Accueil

Load Time 5355 ms
Querying Time 3851 ms
Queries 4545
Memory Peak Usage 80.8 Mb
Included Files 1204 files - 13.59 Mb
PrestaShop Cache 4.50 Mb
Global vars 0.43 Mb
PrestaShop Version 8.2.1
PHP Version 8.1.32
MySQL Version 10.11.11-MariaDB-0ubuntu0.24.04.2
Memory Limit 4096M
Max Execution Time 600s
Smarty Cache enabled
Smarty Compilation auto
  Time Cumulated Time Memory Usage Memory Peak Usage
config 5.989 ms 5.989 ms 3.21 Mb 3.6 Mb
__construct 0.026 ms 6.015 ms - Mb 3.6 Mb
init 66.589 ms 72.604 ms 0.89 Mb 4.4 Mb
checkAccess 0.005 ms 72.609 ms - Mb 4.4 Mb
setMedia 42.176 ms 114.785 ms 0.61 Mb 4.7 Mb
postProcess 0.004 ms 114.789 ms - Mb 4.7 Mb
initHeader 0.002 ms 114.791 ms - Mb 4.7 Mb
initContent 4325 ms 4440 ms 51.71 Mb 56.5 Mb
initFooter 0.005 ms 4440 ms - Mb 56.5 Mb
display 915 ms 5355 ms 20.72 Mb 80.8 Mb
Hook Time Memory Usage
displayMainMenu 202.406 ms 5.80 Mb
ActionFrontControllerSetMedia 20.929 ms 0.19 Mb
displayLeftColumn 17.904 ms 0.74 Mb
displayFooter 7.975 ms 0.38 Mb
DisplayHeader 7.901 ms 0.09 Mb
displayNav2 4.821 ms 0.19 Mb
Footer 3.597 ms 0.18 Mb
renderWidget 2.878 ms 0.05 Mb
displayNav1 2.331 ms 0.08 Mb
DisplayBeforeBodyClosingTag 2.071 ms 0.05 Mb
DisplayGDPRConsent 1.556 ms 0.08 Mb
IsJustElementor 0.632 ms 0.02 Mb
ProductSearchProvider 0.496 ms - Mb
DisplayLeftColumn 0.438 ms 0.02 Mb
Header 0.349 ms - Mb
OverrideLayoutTemplate 0.090 ms - Mb
ActionDispatcher 0.019 ms - Mb
displayVerticalMenu 0.019 ms - Mb
ActionProductSearchAfter 0.017 ms - Mb
DisplayAfterBodyOpeningTag 0.016 ms - Mb
Top 0.016 ms - Mb
DisplayNavFullWidth 0.016 ms - Mb
DisplayFooterBefore 0.016 ms - Mb
DisplayFooterAfter 0.013 ms - Mb
ModuleRoutes 0.009 ms - Mb
25 hook(s) 276.515 ms 7.87 Mb
Module Time Memory Usage
ps_checkout 23.783 ms 0.22 Mb
iqitthemeeditor 2.387 ms 0.18 Mb
ps_emailsubscription 4.265 ms 0.26 Mb
blockreassurance 0.354 ms 0.02 Mb
nkmgls 15.030 ms 0.30 Mb
paybox 4.385 ms 0.08 Mb
ps_emailalerts 0.270 ms 0.01 Mb
ps_accounts 1.502 ms - Mb
revsliderprestashop 3.921 ms 0.05 Mb
productcomments 0.325 ms 0.01 Mb
ps_shoppingcart 0.175 ms 0.01 Mb
iqitcontactpage 3.181 ms 0.07 Mb
iqitsociallogin 0.282 ms 0.01 Mb
iqitmegamenu 202.889 ms 5.81 Mb
iqitelementor 1.363 ms 0.03 Mb
iqitfreedeliverycount 0.237 ms 0.01 Mb
sendinblue 4.380 ms 0.04 Mb
colissimo_simplicite 8.321 ms 0.09 Mb
lgcookieslaw 6.022 ms 0.19 Mb
ps_facetedsearch 2.598 ms 0.08 Mb
iqithtmlandbanners 2.929 ms 0.16 Mb
ps_languageselector 1.180 ms 0.05 Mb
ps_currencyselector 4.001 ms 0.15 Mb
iqitsearch 3.340 ms - Mb
ps_customersignin 0.155 ms 0.01 Mb
ps_categorytree 18.077 ms 0.75 Mb
iqitlinksmanager 1.811 ms 0.08 Mb
psgdpr 2.377 ms 0.19 Mb
statsdata 2.241 ms 0.05 Mb
29 module(s) 321.782 ms 8.86 Mb

Stopwatch SQL - 4545 queries

# Query Time (ms) Rows Filesort Group By Location
86
SELECT SQL_NO_CACHE p.id_product FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM hgt78_product p LEFT JOIN hgt78_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN hgt78_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN hgt78_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN hgt78_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN hgt78_category_product cp ON (p.id_product = cp.id_product) INNER JOIN hgt78_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN hgt78_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN hgt78_category_group cg ON (cg.id_category = c.id_category) WHERE ((sa.quantity>0)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND cp.id_category='38' GROUP BY p.id_product) p INNER JOIN hgt78_category_product cp ON (p.id_product = cp.id_product) GROUP BY p.id_product ORDER BY p.position ASC, p.id_product DESC
210.627 ms 35424 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
88
SELECT SQL_NO_CACHE p.*,
ps.*,
pl.*,
sa.out_of_stock,
IFNULL(sa.quantity, 0) as quantity,
(DATEDIFF(
p.`date_add`,
DATE_SUB(
'2025-05-01 00:00:00',
INTERVAL 20 DAY
)
) > 0) as new
FROM hgt78_product p
LEFT JOIN hgt78_product_lang pl
ON pl.id_product = p.id_product
AND pl.id_shop = 1
AND pl.id_lang = 1
LEFT JOIN hgt78_stock_available sa   ON sa.id_product = p.id_product
AND sa.id_product_attribute = 0
AND sa.id_shop = 1 LEFT JOIN hgt78_product_shop ps
ON ps.id_product = p.id_product
AND ps.id_shop = 1
WHERE p.id_product IN (7543,7542,7541,7540,7539,6727,5148,5147,5146,5145,5144,5143,5142,5141,5140,5139,5138,5137,5136,5135,5134,5133,4902,3743,3741,3740,3587,2893,2694,2660,2652,2651,2623,2767,2768,2769,2770,2773,2774,2775,2776,2766,2765,2661,2690,2691,2692,2693,2771,2738,2764,2777,2778,2779,2795,2797,2798,2799,2800,3178,3075,3176,2794,2793,2780,2781,3179,2788,2789,2790,2791,2792,3177,2659,2635,2631,2632,2633,2634,2782,2636,2637,2638,2639,2630,2629,2628,3477,2620,3459,2622,3458,2624,2625,2626,2627,2640,2641,2656,2648,2657,3456,2649,2658,2647,2646,2642,2643,2655,2644,2645,3252,3254,3264,3265,3326,3155,2818,2892,3099,3107,3132,3327,2490,2621,2733,2650,2654,3454,3455,3484,3556,3558,3584,3585,3586,3639,3689,3745,3746,3747,3748,3749,3750,3751,3752,3753,3754,3755,3756,3757,3763,3764,3765,3766,3771,3775,3776,3777,3804,3805,3806,3807,3808,4256,4574,4575,4932,4934,4935,4942,4943,4944,4963,4964,4965,4966,5282,5283,5284,5293,5296,5093,5589,5590,5591,5970,5971,5972,5973,6047,6107,6108,6129,6172,6173,6174,6176,6177,6178,6179,6180,6181,6182,6183,6184,6185,6186,6187,6188,6189,6191,6192,6193,6194,6195,6499,6500,6501,7938,7940,7941,7942,7943,7944,7945,7946,7769,7773,8392,8393,8395,8396,8397,8401,8417,8418,8419,8420,8975,8976,9055,9321,9323,9324,9325,9535,9596,9597,9598,9687,9686,9688,9689,9690,9691,9692,9693,9694,9695,9697,10067,10068,10069,10070,10071,10072,10073,10111,10297,10298,10299,10302,10303,10304,10305,12552,12551,11001)
29.656 ms 279 /classes/ProductAssembler.php:95
4136
SELECT SQL_NO_CACHE c.*, cl.*
FROM `hgt78_category` c
INNER JOIN hgt78_category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1)
LEFT JOIN `hgt78_category_lang` cl ON c.`id_category` = cl.`id_category` AND cl.id_shop = 1 
LEFT JOIN `hgt78_category_group` cg ON c.`id_category` = cg.`id_category`
RIGHT JOIN `hgt78_category` c2 ON c2.`id_category` = 44 AND c.`nleft` >= c2.`nleft` AND c.`nright` <= c2.`nright`
WHERE 1  AND `id_lang` = 1
AND c.`active` = 1
AND cg.`id_group` IN (1)
GROUP BY c.`id_category`
ORDER BY c.`level_depth` ASC
, category_shop.`position` ASC
17.562 ms 24 Yes Yes /classes/Category.php:799
2737
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 8420
AND image_shop.`cover` = 1 LIMIT 1
12.369 ms 1 /classes/Product.php:3570
4477
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (8417) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
9.561 ms 1 Yes Yes /classes/Product.php:4524
4523
SELECT SQL_NO_CACHE c.*, cl.*
FROM `hgt78_category` c
INNER JOIN hgt78_category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1)
LEFT JOIN `hgt78_category_lang` cl ON c.`id_category` = cl.`id_category` AND cl.id_shop = 1 
LEFT JOIN `hgt78_category_group` cg ON c.`id_category` = cg.`id_category`
RIGHT JOIN `hgt78_category` c2 ON c2.`id_category` = 2 AND c.`nleft` >= c2.`nleft` AND c.`nright` <= c2.`nright`
WHERE 1 AND c.`level_depth` <= 5 AND `id_lang` = 1
AND c.`active` = 1
AND cg.`id_group` IN (1)
GROUP BY c.`id_category`
ORDER BY c.`level_depth` ASC, category_shop.`position` ASC
8.449 ms 242 Yes Yes /classes/Category.php:799
3864
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 7940
ORDER BY `position`
8.304 ms 1 Yes /classes/Product.php:3545
2
SELECT SQL_NO_CACHE c.`name`, cl.`id_lang`, IF(cl.`id_lang` IS NULL, c.`value`, cl.`value`) AS value, c.id_shop_group, c.id_shop
FROM `hgt78_configuration` c
LEFT JOIN `hgt78_configuration_lang` cl ON (c.`id_configuration` = cl.`id_configuration`)
8.297 ms 5859 /classes/Configuration.php:180
2742
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 8420)
8.019 ms 1 /classes/Product.php:3860
3665
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3766) AND (b.`id_shop` = 1) LIMIT 1
7.698 ms 1 /src/Adapter/EntityMapper.php:71
4148
SELECT SQL_NO_CACHE c.*, cl.*
FROM `hgt78_category` c
INNER JOIN hgt78_category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1)
LEFT JOIN `hgt78_category_lang` cl ON c.`id_category` = cl.`id_category` AND cl.id_shop = 1 
LEFT JOIN `hgt78_category_group` cg ON c.`id_category` = cg.`id_category`
RIGHT JOIN `hgt78_category` c2 ON c2.`id_category` = 37 AND c.`nleft` >= c2.`nleft` AND c.`nright` <= c2.`nright`
WHERE 1  AND `id_lang` = 1
AND c.`active` = 1
AND cg.`id_group` IN (1)
GROUP BY c.`id_category`
ORDER BY c.`level_depth` ASC
, category_shop.`position` ASC
7.209 ms 148 Yes Yes /classes/Category.php:799
45
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 37) AND (b.`id_shop` = 1) LIMIT 1
7.042 ms 1 /src/Adapter/EntityMapper.php:71
102
SELECT SQL_NO_CACHE `id_hook`, `name`
FROM `hgt78_hook`
UNION
SELECT `id_hook`, ha.`alias` as name
FROM `hgt78_hook_alias` ha
INNER JOIN `hgt78_hook` h ON ha.name = h.name
7.008 ms 0 /classes/Hook.php:1348
3687
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3806
ORDER BY `position`
6.869 ms 1 Yes /classes/Product.php:3545
15
SELECT SQL_NO_CACHE `name`, `alias` FROM `hgt78_hook_alias`
6.426 ms 88 /classes/Hook.php:290
2736
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 8419
ORDER BY f.position ASC
6.266 ms 5 Yes /classes/Product.php:6021
2182
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 5971
ORDER BY f.position ASC
6.240 ms 5 Yes /classes/Product.php:6021
4472
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (8393) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
5.940 ms 1 Yes Yes /classes/Product.php:4524
3678
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3777
ORDER BY `position`
5.905 ms 2 Yes /classes/Product.php:3545
1049
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2629 AND id_shop=1 LIMIT 1
5.745 ms 1 /classes/Product.php:6876
3540
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3254
ORDER BY `position`
5.733 ms 1 Yes /classes/Product.php:3545
438
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2652
ORDER BY `id_specific_price_priority` DESC LIMIT 1
5.687 ms 0 /classes/SpecificPrice.php:259
359
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3743 LIMIT 1
5.678 ms 10 /classes/SpecificPrice.php:435
3335
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2691) AND (b.`id_shop` = 1) LIMIT 1
5.481 ms 1 /src/Adapter/EntityMapper.php:71
831
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2781 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2781 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
5.474 ms 0 /classes/Cart.php:1430
103
SELECT SQL_NO_CACHE h.id_hook, h.name as h_name, title, description, h.position, hm.position as hm_position, m.id_module, m.name, m.active
FROM `hgt78_hook_module` hm
STRAIGHT_JOIN `hgt78_hook` h ON (h.id_hook = hm.id_hook AND hm.id_shop = 1)
STRAIGHT_JOIN `hgt78_module` as m ON (m.id_module = hm.id_module)
ORDER BY hm.position
5.201 ms 721 /classes/Hook.php:459
3022
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 10069 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
5.141 ms 10 Yes /classes/SpecificPrice.php:576
3669
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3771
ORDER BY `position`
5.090 ms 1 Yes /classes/Product.php:3545
2792
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 9321 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 9321 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
5.058 ms 0 /classes/Cart.php:1430
3677
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3777) AND (b.`id_shop` = 1) LIMIT 1
5.043 ms 1 /src/Adapter/EntityMapper.php:71
2731
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 8419)
4.979 ms 1 /classes/Product.php:3860
1123
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2624
ORDER BY `id_specific_price_priority` DESC LIMIT 1
4.930 ms 0 /classes/SpecificPrice.php:259
2831
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 9535 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
4.870 ms 10 Yes /classes/SpecificPrice.php:576
2082
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 5283
ORDER BY f.position ASC
4.742 ms 5 Yes /classes/Product.php:6021
3311
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2773) AND (b.`id_shop` = 1) LIMIT 1
4.725 ms 1 /src/Adapter/EntityMapper.php:71
2200
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 5973 AND id_shop=1 LIMIT 1
4.719 ms 1 /classes/Product.php:6876
3390
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2794
ORDER BY `position`
4.708 ms 1 Yes /classes/Product.php:3545
3310
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2770
4.650 ms 1 /classes/Product.php:2902
1687
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3750 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
4.648 ms 10 Yes /classes/SpecificPrice.php:576
3676
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3776
4.605 ms 1 /classes/Product.php:2902
2136
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 5589) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
4.598 ms 1 /classes/stock/StockAvailable.php:453
4473
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (8395) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
4.526 ms 1 Yes Yes /classes/Product.php:4524
2142
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 5590
ORDER BY `id_specific_price_priority` DESC LIMIT 1
4.461 ms 0 /classes/SpecificPrice.php:259
14
