ab6dd2ff798a7a1a_2.file.product-list.tpl.php
1099 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/24/3e/71/243e71636e97556888c0393b2f9b2707ca88ed68_2.file.layout-left-column.tpl.php
1100 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/71/d7/35/71d735abfb624f417275d842d825bca284f61193_2.file.layout-both-columns.tpl.php
1101 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/7d/45/b7/7d45b7ec7efac918307809de29557d44680a63e4_2.file.helpers.tpl.php
1102 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_tplfunction.php
1103 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/86/07/8b/86078b28459fa7cd90601729f42410aa6198246a_2.file.head.tpl.php
1104 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/75/a1/41/75a14189d0796b2f1afd51b5286ce629009a30ed_2.file.head-jsonld.tpl.php
1105 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/4f/0b/1f/4f0b1fdd2b9e22e8147a81c8cb2124c0a64a0d9f_2.file.product-list-jsonld.tpl.php
1106 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/53/60/5f/53605fdf8a8949b6a22d2d9cb063fe42d53e06b8_2.file.pagination-seo.tpl.php
1107 /vendor/smarty/smarty/libs/plugins/modifier.replace.php
1108 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/39/a8/b1/39a8b12a758387bfe9a459af55b35aa2633c339c_2.file.stylesheets.tpl.php
1109 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/cd/b1/00/cdb100cf3c2798f0d78781ef17d51d53ad8d6aa3_2.file.javascript.tpl.php
1110 /classes/ProductDownload.php
1111 /src/Core/Cart/Calculator.php
1112 /src/Core/Cart/CartRowCollection.php
1113 /src/Core/Cart/Fees.php
1114 /src/Core/Cart/AmountImmutable.php
1115 /src/Core/Cart/CartRuleCollection.php
1116 /src/Core/Cart/CartRuleCalculator.php
1117 /src/Adapter/Product/PriceCalculator.php
1118 /src/Core/Cart/CartRow.php
1119 /vendor/symfony/symfony/src/Symfony/Component/Translation/PluralizationRules.php
1120 /src/Core/Util/String/StringModifier.php
1121 /src/Core/Util/String/StringModifierInterface.php
1122 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/15/5f/49/155f4970adacdf2bb136d57371ece6919a20a9f4_2.file.product-activation.tpl.php
1123 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/49/3f/fd/493ffd63fb8e54f110fda59bc59cba5f0243b073_2.file.header.tpl.php
1124 /modules/iqithtmlandbanners/iqithtmlandbanners.php
1125 /modules/iqithtmlandbanners/src/IqitHtmlAndBannerRepository.php
1126 /modules/iqithtmlandbanners/src/IqitHtmlAndBannerPresenter.php
1127 /modules/iqithtmlandbanners/src/IqitHtmlAndBanner.php
1128 /modules/iqithtmlandbanners/translations/fr.php
1129 /vendor/smarty/smarty/libs/sysplugins/smarty_template_cached.php
1130 /vendor/smarty/smarty/libs/sysplugins/smarty_cacheresource.php
1131 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_cacheresource_file.php
1132 /var/cache/prod/smarty/cache/iqithtmlandbanners/1/1/1/1/8/displayNav1/warehouse/c7/74/df/c774dfa1ec092af1bad964e2e84d44e094a12e16.iqithtmlandbannersviewstemplateshookiqithtmlandbanners.tpl.php
1133 /modules/ps_languageselector/ps_languageselector.php
1134 /modules/ps_currencyselector/ps_currencyselector.php
1135 /var/cache/prod/smarty/compile/warehouse/b9/77/56/b97756c07f8c7dd53da6530f78f67ddd242f77c9_2.module.ps_currencyselectorps_currencyselector.tpl.php
1136 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/16/a1/8f/16a18f495002f0441eaa5151434d5866441bac65_2.file.header-2.tpl.php
1137 /modules/iqitsearch/iqitsearch.php
1138 /modules/iqitsearch/translations/fr.php
1139 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_method_gettemplatevars.php
1140 /var/cache/prod/smarty/compile/warehouse/78/3c/e0/783ce0bc99544193d9645b02e003b32e879d6a43_2.module.iqitsearchviewstemplateshookiqitsearch.tpl.php
1141 /var/cache/prod/smarty/compile/warehouse/46/29/db/4629dbb3c4efa13c090c633dc2e46e5f2b42bed3_2.module.iqitsearchviewstemplateshooksearchbar.tpl.php