SELECT SQL_NO_CACHE h.`name` as hook, m.`id_module`, h.`id_hook`, m.`name` as module
FROM `hgt78_module` m
INNER JOIN hgt78_module_shop module_shop
ON (module_shop.id_module = m.id_module AND module_shop.id_shop = 1 AND module_shop.enable_device & 1)
INNER JOIN `hgt78_hook_module` `hm` ON hm.`id_module` = m.`id_module`
INNER JOIN `hgt78_hook` `h` ON hm.`id_hook` = h.`id_hook`
LEFT JOIN `hgt78_module_group` `mg` ON mg.`id_module` = m.`id_module`
WHERE (h.`name` != "paymentOptions") AND (hm.`id_shop` = 1) AND (mg.id_shop = 1 AND  mg.`id_group` IN (1))
GROUP BY hm.id_hook, hm.id_module
ORDER BY hm.`position`
4.457 ms 219 Yes Yes /classes/Hook.php:1289
3312
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2773
ORDER BY `position`
4.428 ms 1 Yes /classes/Product.php:3545
1107
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2622 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2622 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
4.399 ms 0 /classes/Cart.php:1430
374
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3741 AND id_shop=1 LIMIT 1
4.396 ms 1 /classes/Product.php:6876
343
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 5133) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
4.369 ms 1 /classes/stock/StockAvailable.php:453
3402
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3179
ORDER BY `position`
4.365 ms 1 Yes /classes/Product.php:3545
3668
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3771) AND (b.`id_shop` = 1) LIMIT 1
4.343 ms 1 /src/Adapter/EntityMapper.php:71
2571
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 7943
AND image_shop.`cover` = 1 LIMIT 1
4.317 ms 1 /classes/Product.php:3570
1315
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2644) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
4.299 ms 1 /classes/stock/StockAvailable.php:453
2953
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 9693 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
4.276 ms 11 Yes /classes/SpecificPrice.php:576
3381
SELECT SQL_NO_CACHE h.`name` as hook, m.`id_module`, h.`id_hook`, m.`name` as module
FROM `hgt78_module` m
INNER JOIN hgt78_module_shop module_shop
ON (module_shop.id_module = m.id_module AND module_shop.id_shop = 1 AND module_shop.enable_device & 1)
INNER JOIN `hgt78_hook_module` `hm` ON hm.`id_module` = m.`id_module`
INNER JOIN `hgt78_hook` `h` ON hm.`id_hook` = h.`id_hook`
LEFT JOIN `hgt78_module_group` `mg` ON mg.`id_module` = m.`id_module`
WHERE (h.`name` != "paymentOptions") AND (hm.`id_shop` = 1) AND (mg.id_shop = 1 AND  mg.`id_group` IN (1))
GROUP BY hm.id_hook, hm.id_module
ORDER BY hm.`position`
4.254 ms 219 Yes Yes /classes/Hook.php:1289
2971
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 9695
AND image_shop.`cover` = 1 LIMIT 1
4.238 ms 1 /classes/Product.php:3570
3296
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2623) AND (b.`id_shop` = 1) LIMIT 1
4.221 ms 1 /src/Adapter/EntityMapper.php:71
19
SELECT SQL_NO_CACHE m.page, ml.url_rewrite, ml.id_lang
FROM `hgt78_meta` m
LEFT JOIN `hgt78_meta_lang` ml ON (m.id_meta = ml.id_meta AND ml.id_shop = 1 )
ORDER BY LENGTH(ml.url_rewrite) DESC
4.210 ms 129 Yes /classes/Dispatcher.php:654
3300
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2767
ORDER BY `position`
4.206 ms 1 Yes /classes/Product.php:3545
2191
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 5972) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
4.189 ms 1 /classes/stock/StockAvailable.php:453
48
SELECT SQL_NO_CACHE * FROM `hgt78_image_type` WHERE 1 AND `categories` = 1  ORDER BY `width` DESC, `height` DESC, `name`ASC
4.181 ms 8 Yes /classes/ImageType.php:109
445
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2652
ORDER BY f.position ASC
4.133 ms 5 Yes /classes/Product.php:6021
3524
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2643) AND (b.`id_shop` = 1) LIMIT 1
4.096 ms 1 /src/Adapter/EntityMapper.php:71
3672
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3775
ORDER BY `position`
4.091 ms 2 Yes /classes/Product.php:3545
1129
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2624 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2624 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
4.086 ms 0 /classes/Cart.php:1430
2105
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 5296
AND image_shop.`cover` = 1 LIMIT 1
4.046 ms 2 /classes/Product.php:3570
13
SELECT SQL_NO_CACHE lower(name) as name
FROM `hgt78_hook` h
WHERE (h.active = 1)
4.026 ms 1185 /classes/Hook.php:1388
4315
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2659) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
4.013 ms 1 Yes Yes /classes/Product.php:4524
1027
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2639 AND id_shop=1 LIMIT 1
3.988 ms 1 /classes/Product.php:6876
2151
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 198 LIMIT 1
3.936 ms 1 /classes/Product.php:5659
3404
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2788) AND (b.`id_shop` = 1) LIMIT 1
3.929 ms 1 /src/Adapter/EntityMapper.php:71
3073
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 10073 AND `id_group` = 1 LIMIT 1
3.918 ms 0 /classes/GroupReduction.php:156
429
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2660)
3.917 ms 1 /classes/Product.php:3860
2125
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 5093 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 5093 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
3.895 ms 0 /classes/Cart.php:1430
1063
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2628 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2628 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
3.867 ms 0 /classes/Cart.php:1430
402
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 185 LIMIT 1
3.818 ms 1 /classes/Product.php:5659
1201
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2648 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
3.812 ms 10 Yes /classes/SpecificPrice.php:576
1089
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3459 LIMIT 1
3.812 ms 10 /classes/SpecificPrice.php:435
3686
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3806) AND (b.`id_shop` = 1) LIMIT 1
3.775 ms 1 /src/Adapter/EntityMapper.php:71
2859
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 9597
ORDER BY f.position ASC
3.762 ms 5 Yes /classes/Product.php:6021
2758
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 8975
ORDER BY f.position ASC
3.737 ms 5 Yes /classes/Product.php:6021
3314
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2774) AND (b.`id_shop` = 1) LIMIT 1
3.728 ms 1 /src/Adapter/EntityMapper.php:71
2793
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 9321
ORDER BY f.position ASC
3.726 ms 5 Yes /classes/Product.php:6021
2888
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 9686)
3.724 ms 1 /classes/Product.php:3860
2066
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 5282)
3.709 ms 1 /classes/Product.php:3860
3182
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 12551)
3.706 ms 1 /classes/Product.php:3860
4217
SELECT SQL_NO_CACHE c.*, cl.*
FROM `hgt78_category` c
INNER JOIN hgt78_category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1)
LEFT JOIN `hgt78_category_lang` cl ON c.`id_category` = cl.`id_category` AND cl.id_shop = 1 
LEFT JOIN `hgt78_category_group` cg ON c.`id_category` = cg.`id_category`
RIGHT JOIN `hgt78_category` c2 ON c2.`id_category` = 36 AND c.`nleft` >= c2.`nleft` AND c.`nright` <= c2.`nright`
WHERE 1  AND `id_lang` = 1
AND c.`active` = 1
AND cg.`id_group` IN (1)
GROUP BY c.`id_category`
ORDER BY c.`level_depth` ASC
, category_shop.`position` ASC
3.693 ms 73 Yes Yes /classes/Category.php:799
82
SELECT SQL_NO_CACHE type, id_value, filter_show_limit, filter_type FROM hgt78_layered_category
WHERE controller = 'category'
AND id_category = 2
AND id_shop = 1
GROUP BY `type`, id_value ORDER BY position ASC
3.688 ms 12 Yes Yes /modules/ps_facetedsearch/src/Filters/Provider.php:61
3675
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3776
ORDER BY `position`
3.662 ms 2 Yes /classes/Product.php:3545
3670
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3771
3.661 ms 1 /classes/Product.php:2902
384
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3740)
3.658 ms 1 /classes/Product.php:3860
1170
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2640 AND id_shop=1 LIMIT 1
3.645 ms 1 /classes/Product.php:6876
3104
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 10298)
3.609 ms 1 /classes/Product.php:3860
917
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2659 AND `id_group` = 1 LIMIT 1
3.604 ms 0 /classes/GroupReduction.php:156
3405
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2788
ORDER BY `position`
3.562 ms 1 Yes /classes/Product.php:3545
396
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3587 AND id_shop=1 LIMIT 1
3.560 ms 1 /classes/Product.php:6876
4340
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2656) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
3.542 ms 1 Yes Yes /classes/Product.php:4524
3667
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3766
3.490 ms 1 /classes/Product.php:2902
3671
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3775) AND (b.`id_shop` = 1) LIMIT 1
3.476 ms 1 /src/Adapter/EntityMapper.php:71
2899
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 9688)
3.459 ms 1 /classes/Product.php:3860
1160
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2627 AND `id_group` = 1 LIMIT 1
3.424 ms 0 /classes/GroupReduction.php:156
2776
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 9055)
3.407 ms 1 /classes/Product.php:3860
2811
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 9324 AND id_shop=1 LIMIT 1
3.402 ms 1 /classes/Product.php:6876
2130
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 5589 LIMIT 1
3.394 ms 10 /classes/SpecificPrice.php:435
1009
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2637
ORDER BY f.position ASC
3.387 ms 5 Yes /classes/Product.php:6021
2981
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 9695
ORDER BY f.position ASC
3.373 ms 5 Yes /classes/Product.php:6021
1703
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3751 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3751 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
3.368 ms 0 /classes/Cart.php:1430
3827
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 6187) AND (b.`id_shop` = 1) LIMIT 1
3.353 ms 1 /src/Adapter/EntityMapper.php:71
34
SELECT SQL_NO_CACHE id_shop
FROM `hgt78_currency_shop`
WHERE `id_currency` = 1
AND id_shop = 1 LIMIT 1
3.350 ms 1 /classes/ObjectModel.php:1729
1224
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3456)
3.342 ms 1 /classes/Product.php:3860
3163
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 10305 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 10305 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
3.333 ms 0 /classes/Cart.php:1430
349
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4902
ORDER BY `id_specific_price_priority` DESC LIMIT 1
3.332 ms 0 /classes/SpecificPrice.php:259
3688
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3806
3.325 ms 1 /classes/Product.php:2902
3323
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2766) AND (b.`id_shop` = 1) LIMIT 1
3.306 ms 1 /src/Adapter/EntityMapper.php:71
3294
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2651
ORDER BY `position`
3.277 ms 1 Yes /classes/Product.php:3545
1020
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2638
ORDER BY f.position ASC
3.273 ms 5 Yes /classes/Product.php:6021
1217
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2657 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2657 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
3.255 ms 0 /classes/Cart.php:1430
3538
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3252
3.228 ms 1 /classes/Product.php:2902
3064
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 10072
ORDER BY f.position ASC
3.216 ms 5 Yes /classes/Product.php:6021
3317
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2775) AND (b.`id_shop` = 1) LIMIT 1
3.213 ms 1 /src/Adapter/EntityMapper.php:71
1671
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3748
ORDER BY f.position ASC
3.195 ms 5 Yes /classes/Product.php:6021
1008
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2637 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2637 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
3.182 ms 0 /classes/Cart.php:1430
1134
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2625
ORDER BY `id_specific_price_priority` DESC LIMIT 1
3.174 ms 0 /classes/SpecificPrice.php:259
101
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 7543 AND id_shop=1 LIMIT 1
3.152 ms 1 /classes/Product.php:6876
2864
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 9598 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
3.134 ms 10 Yes /classes/SpecificPrice.php:576
2115
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 5296
ORDER BY f.position ASC
3.131 ms 5 Yes /classes/Product.php:6021
1018
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2638) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
3.108 ms 1 /classes/stock/StockAvailable.php:453
1726
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3753
ORDER BY f.position ASC
3.102 ms 5 Yes /classes/Product.php:6021
2799