1142 /modules/ps_customersignin/ps_customersignin.php
1143 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/72/be/19/72be192e406191c1cad554abe284e159adeb4234_2.module.ps_customersigninps_customersigninbtn.tpl.php
1144 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/b4/a4/76/b4a476e0a8201677b298f7c0f8ca1ac698e1bac3_2.module.ps_shoppingcartps_shoppingcartbtn.tpl.php
1145 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/35/65/5e/35655e6409b6198f29dd6e732ef9598dec599880_2.module.ps_shoppingcartps_shoppingcart.tpl.php
1146 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/f6/e9/f2/f6e9f2b1680a466582d2199d038efe2cfa3a83f7_2.module.ps_shoppingcartps_shoppingcartcontent.tpl.php
1147 /var/cache/prod/smarty/cache/iqitmegamenu/index/1/1/1/1/8/warehouse/12/c6/31/12c63107907c6d214b90e77509786468cad41332.iqitmegamenuviewstemplateshookhorizontal.tpl.php
1148 /classes/CMS.php
1149 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_updatecache.php
1150 /var/cache/prod/smarty/compile/warehouse/79/74/04/797404135c3d6163c184d5946c377ac2bc91c4d2_2.module.iqitmegamenuviewstemplateshookhorizontal.tpl.cache.php
1151 /vendor/smarty/smarty/libs/plugins/shared.mb_str_replace.php
1152 /var/cache/prod/smarty/compile/warehouse/47/0d/5c/470d5c96fd175e37e89afd5cc78d331c9756e29d_2.module.iqitmegamenuviewstemplateshook_partialssubmenu_content.tpl.cache.php
1153 /var/cache/prod/smarty/compile/warehouse/98/cb/9e/98cb9e3fbf4c879e219db3109049550b02a2da1b_2.module.iqitmegamenuviewstemplateshookmobile.tpl.cache.php
1154 /var/cache/prod/smarty/compile/warehouse/56/f0/d4/56f0d4faf7cc1ec9240e891fedda6e0b4794dc62_2.module.iqitmegamenuviewstemplateshook_partialssubmenu_content_mobile.tpl.cache.php
1155 /var/cache/prod/smarty/compile/warehouse/9b/b6/a9/9bb6a9970aa01b8fd3c752c16e574cb1b14bf323_2.module.ps_languageselectorps_languageselectormobilemenu.tpl.cache.php
1156 /var/cache/prod/smarty/compile/warehouse/dd/65/22/dd6522dbacb2ead7139cef7a64e59ac80e0726fc_2.module.ps_currencyselectorps_currencyselectormobilemenu.tpl.cache.php
1157 /var/cache/prod/smarty/compile/warehouse/d3/f6/c8/d3f6c8247111f1ef9bebabfff451b9cb9207ba0b_2.module.ps_customersigninps_customersigninmobilemenu.tpl.cache.php
1158 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_codeframe.php
1159 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_writefile.php
1160 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/27/7f/d3/277fd37fbd4e3d5997a6729163ed4291fb7b747e_2.file.mobile-header-1.tpl.php
1161 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/7a/30/38/7a3038780284d52e9fcd7a66e51e5b86a166106b_2.module.iqitsearchviewstemplateshooksearchbarmobile.tpl.php
1162 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/be/ee/e6/beeee6f3d87613010f8af1cabc4c4562f8cf600a_2.module.ps_customersigninps_customersigninmobile.tpl.php
1163 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/d4/e1/57/d4e1571b6b210795247564db06deb17061778b51_2.module.ps_shoppingcartps_shoppingcartmqty.tpl.php
1164 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/9a/64/f3/9a64f33010c8c3420bbc410257bdb57f0a9bc3be_2.file.breadcrumb.tpl.php
1165 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/d4/35/7f/d4357f43e19050f2d2f2028e6f165cd3b7cc2cd7_2.file.notifications.tpl.php
1166 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/a7/28/48/a72848955674ed794c6c6a5e504b11a1cb173ed8_2.file.category-header.tpl.php
1167 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/92/94/ca/9294ca5ac8cef4c021336349ebba4cf8ccc608a1_2.file.products-top.tpl.php
1168 /vendor/smarty/smarty/libs/plugins/modifier.regex_replace.php
1169 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/83/e9/08/83e90827ba40fafa2a771c4073ac57f31928625e_2.file.sort-orders.tpl.php