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 9323)
3.095 ms 1 /classes/Product.php:3860
3673
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3775
3.078 ms 1 /classes/Product.php:2902
1079
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2620
ORDER BY `id_specific_price_priority` DESC LIMIT 1
3.077 ms 0 /classes/SpecificPrice.php:259
4448
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (6185) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
3.061 ms 1 Yes Yes /classes/Product.php:4524
2196
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 5973 LIMIT 1
3.049 ms 10 /classes/SpecificPrice.php:435
354
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4902) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
3.041 ms 1 /classes/stock/StockAvailable.php:453
3330
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2661
ORDER BY `position`
3.020 ms 1 Yes /classes/Product.php:3545
3542
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3264) AND (b.`id_shop` = 1) LIMIT 1
3.005 ms 1 /src/Adapter/EntityMapper.php:71
3353
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2777) AND (b.`id_shop` = 1) LIMIT 1
3.002 ms 1 /src/Adapter/EntityMapper.php:71
391
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 185 LIMIT 1
2.995 ms 1 /classes/Product.php:5659
89
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 7543
AND image_shop.`cover` = 1 LIMIT 1
2.969 ms 1 /classes/Product.php:3570
346
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4902
AND image_shop.`cover` = 1 LIMIT 1
2.968 ms 1 /classes/Product.php:3570
2692
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 8397
ORDER BY f.position ASC
2.960 ms 5 Yes /classes/Product.php:6021
3044
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 10071 LIMIT 1
2.959 ms 10 /classes/SpecificPrice.php:435
4470
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (7773) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
2.957 ms 1 Yes Yes /classes/Product.php:4524
411
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2893
ORDER BY f.position ASC
2.951 ms 5 Yes /classes/Product.php:6021
3510
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2649
ORDER BY `position`
2.951 ms 1 Yes /classes/Product.php:3545
4072
SELECT SQL_NO_CACHE c.*, cl.*
FROM `hgt78_category` c
INNER JOIN hgt78_category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1)
LEFT JOIN `hgt78_category_lang` cl ON c.`id_category` = cl.`id_category` AND cl.id_shop = 1 
LEFT JOIN `hgt78_category_group` cg ON c.`id_category` = cg.`id_category`
RIGHT JOIN `hgt78_category` c2 ON c2.`id_category` = 40 AND c.`nleft` >= c2.`nleft` AND c.`nright` <= c2.`nright`
WHERE 1  AND `id_lang` = 1
AND c.`active` = 1
AND cg.`id_group` IN (1)
GROUP BY c.`id_category`
ORDER BY c.`level_depth` ASC
, category_shop.`position` ASC
2.936 ms 73 Yes Yes /classes/Category.php:799
1043
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2629
AND image_shop.`cover` = 1 LIMIT 1
2.897 ms 1 /classes/Product.php:3570
3691
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3807
2.889 ms 1 /classes/Product.php:2902
4455
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (6193) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
2.889 ms 1 Yes Yes /classes/Product.php:4524
99
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 7543 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
2.882 ms 9 Yes /classes/SpecificPrice.php:576
369
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 185 LIMIT 1
2.859 ms 1 /classes/Product.php:5659
421
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2694 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2694 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
2.857 ms 0 /classes/Cart.php:1430
358
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 185 LIMIT 1
2.850 ms 1 /classes/Product.php:5659
417
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2694)
2.833 ms 1 /classes/Product.php:3860
1644
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3746)
2.826 ms 1 /classes/Product.php:3860
4476
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (8401) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
2.818 ms 1 Yes Yes /classes/Product.php:4524
2843
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 9596)
2.816 ms 1 /classes/Product.php:3860
350
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4902 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
2.808 ms 10 Yes /classes/SpecificPrice.php:576
3690
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3807
ORDER BY `position`
2.802 ms 1 Yes /classes/Product.php:3545
3631
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3749
2.797 ms 1 /classes/Product.php:2902
1208
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2657
AND image_shop.`cover` = 1 LIMIT 1
2.787 ms 1 /classes/Product.php:3570
4469
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (7769) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
2.786 ms 1 Yes Yes /classes/Product.php:4524
4350
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2655) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
2.782 ms 1 Yes Yes /classes/Product.php:4524
3555
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2818
ORDER BY `position`
2.772 ms 1 Yes /classes/Product.php:3545
3536
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3252) AND (b.`id_shop` = 1) LIMIT 1
2.771 ms 1 /src/Adapter/EntityMapper.php:71
3396
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2780
ORDER BY `position`
2.756 ms 1 Yes /classes/Product.php:3545
52
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 44) AND (b.`id_shop` = 1) LIMIT 1
2.735 ms 1 /src/Adapter/EntityMapper.php:71
2920
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 9690 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
2.732 ms 11 Yes /classes/SpecificPrice.php:576
2144
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 5590)
2.728 ms 1 /classes/Product.php:3860
351
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4902)
2.725 ms 1 /classes/Product.php:3860
2211
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 6047)
2.708 ms 1 /classes/Product.php:3860
2059
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4966 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4966 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
2.702 ms 0 /classes/Cart.php:1430
2207
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 178 LIMIT 1
2.693 ms 1 /classes/Product.php:5659
2682
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 8397
AND image_shop.`cover` = 1 LIMIT 1
2.689 ms 1 /classes/Product.php:3570
2077
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 5283)
2.680 ms 1 /classes/Product.php:3860
1145
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2626
ORDER BY `id_specific_price_priority` DESC LIMIT 1
2.679 ms 0 /classes/SpecificPrice.php:259
1132
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
2.661 ms 1 /classes/Product.php:5659
2222
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 6107)
2.658 ms 1 /classes/Product.php:3860
2809
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 9324 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
2.647 ms 10 Yes /classes/SpecificPrice.php:576
2968
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 9694) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
2.612 ms 1 /classes/stock/StockAvailable.php:453
4084
SELECT SQL_NO_CACHE c.*, cl.*
FROM `hgt78_category` c
INNER JOIN hgt78_category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1)
LEFT JOIN `hgt78_category_lang` cl ON c.`id_category` = cl.`id_category` AND cl.id_shop = 1 
LEFT JOIN `hgt78_category_group` cg ON c.`id_category` = cg.`id_category`
RIGHT JOIN `hgt78_category` c2 ON c2.`id_category` = 38 AND c.`nleft` >= c2.`nleft` AND c.`nright` <= c2.`nright`
WHERE 1  AND `id_lang` = 1
AND c.`active` = 1
AND cg.`id_group` IN (1)
GROUP BY c.`id_category`
ORDER BY c.`level_depth` ASC
, category_shop.`position` ASC
2.610 ms 93 Yes Yes /classes/Category.php:799
2740
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 8420
ORDER BY `id_specific_price_priority` DESC LIMIT 1
2.608 ms 0 /classes/SpecificPrice.php:259
3318
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2775
ORDER BY `position`
2.606 ms 1 Yes /classes/Product.php:3545
2697
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 8401 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
2.587 ms 10 Yes /classes/SpecificPrice.php:576
1665
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3748 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
2.586 ms 10 Yes /classes/SpecificPrice.php:576
1128
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2624) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
2.585 ms 1 /classes/stock/StockAvailable.php:453
444
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2652 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2652 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
2.584 ms 0 /classes/Cart.php:1430
2054
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4966 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
2.580 ms 10 Yes /classes/SpecificPrice.php:576
2839
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
2.574 ms 1 /classes/Product.php:5659
1221
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3456 LIMIT 1
2.571 ms 10 /classes/SpecificPrice.php:435
1663
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3748 LIMIT 1
2.551 ms 10 /classes/SpecificPrice.php:435
923
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2635 LIMIT 1
2.546 ms 10 /classes/SpecificPrice.php:435
2241
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 6129 LIMIT 1
2.531 ms 10 /classes/SpecificPrice.php:435
3174
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 12552) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
2.530 ms 1 /classes/stock/StockAvailable.php:453
42
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 34) AND (b.`id_shop` = 1) LIMIT 1
2.526 ms 1 /src/Adapter/EntityMapper.php:71
4453
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (6191) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
2.525 ms 1 Yes Yes /classes/Product.php:4524
1207
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2648
ORDER BY f.position ASC
2.522 ms 5 Yes /classes/Product.php:6021
2937
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 9691
ORDER BY f.position ASC
2.521 ms 5 Yes /classes/Product.php:6021
2932
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 9691)
2.520 ms 1 /classes/Product.php:3860
3179
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 12551 LIMIT 1
2.514 ms 10 /classes/SpecificPrice.php:435
4
SELECT SQL_NO_CACHE *
FROM `hgt78_shop` a
WHERE (a.`id_shop` = 1) LIMIT 1
2.513 ms 1 /src/Adapter/EntityMapper.php:71
2798
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 9323 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
2.511 ms 10 Yes /classes/SpecificPrice.php:576
2568
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 7942) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
2.506 ms 1 /classes/stock/StockAvailable.php:453
2775
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 9055 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
2.495 ms 13 Yes /classes/SpecificPrice.php:576
2099
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 5293)
2.462 ms 1 /classes/Product.php:3860
1317
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2644
ORDER BY f.position ASC
2.457 ms 5 Yes /classes/Product.php:6021
356
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4902
ORDER BY f.position ASC
2.448 ms 5 Yes /classes/Product.php:6021
1732
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3754)
2.440 ms 1 /classes/Product.php:3860
3414
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2791
ORDER BY `position`
2.426 ms 1 Yes /classes/Product.php:3545
3543
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3264
ORDER BY `position`
2.415 ms 1 Yes /classes/Product.php:3545
2846
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 9596) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
2.411 ms 1 /classes/stock/StockAvailable.php:453
20
SELECT SQL_NO_CACHE * FROM `hgt78_hook_module_exceptions`
WHERE `id_shop` IN (1)
2.383 ms 1 /classes/module/Module.php:2046
2218
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 178 LIMIT 1
2.376 ms 1 /classes/Product.php:5659
2922
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 9690 AND id_shop=1 LIMIT 1
2.360 ms 1 /classes/Product.php:6876
1213
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2657)
2.358 ms 1 /classes/Product.php:3860
2752
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 8975 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
2.332 ms 16 Yes /classes/SpecificPrice.php:576
344
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 5133 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 5133 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
2.327 ms 0 /classes/Cart.php:1430
2948
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 9692
ORDER BY f.position ASC
2.323 ms 5 Yes /classes/Product.php:6021
2794
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 9323
AND image_shop.`cover` = 1 LIMIT 1
2.321 ms 1 /classes/Product.php:3570
1689
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3750 AND id_shop=1 LIMIT 1
2.316 ms 1 /classes/Product.php:6876
2632
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 7773)
2.316 ms 1 /classes/Product.php:3860
66
SELECT SQL_NO_CACHE *
FROM `hgt78_country` a
LEFT JOIN `hgt78_country_shop` `c` ON a.`id_country` = c.`id_country` AND c.`id_shop` = 1
WHERE (a.`id_country` = 8) LIMIT 1
2.315 ms 1 /src/Adapter/EntityMapper.php:71
2094
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 5293
AND image_shop.`cover` = 1 LIMIT 1
2.315 ms 2 /classes/Product.php:3570
2735
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 8419 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 8419 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
2.310 ms 0 /classes/Cart.php:1430
2949
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 9693
AND image_shop.`cover` = 1 LIMIT 1
2.305 ms 1 /classes/Product.php:3570
385
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3740 AND id_shop=1 LIMIT 1
2.304 ms 1 /classes/Product.php:6876
1709
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3752 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
2.299 ms 10 Yes /classes/SpecificPrice.php:576
2858
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 9597 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 9597 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
2.296 ms 0 /classes/Cart.php:1430
4465
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (7943) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
2.294 ms 1 Yes Yes /classes/Product.php:4524
2647
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 8392 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 8392 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
2.294 ms 0 /classes/Cart.php:1430
1024
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2639
ORDER BY `id_specific_price_priority` DESC LIMIT 1
2.284 ms 0 /classes/SpecificPrice.php:259
3063
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 10072 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 10072 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
2.284 ms 0 /classes/Cart.php:1430
2631
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 7773 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
2.283 ms 10 Yes /classes/SpecificPrice.php:576
1428
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3099 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3099 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
2.273 ms 0 /classes/Cart.php:1430
2804
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 9323
ORDER BY f.position ASC
2.270 ms 5 Yes /classes/Product.php:6021
2876
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 9687 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
2.267 ms 11 Yes /classes/SpecificPrice.php:576
3590
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3455) AND (b.`id_shop` = 1) LIMIT 1
2.267 ms 1 /src/Adapter/EntityMapper.php:71
4120
SELECT SQL_NO_CACHE c.*, cl.*
FROM `hgt78_category` c
INNER JOIN hgt78_category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1)
LEFT JOIN `hgt78_category_lang` cl ON c.`id_category` = cl.`id_category` AND cl.id_shop = 1 
LEFT JOIN `hgt78_category_group` cg ON c.`id_category` = cg.`id_category`
RIGHT JOIN `hgt78_category` c2 ON c2.`id_category` = 70 AND c.`nleft` >= c2.`nleft` AND c.`nright` <= c2.`nright`
WHERE 1  AND `id_lang` = 1
AND c.`active` = 1
AND cg.`id_group` IN (1)
GROUP BY c.`id_category`
ORDER BY c.`level_depth` ASC
, category_shop.`position` ASC
2.261 ms 11 Yes Yes /classes/Category.php:799
2147
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 5590) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
2.257 ms 1 /classes/stock/StockAvailable.php:453
1136
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2625)
2.245 ms 1 /classes/Product.php:3860
1205
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2648) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
2.230 ms 1 /classes/stock/StockAvailable.php:453
958
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2633 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
2.225 ms 10 Yes /classes/SpecificPrice.php:576
1312
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2644)
2.217 ms 1 /classes/Product.php:3860
1842
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3776 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
2.216 ms 10 Yes /classes/SpecificPrice.php:576
2133
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 5589)
2.215 ms 1 /classes/Product.php:3860
2987
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 9697)
2.192 ms 1 /classes/Product.php:3860
2726
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 8419
AND image_shop.`cover` = 1 LIMIT 1
2.184 ms 1 /classes/Product.php:3570
3319
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2775
2.184 ms 1 /classes/Product.php:2902
1214
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2657 AND id_shop=1 LIMIT 1
2.182 ms 1 /classes/Product.php:6876
1693
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3750
ORDER BY f.position ASC
2.180 ms 5 Yes /classes/Product.php:6021
2447
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 6191
ORDER BY f.position ASC
2.175 ms 5 Yes /classes/Product.php:6021
3147
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 10304 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
2.174 ms 10 Yes /classes/SpecificPrice.php:576
886
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2791 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2791 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
2.160 ms 0 /classes/Cart.php:1430
40
SELECT SQL_NO_CACHE c.*, cl.`id_lang`, cl.`name`, cl.`description`, cl.`additional_description`, cl.`link_rewrite`, cl.`meta_title`, cl.`meta_keywords`, cl.`meta_description`
FROM `hgt78_category` c
INNER JOIN hgt78_category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1)
LEFT JOIN `hgt78_category_lang` cl ON (c.`id_category` = cl.`id_category` AND `id_lang` = 1  AND cl.id_shop = 1 )
LEFT JOIN `hgt78_category_group` cg ON (cg.`id_category` = c.`id_category`)
WHERE `id_parent` = 2
AND `active` = 1
AND cg.`id_group` =1
GROUP BY c.`id_category`
ORDER BY `level_depth` ASC, category_shop.`position` ASC
2.158 ms 31 Yes Yes /classes/Category.php:924
2027
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4963
ORDER BY f.position ASC
2.156 ms 5 Yes /classes/Product.php:6021
2113
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 5296) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
2.148 ms 1 /classes/stock/StockAvailable.php:453
3594
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3484
ORDER BY `position`
2.135 ms 1 Yes /classes/Product.php:3545
4282
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2776) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
2.102 ms 1 Yes Yes /classes/Product.php:4524
2761
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 8976 LIMIT 1
2.099 ms 16 /classes/SpecificPrice.php:435
3506
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3456) AND (b.`id_shop` = 1) LIMIT 1
2.099 ms 1 /src/Adapter/EntityMapper.php:71
2415
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 6188
AND image_shop.`cover` = 1 LIMIT 1
2.089 ms 1 /classes/Product.php:3570
3820
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 6184
2.089 ms 1 /classes/Product.php:2902
1270
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2646 AND `id_group` = 1 LIMIT 1
2.086 ms 0 /classes/GroupReduction.php:156
1427
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3099) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
2.081 ms 1 /classes/stock/StockAvailable.php:453
3554
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2818) AND (b.`id_shop` = 1) LIMIT 1
2.078 ms 1 /src/Adapter/EntityMapper.php:71
4451
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (6188) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
2.074 ms 1 Yes Yes /classes/Product.php:4524
3530
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2644) AND (b.`id_shop` = 1) LIMIT 1
2.071 ms 1 /src/Adapter/EntityMapper.php:71
3021
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 10069
ORDER BY `id_specific_price_priority` DESC LIMIT 1
2.069 ms 1 /classes/SpecificPrice.php:259
2187
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 5972 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
2.066 ms 10 Yes /classes/SpecificPrice.php:576
2829
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 9535 LIMIT 1
2.061 ms 10 /classes/SpecificPrice.php:435
2928
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 334 LIMIT 1
2.060 ms 1 /classes/Product.php:5659
2885
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 9686 LIMIT 1
2.048 ms 11 /classes/SpecificPrice.php:435
3380
SELECT SQL_NO_CACHE lower(name) as name
FROM `hgt78_hook` h
WHERE (h.active = 1)
2.030 ms 1185 /classes/Hook.php:1388
4106
SELECT SQL_NO_CACHE c.*, cl.*
FROM `hgt78_category` c
INNER JOIN hgt78_category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1)
LEFT JOIN `hgt78_category_lang` cl ON c.`id_category` = cl.`id_category` AND cl.id_shop = 1 
LEFT JOIN `hgt78_category_group` cg ON c.`id_category` = cg.`id_category`
RIGHT JOIN `hgt78_category` c2 ON c2.`id_category` = 41 AND c.`nleft` >= c2.`nleft` AND c.`nright` <= c2.`nright`
WHERE 1  AND `id_lang` = 1
AND c.`active` = 1
AND cg.`id_group` IN (1)
GROUP BY c.`id_category`
ORDER BY c.`level_depth` ASC
, category_shop.`position` ASC
2.028 ms 7 Yes Yes /classes/Category.php:799
4457
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (6195) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
2.025 ms 1 Yes Yes /classes/Product.php:4524
1655
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3747)
2.025 ms 1 /classes/Product.php:3860
353
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4902 AND `id_group` = 1 LIMIT 1
2.019 ms 0 /classes/GroupReduction.php:156
887
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2791
ORDER BY f.position ASC
2.015 ms 5 Yes /classes/Product.php:6021
3374
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2800) AND (b.`id_shop` = 1) LIMIT 1
2.000 ms 1 /src/Adapter/EntityMapper.php:71
3141
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 10303 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 10303 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.998 ms 0 /classes/Cart.php:1430
2608
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 7946 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.994 ms 10 Yes /classes/SpecificPrice.php:576
2693
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 8401
AND image_shop.`cover` = 1 LIMIT 1
1.993 ms 1 /classes/Product.php:3570
2767
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 8976) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
1.992 ms 1 /classes/stock/StockAvailable.php:453
4287
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2691) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.980 ms 1 Yes Yes /classes/Product.php:4524
2719
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 8418 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.979 ms 10 Yes /classes/SpecificPrice.php:576
2177
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 5971)
1.975 ms 1 /classes/Product.php:3860
3869
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 7942) AND (b.`id_shop` = 1) LIMIT 1
1.973 ms 1 /src/Adapter/EntityMapper.php:71
921
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2635
AND image_shop.`cover` = 1 LIMIT 1
1.950 ms 1 /classes/Product.php:3570
3596
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3556) AND (b.`id_shop` = 1) LIMIT 1
1.937 ms 1 /src/Adapter/EntityMapper.php:71
2156
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 5591 AND id_shop=1 LIMIT 1
1.935 ms 1 /classes/Product.php:6876
1424
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3099)
1.927 ms 1 /classes/Product.php:3860
4345
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2658) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.926 ms 1 Yes Yes /classes/Product.php:4524
4458
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (6499) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.921 ms 1 Yes Yes /classes/Product.php:4524
39
SELECT SQL_NO_CACHE ctg.`id_group`
FROM hgt78_category_group ctg
WHERE ctg.`id_category` = 2 AND ctg.`id_group` = 1 LIMIT 1
1.919 ms 1 /classes/Category.php:1754
4354
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3254) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.917 ms 1 Yes Yes /classes/Product.php:4524
2853
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 9597 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.916 ms 11 Yes /classes/SpecificPrice.php:576
3171
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 12552)
1.912 ms 1 /classes/Product.php:3860
4348
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2642) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.909 ms 1 Yes Yes /classes/Product.php:4524
997
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2636 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2636 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.909 ms 0 /classes/Cart.php:1430
1429
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3099
ORDER BY f.position ASC
1.907 ms 5 Yes /classes/Product.php:6021
2763
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 8976 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.906 ms 16 Yes /classes/SpecificPrice.php:576