1170 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/18/fe/cb/18fecbdf20428cf6869837dea2e0d5ca5dd8d3ec_2.file.products.tpl.php
1171 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/3f/3e/f7/3f3ef74c741ca95575dc32ec76705f946e3422a0_2.file.product.tpl.php
1172 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/0d/c1/99/0dc199c5d12599ceeb88b6a2b1d98a7a56f14314_2.file.product-miniature-1.tpl.php
1173 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/b6/dd/21/b6dd2164727c4f6493fca8e8e7fc27495f5e513d_2.file.product-miniature-thumb.tpl.php
1174 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/56/c3/f2/56c3f2a516718b563166d070fcdb1702f53c5b74_2.file.product-miniature-btn.tpl.php
1175 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/c3/b4/5d/c3b45dd17613497fe3573058ca4c0e68116beb49_2.file.pagination.tpl.php
1176 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/d7/38/da/d738dab394eb6986b6d095fda5b79bd9db20b43b_2.file.products-bottom.tpl.php
1177 /modules/ps_categorytree/ps_categorytree.php
1178 /var/cache/prod/smarty/compile/warehouse/89/21/00/8921007f54626fc7fe42cbff53f1d70828d3393d_2.module.ps_categorytreeviewstemplateshookps_categorytree.tpl.php
1179 /var/cache/prod/smarty/compile/warehouse/81/a1/04/81a1040ed0eeab6f58198f9907167c7fced628c5_2.module.ps_facetedsearchps_facetedsearch.tpl.php
1180 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/a1/9f/e0/a19fe04169c26490610977ee4790590b01e18353_2.file.footer.tpl.php
1181 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/49/8a/94/498a94e3fb2e357d8f6d4e4c267d7b70c033a1c3_2.file.footer-1.tpl.php
1182 /modules/iqitlinksmanager/iqitlinksmanager.php
1183 /modules/iqitlinksmanager/src/IqitLinkBlockRepository.php
1184 /modules/iqitlinksmanager/src/IqitLinkBlock.php
1185 /modules/iqitlinksmanager/src/IqitLinkBlockPresenter.php
1186 /modules/iqitlinksmanager/translations/fr.php
1187 /var/cache/prod/smarty/cache/iqitlinksmanager/1/1/1/1/8/displayFooter/warehouse/a3/94/0b/a3940bd1d7ebdb077f5394215b97cf9d975f5741.iqitlinksmanagerviewstemplateshookiqitlinksmanager.tpl.php
1188 /var/cache/prod/smarty/cache/iqitcontactpage/1/1/1/1/8/warehouse/c4/e5/8b/c4e58ba5baab27adb5450fcac6725664cd1cef81.iqitcontactpageviewstemplateshookiqitcontactpageblock.tpl.php
1189 /var/cache/prod/smarty/compile/warehouse/ee/75/26/ee752603de038a9aef5378771f6bf531aa9e40f3_2.module.iqitcontactpageviewstemplateshookiqitcontactpageblock.tpl.cache.php
1190 /var/cache/prod/smarty/compile/warehouse/44/b4/ef/44b4ef888deb2f933dcd9da2c1066fcd712ea5c6_2.module.iqitcontactpageviewstemplateshook_partialscontent.tpl.cache.php
1191 /var/cache/prod/smarty/compile/warehouse/2d/c2/29/2dc229bcd2fcd72db57e2012572582b00bdf5abe_2.file.cookieslaw.tpl.php
1192 /vendor/smarty/smarty/libs/plugins/modifier.escape.php
1193 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/63/d3/ad/63d3adee5f6b5e391329228d089f792c3bb82b69_2.file.social-links.tpl.php
1194 /var/cache/prod/smarty/compile/warehouse/30/7d/c6/307dc6bd4724d29d1572cc301dd7148e962604ef_2.module.ps_emailsubscriptionviewstemplateshookps_emailsubscription.tpl.php
1195 /modules/psgdpr/psgdpr.php
1196 /modules/psgdpr/translations/fr.php
1197 /modules/psgdpr/classes/GDPRConsent.php
1198 /var/cache/prod/smarty/compile/warehouse/5e/ee/24/5eee242e5cbca9bb89b8ffa439cebef7beaaf2e4_2.module.psgdprviewstemplateshookdisplayGDPRConsent.tpl.php
1199 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/16/d6/b8/16d6b8721374815caf8784f27e2d077ed824ca86_2.file.footer-copyrights-1.tpl.php
1200 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/22/f3/55/22f35596a1c264e5427f9b58f5206b3b8a797425_2.file.password-policy-template.tpl.php
1201 /modules/statsdata/statsdata.php
1202 /classes/Connection.php
1203 /classes/ConnectionsSource.php