2277
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 6174)
1.901 ms 1 /classes/Product.php:3860
4110
SELECT SQL_NO_CACHE c.*, cl.*
FROM `hgt78_category` c
INNER JOIN hgt78_category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1)
LEFT JOIN `hgt78_category_lang` cl ON c.`id_category` = cl.`id_category` AND cl.id_shop = 1 
LEFT JOIN `hgt78_category_group` cg ON c.`id_category` = cg.`id_category`
RIGHT JOIN `hgt78_category` c2 ON c2.`id_category` = 45 AND c.`nleft` >= c2.`nleft` AND c.`nright` <= c2.`nright`
WHERE 1  AND `id_lang` = 1
AND c.`active` = 1
AND cg.`id_group` IN (1)
GROUP BY c.`id_category`
ORDER BY c.`level_depth` ASC
, category_shop.`position` ASC
1.898 ms 8 Yes Yes /classes/Category.php:799
1106
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2622) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
1.893 ms 1 /classes/stock/StockAvailable.php:453
1103
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2622)
1.890 ms 1 /classes/Product.php:3860
3075
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 10073 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 10073 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.890 ms 0 /classes/Cart.php:1430
3692
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3808) AND (b.`id_shop` = 1) LIMIT 1
1.888 ms 1 /src/Adapter/EntityMapper.php:71
348
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4902 LIMIT 1
1.887 ms 10 /classes/SpecificPrice.php:435
1915
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3808
ORDER BY f.position ASC
1.884 ms 5 Yes /classes/Product.php:6021
2446
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 6191 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 6191 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.884 ms 0 /classes/Cart.php:1430
1713
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3752) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
1.876 ms 1 /classes/stock/StockAvailable.php:453
2469
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 6193
ORDER BY f.position ASC
1.875 ms 5 Yes /classes/Product.php:6021
4342
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2657) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.874 ms 1 Yes Yes /classes/Product.php:4524
2691
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 8397 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 8397 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.869 ms 0 /classes/Cart.php:1430
2698
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 8401)
1.868 ms 1 /classes/Product.php:3860
3043
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 10071) AND (b.`id_shop` = 1) LIMIT 1
1.867 ms 1 /src/Adapter/EntityMapper.php:71
3674
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3776) AND (b.`id_shop` = 1) LIMIT 1
1.865 ms 1 /src/Adapter/EntityMapper.php:71
1776
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3763 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.857 ms 11 Yes /classes/SpecificPrice.php:576
986
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2782 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2782 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.855 ms 0 /classes/Cart.php:1430
1774
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3763 LIMIT 1
1.850 ms 11 /classes/SpecificPrice.php:435
4310
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2789) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.847 ms 1 Yes Yes /classes/Product.php:4524
3058
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 10072 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.845 ms 10 Yes /classes/SpecificPrice.php:576
3392
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2793) AND (b.`id_shop` = 1) LIMIT 1
1.839 ms 1 /src/Adapter/EntityMapper.php:71
2881
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 9687 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 9687 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.831 ms 0 /classes/Cart.php:1430
1141
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2625
ORDER BY f.position ASC
1.830 ms 5 Yes /classes/Product.php:6021
2402
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 6186 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 6186 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.828 ms 0 /classes/Cart.php:1430
3799
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 6177
1.826 ms 1 /classes/Product.php:2902
3800
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 6178) AND (b.`id_shop` = 1) LIMIT 1
1.822 ms 1 /src/Adapter/EntityMapper.php:71
4256
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (5140) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.822 ms 1 Yes Yes /classes/Product.php:4524
3797
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 6177) AND (b.`id_shop` = 1) LIMIT 1
1.815 ms 1 /src/Adapter/EntityMapper.php:71
2314
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 6178 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 6178 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.814 ms 0 /classes/Cart.php:1430
1434
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3107 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.810 ms 10 Yes /classes/SpecificPrice.php:576
1872
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3805
AND image_shop.`cover` = 1 LIMIT 1
1.805 ms 1 /classes/Product.php:3570
1257
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2647)
1.804 ms 1 /classes/Product.php:3860
2430
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 6189 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.803 ms 10 Yes /classes/SpecificPrice.php:576
3276
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3740
ORDER BY `position`
1.797 ms 1 Yes /classes/Product.php:3545
53
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 319) AND (b.`id_shop` = 1) LIMIT 1
1.790 ms 1 /src/Adapter/EntityMapper.php:71
1059
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2628)
1.789 ms 1 /classes/Product.php:3860
1684
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
1.786 ms 1 /classes/Product.php:5659
3115
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 10299)
1.785 ms 1 /classes/Product.php:3860
3932
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 9323) AND (b.`id_shop` = 1) LIMIT 1
1.781 ms 1 /src/Adapter/EntityMapper.php:71
4132
SELECT SQL_NO_CACHE c.*, cl.*
FROM `hgt78_category` c
INNER JOIN hgt78_category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1)
LEFT JOIN `hgt78_category_lang` cl ON c.`id_category` = cl.`id_category` AND cl.id_shop = 1 
LEFT JOIN `hgt78_category_group` cg ON c.`id_category` = cg.`id_category`
RIGHT JOIN `hgt78_category` c2 ON c2.`id_category` = 35 AND c.`nleft` >= c2.`nleft` AND c.`nright` <= c2.`nright`
WHERE 1  AND `id_lang` = 1
AND c.`active` = 1
AND cg.`id_group` IN (1)
GROUP BY c.`id_category`
ORDER BY c.`level_depth` ASC
, category_shop.`position` ASC
1.777 ms 27 Yes Yes /classes/Category.php:799
2965
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 9694)
1.775 ms 1 /classes/Product.php:3860
2586
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 7944 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.769 ms 10 Yes /classes/SpecificPrice.php:576
3070
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 10073 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.768 ms 10 Yes /classes/SpecificPrice.php:576
3626
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3748) AND (b.`id_shop` = 1) LIMIT 1
1.766 ms 1 /src/Adapter/EntityMapper.php:71
1686
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3750
ORDER BY `id_specific_price_priority` DESC LIMIT 1
1.765 ms 0 /classes/SpecificPrice.php:259
123
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 7542 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 7542 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.763 ms 0 /classes/Cart.php:1430
2681
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 8396
ORDER BY f.position ASC
1.752 ms 5 Yes /classes/Product.php:6021
2143
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 5590 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.749 ms 10 Yes /classes/SpecificPrice.php:576
367
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3743
ORDER BY f.position ASC
1.744 ms 5 Yes /classes/Product.php:6021
2768
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 8976 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 8976 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.744 ms 0 /classes/Cart.php:1430
4291
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2738) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.744 ms 1 Yes Yes /classes/Product.php:4524
92
SELECT SQL_NO_CACHE `name`
FROM `hgt78_manufacturer`
WHERE `id_manufacturer` = 2
AND `active` = 1 LIMIT 1
1.740 ms 1 /classes/Manufacturer.php:316
2570
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 7942
ORDER BY f.position ASC
1.740 ms 5 Yes /classes/Product.php:6021
2702
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 8401 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 8401 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.735 ms 0 /classes/Cart.php:1430
3537
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3252
ORDER BY `position`
1.735 ms 1 Yes /classes/Product.php:3545
2377
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 6184 AND id_shop=1 LIMIT 1
1.734 ms 1 /classes/Product.php:6876
2387
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 6185)
1.734 ms 1 /classes/Product.php:3860
1648
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3746 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3746 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.732 ms 0 /classes/Cart.php:1430
4302
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3075) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.732 ms 1 Yes Yes /classes/Product.php:4524
4233
SELECT SQL_NO_CACHE c.*, cl.*
FROM `hgt78_category` c
INNER JOIN hgt78_category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1)
LEFT JOIN `hgt78_category_lang` cl ON c.`id_category` = cl.`id_category` AND cl.id_shop = 1 
LEFT JOIN `hgt78_category_group` cg ON c.`id_category` = cg.`id_category`
RIGHT JOIN `hgt78_category` c2 ON c2.`id_category` = 39 AND c.`nleft` >= c2.`nleft` AND c.`nright` <= c2.`nright`
WHERE 1  AND `id_lang` = 1
AND c.`active` = 1
AND cg.`id_group` IN (1)
GROUP BY c.`id_category`
ORDER BY c.`level_depth` ASC
, category_shop.`position` ASC
1.730 ms 73 Yes Yes /classes/Category.php:799
4337
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2627) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.726 ms 1 Yes Yes /classes/Product.php:4524
2244
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 6129)
1.718 ms 1 /classes/Product.php:3860
2121
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 5093)
1.712 ms 1 /classes/Product.php:3860
3266
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4902) AND (b.`id_shop` = 1) LIMIT 1
1.708 ms 1 /src/Adapter/EntityMapper.php:71
3085
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 10111) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
1.707 ms 1 /classes/stock/StockAvailable.php:453
2746
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 8420 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 8420 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.705 ms 0 /classes/Cart.php:1430
2188
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 5972)
1.702 ms 1 /classes/Product.php:3860
2943
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 9692)
1.701 ms 1 /classes/Product.php:3860
2265
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 6173 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.697 ms 10 Yes /classes/SpecificPrice.php:576
1831
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3775 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.694 ms 10 Yes /classes/SpecificPrice.php:576
2269
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 6173) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
1.691 ms 1 /classes/stock/StockAvailable.php:453
4129
SELECT SQL_NO_CACHE c.*, cl.*
FROM `hgt78_category` c
INNER JOIN hgt78_category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1)
LEFT JOIN `hgt78_category_lang` cl ON c.`id_category` = cl.`id_category` AND cl.id_shop = 1 
LEFT JOIN `hgt78_category_group` cg ON c.`id_category` = cg.`id_category`
RIGHT JOIN `hgt78_category` c2 ON c2.`id_category` = 200 AND c.`nleft` >= c2.`nleft` AND c.`nright` <= c2.`nright`
WHERE 1  AND `id_lang` = 1
AND c.`active` = 1
AND cg.`id_group` IN (1)
GROUP BY c.`id_category`
ORDER BY c.`level_depth` ASC
, category_shop.`position` ASC
1.688 ms 14 Yes Yes /classes/Category.php:799
439
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2652 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.684 ms 10 Yes /classes/SpecificPrice.php:576
2223
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 6107 AND id_shop=1 LIMIT 1
1.683 ms 1 /classes/Product.php:6876
1653
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3747
ORDER BY `id_specific_price_priority` DESC LIMIT 1
1.678 ms 0 /classes/SpecificPrice.php:259
2217
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 6107
AND image_shop.`cover` = 1 LIMIT 1
1.678 ms 1 /classes/Product.php:3570
2870
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 9598
ORDER BY f.position ASC
1.678 ms 5 Yes /classes/Product.php:6021
3269
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3743) AND (b.`id_shop` = 1) LIMIT 1
1.678 ms 1 /src/Adapter/EntityMapper.php:71
3072
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 10073 AND id_shop=1 LIMIT 1
1.677 ms 1 /classes/Product.php:6876
985
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2782) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
1.676 ms 1 /classes/stock/StockAvailable.php:453
2486
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 6195)
1.676 ms 1 /classes/Product.php:3860
1698
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3751 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.674 ms 10 Yes /classes/SpecificPrice.php:576
2636
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 7773 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 7773 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.672 ms 0 /classes/Cart.php:1430
3110
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 10299
AND image_shop.`cover` = 1 LIMIT 1
1.669 ms 1 /classes/Product.php:3570
1736
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3754 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3754 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.666 ms 0 /classes/Cart.php:1430
1003
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2637 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.662 ms 10 Yes /classes/SpecificPrice.php:576
4325
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2639) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.660 ms 1 Yes Yes /classes/Product.php:4524
2029
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
1.653 ms 1 /classes/Product.php:5659
355
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4902 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4902 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.653 ms 0 /classes/Cart.php:1430
1022
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
1.653 ms 1 /classes/Product.php:5659
2975
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 9695 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.651 ms 11 Yes /classes/SpecificPrice.php:576
1212
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2657 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.648 ms 10 Yes /classes/SpecificPrice.php:576
2714
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 8417
ORDER BY f.position ASC
1.648 ms 5 Yes /classes/Product.php:6021
3289
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2660
1.645 ms 1 /classes/Product.php:2902
87
SELECT SQL_NO_CACHE data FROM hgt78_layered_filter_block WHERE hash="61d8914cfe6c18bd9a8452cb6c016831" LIMIT 1
1.644 ms 1 /modules/ps_facetedsearch/src/Filters/Block.php:186
3051
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 10071 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 10071 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.642 ms 0 /classes/Cart.php:1430
11
SELECT SQL_NO_CACHE domain, domain_ssl
FROM hgt78_shop_url
WHERE main = 1
AND id_shop = 1 LIMIT 1
1.641 ms 1 /classes/shop/ShopUrl.php:182
1191
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2656)
1.641 ms 1 /classes/Product.php:3860
1815
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3766
ORDER BY f.position ASC
1.640 ms 5 Yes /classes/Product.php:6021
8
SELECT SQL_NO_CACHE *
FROM `hgt78_shop_group` a
WHERE (a.`id_shop_group` = 1) LIMIT 1
1.635 ms 1 /src/Adapter/EntityMapper.php:71
3275
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3740) AND (b.`id_shop` = 1) LIMIT 1
1.635 ms 1 /src/Adapter/EntityMapper.php:71
1119
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3458
ORDER BY f.position ASC
1.634 ms 5 Yes /classes/Product.php:6021
2898
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 9688 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.634 ms 11 Yes /classes/SpecificPrice.php:576
1898
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3807 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.630 ms 10 Yes /classes/SpecificPrice.php:576
9
SELECT SQL_NO_CACHE *
FROM `hgt78_lang` a
LEFT JOIN `hgt78_lang_shop` `c` ON a.`id_lang` = c.`id_lang` AND c.`id_shop` = 1
WHERE (a.`id_lang` = 1) LIMIT 1
1.625 ms 1 /src/Adapter/EntityMapper.php:71
4116
SELECT SQL_NO_CACHE c.*, cl.*
FROM `hgt78_category` c
INNER JOIN hgt78_category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1)
LEFT JOIN `hgt78_category_lang` cl ON c.`id_category` = cl.`id_category` AND cl.id_shop = 1 
LEFT JOIN `hgt78_category_group` cg ON c.`id_category` = cg.`id_category`
RIGHT JOIN `hgt78_category` c2 ON c2.`id_category` = 54 AND c.`nleft` >= c2.`nleft` AND c.`nright` <= c2.`nright`
WHERE 1  AND `id_lang` = 1
AND c.`active` = 1
AND cg.`id_group` IN (1)
GROUP BY c.`id_category`
ORDER BY c.`level_depth` ASC
, category_shop.`position` ASC
1.624 ms 10 Yes Yes /classes/Category.php:799
1649
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3746
ORDER BY f.position ASC
1.622 ms 5 Yes /classes/Product.php:6021
2043
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4965 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.619 ms 10 Yes /classes/SpecificPrice.php:576
4346
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2647) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.618 ms 1 Yes Yes /classes/Product.php:4524
3087
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 10111
ORDER BY f.position ASC
1.617 ms 5 Yes /classes/Product.php:6021
4250
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (5146) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.615 ms 1 Yes Yes /classes/Product.php:4524
2648
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 8392
ORDER BY f.position ASC
1.613 ms 5 Yes /classes/Product.php:6021
1966
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4934)
1.612 ms 1 /classes/Product.php:3860
2092
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 5284 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 5284 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.611 ms 0 /classes/Cart.php:1430
3525
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2643
ORDER BY `position`
1.608 ms 1 Yes /classes/Product.php:3545
1300
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2655 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.605 ms 10 Yes /classes/SpecificPrice.php:576
2148
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 5590 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 5590 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.604 ms 0 /classes/Cart.php:1430
2964
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 9694 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.602 ms 11 Yes /classes/SpecificPrice.php:576
3059
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 10072)
1.598 ms 1 /classes/Product.php:3860
2905
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 9689
AND image_shop.`cover` = 1 LIMIT 1
1.596 ms 1 /classes/Product.php:3570
1290
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2643)
1.594 ms 1 /classes/Product.php:3860
3027
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 10069 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 10069 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.591 ms 0 /classes/Cart.php:1430
3587
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3454) AND (b.`id_shop` = 1) LIMIT 1
1.591 ms 1 /src/Adapter/EntityMapper.php:71
1809
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3766 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.586 ms 11 Yes /classes/SpecificPrice.php:576
2331
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 6180 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.585 ms 10 Yes /classes/SpecificPrice.php:576
987
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2782
ORDER BY f.position ASC
1.577 ms 5 Yes /classes/Product.php:6021
2441
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 6191 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.577 ms 10 Yes /classes/SpecificPrice.php:576
1102
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2622 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.576 ms 10 Yes /classes/SpecificPrice.php:576
1820
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3771 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.574 ms 10 Yes /classes/SpecificPrice.php:576
104
SELECT SQL_NO_CACHE tr.*
FROM `hgt78_tax_rule` tr
JOIN `hgt78_tax_rules_group` trg ON (tr.`id_tax_rules_group` = trg.`id_tax_rules_group`)
WHERE trg.`active` = 1
AND tr.`id_country` = 8
AND tr.`id_tax_rules_group` = 28
AND tr.`id_state` IN (0, 0)
AND ('04510' BETWEEN tr.`zipcode_from` AND tr.`zipcode_to`
OR (tr.`zipcode_to` = 0 AND tr.`zipcode_from` IN(0, '04510')))
ORDER BY tr.`zipcode_from` DESC, tr.`zipcode_to` DESC, tr.`id_state` DESC, tr.`id_country` DESC
1.569 ms 1 /classes/tax/TaxRulesTaxManager.php:109
1272
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2646 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2646 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.568 ms 0 /classes/Cart.php:1430
3599
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3558) AND (b.`id_shop` = 1) LIMIT 1
1.568 ms 1 /src/Adapter/EntityMapper.php:71
1682
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3749
ORDER BY f.position ASC
1.568 ms 5 Yes /classes/Product.php:6021
2033
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4964)
1.563 ms 1 /classes/Product.php:3860
3581
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2650) AND (b.`id_shop` = 1) LIMIT 1
1.563 ms 1 /src/Adapter/EntityMapper.php:71
4203
SELECT SQL_NO_CACHE c.*, cl.*
FROM `hgt78_category` c
INNER JOIN hgt78_category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1)
LEFT JOIN `hgt78_category_lang` cl ON c.`id_category` = cl.`id_category` AND cl.id_shop = 1 
LEFT JOIN `hgt78_category_group` cg ON c.`id_category` = cg.`id_category`
RIGHT JOIN `hgt78_category` c2 ON c2.`id_category` = 33 AND c.`nleft` >= c2.`nleft` AND c.`nright` <= c2.`nright`
WHERE 1  AND `id_lang` = 1
AND c.`active` = 1
AND cg.`id_group` IN (1)
GROUP BY c.`id_category`
ORDER BY c.`level_depth` ASC
, category_shop.`position` ASC
1.561 ms 7 Yes Yes /classes/Category.php:799
4242
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (7543) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.561 ms 1 Yes Yes /classes/Product.php:4524
1654
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3747 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.560 ms 10 Yes /classes/SpecificPrice.php:576
427
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2660
ORDER BY `id_specific_price_priority` DESC LIMIT 1
1.558 ms 0 /classes/SpecificPrice.php:259
4452
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (6189) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.557 ms 1 Yes Yes /classes/Product.php:4524
957
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2633
ORDER BY `id_specific_price_priority` DESC LIMIT 1
1.555 ms 0 /classes/SpecificPrice.php:259
992
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2636 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.552 ms 10 Yes /classes/SpecificPrice.php:576
2703
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 8401
ORDER BY f.position ASC
1.551 ms 5 Yes /classes/Product.php:6021
3049
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 10071 AND `id_group` = 1 LIMIT 1
1.551 ms 0 /classes/GroupReduction.php:156
2687
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 8397)
1.548 ms 1 /classes/Product.php:3860
1769
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3757 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3757 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.546 ms 0 /classes/Cart.php:1430
345
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 5133
ORDER BY f.position ASC
1.542 ms 5 Yes /classes/Product.php:6021
2260
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 6172
ORDER BY f.position ASC
1.540 ms 5 Yes /classes/Product.php:6021
937
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2631)
1.534 ms 1 /classes/Product.php:3860
2947
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 9692 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 9692 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.529 ms 0 /classes/Cart.php:1430
4039
SELECT SQL_NO_CACHE `id_hook`, `name` FROM `hgt78_hook`
1.529 ms 1185 /classes/Hook.php:1348
372
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3741 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.528 ms 10 Yes /classes/SpecificPrice.php:576
3170
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 12552 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.525 ms 11 Yes /classes/SpecificPrice.php:576
1228
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3456 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3456 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.524 ms 0 /classes/Cart.php:1430
2592
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 7944
ORDER BY f.position ASC
1.524 ms 5 Yes /classes/Product.php:6021
2160
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 5591
ORDER BY f.position ASC
1.522 ms 5 Yes /classes/Product.php:6021
4332
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2622) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.520 ms 1 Yes Yes /classes/Product.php:4524
85
SELECT SQL_NO_CACHE DISTINCT f.id_feature, f.*, fl.*, IF(liflv.`url_name` IS NULL OR liflv.`url_name` = "", NULL, liflv.`url_name`) AS url_name, IF(liflv.`meta_title` IS NULL OR liflv.`meta_title` = "", NULL, liflv.`meta_title`) AS meta_title, lif.indexable FROM `hgt78_feature` f  INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1) LEFT JOIN `hgt78_feature_lang` fl ON (f.`id_feature` = fl.`id_feature` AND fl.`id_lang` = 1) LEFT JOIN `hgt78_layered_indexable_feature` lif ON (f.`id_feature` = lif.`id_feature`) LEFT JOIN `hgt78_layered_indexable_feature_lang_value` liflv ON (f.`id_feature` = liflv.`id_feature` AND liflv.`id_lang` = 1) ORDER BY f.`position` ASC
1.519 ms 25 Yes /modules/ps_facetedsearch/src/Filters/DataAccessor.php:171
3136
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 10303 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.518 ms 10 Yes /classes/SpecificPrice.php:576
3681
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3804
ORDER BY `position`
1.517 ms 1 Yes /classes/Product.php:3545
4123
SELECT SQL_NO_CACHE c.*, cl.*
FROM `hgt78_category` c
INNER JOIN hgt78_category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1)
LEFT JOIN `hgt78_category_lang` cl ON c.`id_category` = cl.`id_category` AND cl.id_shop = 1 
LEFT JOIN `hgt78_category_group` cg ON c.`id_category` = cg.`id_category`
RIGHT JOIN `hgt78_category` c2 ON c2.`id_category` = 78 AND c.`nleft` >= c2.`nleft` AND c.`nright` <= c2.`nright`
WHERE 1  AND `id_lang` = 1
AND c.`active` = 1
AND cg.`id_group` IN (1)
GROUP BY c.`id_category`
ORDER BY c.`level_depth` ASC
, category_shop.`position` ASC
1.517 ms 12 Yes Yes /classes/Category.php:799
4454
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (6192) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.514 ms 1 Yes Yes /classes/Product.php:4524
4247
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (6727) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.510 ms 1 Yes Yes /classes/Product.php:4524
2548
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 7940
ORDER BY f.position ASC
1.507 ms 5 Yes /classes/Product.php:6021
1676
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3749 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.506 ms 10 Yes /classes/SpecificPrice.php:576
405
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2893 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.505 ms 11 Yes /classes/SpecificPrice.php:576
4471
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (8392) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.505 ms 1 Yes Yes /classes/Product.php:4524
3010
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 10068 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.503 ms 10 Yes /classes/SpecificPrice.php:576
1053
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2629
ORDER BY f.position ASC
1.501 ms 5 Yes /classes/Product.php:6021
1279
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2642)
1.501 ms 1 /classes/Product.php:3860
3034
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 10070 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.501 ms 10 Yes /classes/SpecificPrice.php:576
837
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3179 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.500 ms 10 Yes /classes/SpecificPrice.php:576
3534
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2645
ORDER BY `position`
1.499 ms 1 Yes /classes/Product.php:3545
3130
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 10302 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 10302 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.498 ms 0 /classes/Cart.php:1430
2386
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 6185 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.496 ms 10 Yes /classes/SpecificPrice.php:576
3114
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 10299 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.489 ms 10 Yes /classes/SpecificPrice.php:576
2536
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 7938 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 7938 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.488 ms 0 /classes/Cart.php:1430
1278
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2642 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.487 ms 10 Yes /classes/SpecificPrice.php:576
2103
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 5293 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 5293 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.483 ms 0 /classes/Cart.php:1430
3512
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2658) AND (b.`id_shop` = 1) LIMIT 1
1.481 ms 1 /src/Adapter/EntityMapper.php:71
1888
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3806)
1.480 ms 1 /classes/Product.php:3860
4349
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2643) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.479 ms 1 Yes Yes /classes/Product.php:4524
2485
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 6195 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.478 ms 10 Yes /classes/SpecificPrice.php:576
4446
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (6183) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.478 ms 1 Yes Yes /classes/Product.php:4524
111
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 7543 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 7543 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.474 ms 0 /classes/Cart.php:1430
3288
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2660
ORDER BY `position`
1.473 ms 1 Yes /classes/Product.php:3545
2210
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 6047 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.471 ms 10 Yes /classes/SpecificPrice.php:576
1934
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4574 AND `id_group` = 1 LIMIT 1
1.467 ms 0 /classes/GroupReduction.php:156
3162
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 10305) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
1.464 ms 1 /classes/stock/StockAvailable.php:453
3561
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3099
ORDER BY `position`
1.464 ms 1 Yes /classes/Product.php:3545
2205
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 6047
AND image_shop.`cover` = 1 LIMIT 1
1.462 ms 1 /classes/Product.php:3570
4319
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2633) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.462 ms 1 Yes Yes /classes/Product.php:4524
1
SELECT SQL_NO_CACHE gs.*, s.*, gs.name AS group_name, s.name AS shop_name, s.active, su.domain, su.domain_ssl, su.physical_uri, su.virtual_uri
FROM hgt78_shop_group gs
LEFT JOIN hgt78_shop s
ON s.id_shop_group = gs.id_shop_group
LEFT JOIN hgt78_shop_url su
ON s.id_shop = su.id_shop AND su.main = 1
WHERE s.deleted = 0
AND gs.deleted = 0
ORDER BY gs.name, s.name
1.459 ms 1 Yes /classes/shop/Shop.php:715
2497
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 6499)
1.457 ms 1 /classes/Product.php:3860
112
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 7543
ORDER BY f.position ASC
1.456 ms 5 Yes /classes/Product.php:6021
1174
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2640
ORDER BY f.position ASC
1.456 ms 5 Yes /classes/Product.php:6021
3979
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 9695) AND (b.`id_shop` = 1) LIMIT 1
1.456 ms 1 /src/Adapter/EntityMapper.php:71
3574
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2490
1.453 ms 1 /classes/Product.php:2902
4113
SELECT SQL_NO_CACHE c.*, cl.*
FROM `hgt78_category` c
INNER JOIN hgt78_category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1)
LEFT JOIN `hgt78_category_lang` cl ON c.`id_category` = cl.`id_category` AND cl.id_shop = 1 
LEFT JOIN `hgt78_category_group` cg ON c.`id_category` = cg.`id_category`
RIGHT JOIN `hgt78_category` c2 ON c2.`id_category` = 46 AND c.`nleft` >= c2.`nleft` AND c.`nright` <= c2.`nright`
WHERE 1  AND `id_lang` = 1
AND c.`active` = 1
AND cg.`id_group` IN (1)
GROUP BY c.`id_category`
ORDER BY c.`level_depth` ASC
, category_shop.`position` ASC
1.452 ms 9 Yes Yes /classes/Category.php:799
3873
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 7943
ORDER BY `position`
1.451 ms 1 Yes /classes/Product.php:3545
373
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3741)
1.449 ms 1 /classes/Product.php:3860
3545
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3265) AND (b.`id_shop` = 1) LIMIT 1
1.446 ms 1 /src/Adapter/EntityMapper.php:71
1155
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2627 LIMIT 1
1.443 ms 10 /classes/SpecificPrice.php:435
2757
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 8975 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 8975 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.441 ms 0 /classes/Cart.php:1430
1973
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 185 LIMIT 1
1.440 ms 1 /classes/Product.php:5659
3519
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2646
ORDER BY `position`
1.440 ms 1 Yes /classes/Product.php:3545
21
SELECT SQL_NO_CACHE m.`id_module`, m.`name`, ms.`id_module`as `mshop`
FROM `hgt78_module` m
LEFT JOIN `hgt78_module_shop` ms
ON m.`id_module` = ms.`id_module`
AND ms.`id_shop` = 1
1.438 ms 118 /classes/module/Module.php:346
940
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2631) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
1.438 ms 1 /classes/stock/StockAvailable.php:453
3125
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 10302 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.436 ms 10 Yes /classes/SpecificPrice.php:576
1294
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2643 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2643 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.427 ms 0 /classes/Cart.php:1430
2665
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 8395)
1.426 ms 1 /classes/Product.php:3860
2837
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 9535
ORDER BY f.position ASC
1.426 ms 5 Yes /classes/Product.php:6021
2547
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 7940 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 7940 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.425 ms 0 /classes/Cart.php:1430
4462
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (7940) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.424 ms 1 Yes Yes /classes/Product.php:4524
339
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 5133 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.421 ms 10 Yes /classes/SpecificPrice.php:576
1853
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3777 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.421 ms 10 Yes /classes/SpecificPrice.php:576
3551
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3155) AND (b.`id_shop` = 1) LIMIT 1
1.419 ms 1 /src/Adapter/EntityMapper.php:71
1311
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2644 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.417 ms 10 Yes /classes/SpecificPrice.php:576
1859
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3777
ORDER BY f.position ASC
1.411 ms 5 Yes /classes/Product.php:6021
2708
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 8417 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.411 ms 10 Yes /classes/SpecificPrice.php:576
223
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 5144 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 5144 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.409 ms 0 /classes/Cart.php:1430
2332
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 6180)
1.404 ms 1 /classes/Product.php:3860
4193
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 82 AND `id_shop` = 1
1.403 ms 6 /src/Adapter/EntityMapper.php:79
1666
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3748)
1.403 ms 1 /classes/Product.php:3860
2452
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 6192 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.401 ms 10 Yes /classes/SpecificPrice.php:576
3047
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 10071)
1.401 ms 1 /classes/Product.php:3860
3081
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 10111 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.401 ms 11 Yes /classes/SpecificPrice.php:576
2502
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 6499
ORDER BY f.position ASC
1.400 ms 5 Yes /classes/Product.php:6021
2579
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 7943) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
1.399 ms 1 /classes/stock/StockAvailable.php:453
2880
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 9687) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
1.399 ms 1 /classes/stock/StockAvailable.php:453
2969
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 9694 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 9694 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.396 ms 0 /classes/Cart.php:1430
4295
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2779) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.396 ms 1 Yes Yes /classes/Product.php:4524
672
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2777 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.393 ms 10 Yes /classes/SpecificPrice.php:576
3393
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2793
ORDER BY `position`
1.393 ms 1 Yes /classes/Product.php:3545
2173
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
1.391 ms 1 /classes/Product.php:5659
2375
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 6184 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.389 ms 10 Yes /classes/SpecificPrice.php:576
2194
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 5973
AND image_shop.`cover` = 1 LIMIT 1
1.387 ms 1 /classes/Product.php:3570
4460
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (6501) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.382 ms 1 Yes Yes /classes/Product.php:4524
3564
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3107
ORDER BY `position`
1.381 ms 1 Yes /classes/Product.php:3545
3573
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2490
ORDER BY `position`
1.380 ms 1 Yes /classes/Product.php:3545
2127
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 5589
AND image_shop.`cover` = 1 LIMIT 1
1.378 ms 2 /classes/Product.php:3570
239
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 5142
ORDER BY `id_specific_price_priority` DESC LIMIT 1
1.377 ms 0 /classes/SpecificPrice.php:259
4445
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (6182) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.377 ms 1 Yes Yes /classes/Product.php:4524
4443
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (6180) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.377 ms 1 Yes Yes /classes/Product.php:4524
4126
SELECT SQL_NO_CACHE c.*, cl.*
FROM `hgt78_category` c
INNER JOIN hgt78_category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1)
LEFT JOIN `hgt78_category_lang` cl ON c.`id_category` = cl.`id_category` AND cl.id_shop = 1 
LEFT JOIN `hgt78_category_group` cg ON c.`id_category` = cg.`id_category`
RIGHT JOIN `hgt78_category` c2 ON c2.`id_category` = 199 AND c.`nleft` >= c2.`nleft` AND c.`nright` <= c2.`nright`
WHERE 1  AND `id_lang` = 1
AND c.`active` = 1
AND cg.`id_group` IN (1)
GROUP BY c.`id_category`
ORDER BY c.`level_depth` ASC
, category_shop.`position` ASC
1.375 ms 13 Yes Yes /classes/Category.php:799
1910
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3808)
1.373 ms 1 /classes/Product.php:3860
3947
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 9597) AND (b.`id_shop` = 1) LIMIT 1
1.372 ms 1 /src/Adapter/EntityMapper.php:71
4461
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (7938) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.372 ms 1 Yes Yes /classes/Product.php:4524
366
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3743 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3743 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.371 ms 0 /classes/Cart.php:1430
2154
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 5591 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.371 ms 10 Yes /classes/SpecificPrice.php:576
3507
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3456
ORDER BY `position`
1.370 ms 1 Yes /classes/Product.php:3545
1720
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3753 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.369 ms 10 Yes /classes/SpecificPrice.php:576
998
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2636
ORDER BY f.position ASC
1.364 ms 5 Yes /classes/Product.php:6021
2065
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 5282 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.362 ms 15 Yes /classes/SpecificPrice.php:576
4119
SELECT SQL_NO_CACHE c.*, cl.*
FROM `hgt78_category` c
INNER JOIN hgt78_category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1)
LEFT JOIN `hgt78_category_lang` cl ON c.`id_category` = cl.`id_category` AND cl.id_shop = 1 
LEFT JOIN `hgt78_category_group` cg ON c.`id_category` = cg.`id_category`
RIGHT JOIN `hgt78_category` c2 ON c2.`id_category` = 64 AND c.`nleft` >= c2.`nleft` AND c.`nright` <= c2.`nright`
WHERE 1  AND `id_lang` = 1
AND c.`active` = 1
AND cg.`id_group` IN (1)
GROUP BY c.`id_category`
ORDER BY c.`level_depth` ASC
, category_shop.`position` ASC
1.360 ms 10 Yes Yes /classes/Category.php:799
4353
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3252) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.360 ms 1 Yes Yes /classes/Product.php:4524
2569
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 7942 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 7942 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.358 ms 0 /classes/Cart.php:1430
2786
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 9321
ORDER BY `id_specific_price_priority` DESC LIMIT 1
1.358 ms 0 /classes/SpecificPrice.php:259
2037
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4964 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4964 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.356 ms 0 /classes/Cart.php:1430
2802
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 9323) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
1.356 ms 1 /classes/stock/StockAvailable.php:453
4003
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 10073) AND (b.`id_shop` = 1) LIMIT 1
1.352 ms 1 /src/Adapter/EntityMapper.php:71
2724
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 8418 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 8418 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.350 ms 0 /classes/Cart.php:1430
2921
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 9690)
1.349 ms 1 /classes/Product.php:3860
1058
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2628 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.348 ms 10 Yes /classes/SpecificPrice.php:576
2854
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 9597)
1.348 ms 1 /classes/Product.php:3860
4273
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2651) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.348 ms 1 Yes Yes /classes/Product.php:4524
383
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3740 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.348 ms 10 Yes /classes/SpecificPrice.php:576
2743
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 8420 AND id_shop=1 LIMIT 1
1.347 ms 1 /classes/Product.php:6876
3917
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 8420) AND (b.`id_shop` = 1) LIMIT 1
1.346 ms 1 /src/Adapter/EntityMapper.php:71
1670
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3748 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3748 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.344 ms 0 /classes/Cart.php:1430
2597
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 7945 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.344 ms 10 Yes /classes/SpecificPrice.php:576
1943
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4575)
1.342 ms 1 /classes/Product.php:3860
2827
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 9535
AND image_shop.`cover` = 1 LIMIT 1
1.342 ms 1 /classes/Product.php:3570
1731
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3754 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.341 ms 10 Yes /classes/SpecificPrice.php:576
2560
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 7942
AND image_shop.`cover` = 1 LIMIT 1
1.340 ms 1 /classes/Product.php:3570
4339
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2641) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.336 ms 1 Yes Yes /classes/Product.php:4524
3066
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 184 LIMIT 1
1.332 ms 1 /classes/Product.php:5659
83
SELECT SQL_NO_CACHE c.*, cl.*
FROM `hgt78_category` c
LEFT JOIN `hgt78_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 )
WHERE `name` = 'Luminaires'
AND c.`id_category` != 2
AND c.`id_parent` = 2 LIMIT 1
1.330 ms 7 /classes/Category.php:1500
2193
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 5972
ORDER BY f.position ASC
1.328 ms 5 Yes /classes/Product.php:6021
2869
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 9598 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 9598 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.328 ms 0 /classes/Cart.php:1430
3347
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2738) AND (b.`id_shop` = 1) LIMIT 1
1.328 ms 1 /src/Adapter/EntityMapper.php:71
3685
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3805
1.328 ms 1 /classes/Product.php:2902
4225
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 76 AND `id_shop` = 1
1.328 ms 6 /src/Adapter/EntityMapper.php:79
1937
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4574
ORDER BY f.position ASC
1.326 ms 5 Yes /classes/Product.php:6021
1965
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4934 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.326 ms 10 Yes /classes/SpecificPrice.php:576
2150
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 5591
AND image_shop.`cover` = 1 LIMIT 1
1.325 ms 2 /classes/Product.php:3570
1367
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3265 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.324 ms 10 Yes /classes/SpecificPrice.php:576
3009
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 10068
ORDER BY `id_specific_price_priority` DESC LIMIT 1
1.324 ms 0 /classes/SpecificPrice.php:259
84
SELECT SQL_NO_CACHE ag.id_attribute_group, agl.public_name as attribute_group_name, is_color_group, IF(liaglv.`url_name` IS NULL OR liaglv.`url_name` = "", NULL, liaglv.`url_name`) AS url_name, IF(liaglv.`meta_title` IS NULL OR liaglv.`meta_title` = "", NULL, liaglv.`meta_title`) AS meta_title, IFNULL(liag.indexable, TRUE) AS indexable FROM `hgt78_attribute_group` ag  INNER JOIN hgt78_attribute_group_shop attribute_group_shop
ON (attribute_group_shop.id_attribute_group = ag.id_attribute_group AND attribute_group_shop.id_shop = 1) LEFT JOIN `hgt78_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1) LEFT JOIN `hgt78_layered_indexable_attribute_group` liag ON (ag.`id_attribute_group` = liag.`id_attribute_group`) LEFT JOIN `hgt78_layered_indexable_attribute_group_lang_value` AS liaglv ON (ag.`id_attribute_group` = liaglv.`id_attribute_group` AND agl.`id_lang` = 1) GROUP BY ag.id_attribute_group ORDER BY ag.`position` ASC
1.323 ms 1 Yes Yes /modules/ps_facetedsearch/src/Filters/DataAccessor.php:137
2713
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 8417 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 8417 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.323 ms 0 /classes/Cart.php:1430
3387
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3176
ORDER BY `position`
1.323 ms 1 Yes /classes/Product.php:3545
1892
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3806 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3806 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.318 ms 0 /classes/Cart.php:1430
2480
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 6194
ORDER BY f.position ASC
1.318 ms 5 Yes /classes/Product.php:6021
3858
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 6501
ORDER BY `position`
1.318 ms 1 Yes /classes/Product.php:3545
2464
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 6193)
1.316 ms 1 /classes/Product.php:3860
2255
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 6172)
1.313 ms 1 /classes/Product.php:3860
2581
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 7943
ORDER BY f.position ASC
1.312 ms 5 Yes /classes/Product.php:6021
2225
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 6107) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
1.311 ms 1 /classes/stock/StockAvailable.php:453
3200
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 7543) AND (b.`id_shop` = 1) LIMIT 1
1.311 ms 1 /src/Adapter/EntityMapper.php:71
4300
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2800) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.311 ms 1 Yes Yes /classes/Product.php:4524
3356
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2778) AND (b.`id_shop` = 1) LIMIT 1
1.310 ms 1 /src/Adapter/EntityMapper.php:71
2176
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 5971 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.309 ms 10 Yes /classes/SpecificPrice.php:576
2729
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 8419
ORDER BY `id_specific_price_priority` DESC LIMIT 1
1.308 ms 0 /classes/SpecificPrice.php:259
2288
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 6176)
1.308 ms 1 /classes/Product.php:3860
3399
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2781
ORDER BY `position`
1.307 ms 1 Yes /classes/Product.php:3545
3872
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 7943) AND (b.`id_shop` = 1) LIMIT 1
1.307 ms 1 /src/Adapter/EntityMapper.php:71
3338
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2692) AND (b.`id_shop` = 1) LIMIT 1
1.307 ms 1 /src/Adapter/EntityMapper.php:71
1804
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3765
ORDER BY f.position ASC
1.305 ms 5 Yes /classes/Product.php:6021
2686
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 8397 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.304 ms 10 Yes /classes/SpecificPrice.php:576
3593
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3484) AND (b.`id_shop` = 1) LIMIT 1
1.301 ms 1 /src/Adapter/EntityMapper.php:71
1788
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3764)
1.299 ms 1 /classes/Product.php:3860
4204
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 33) LIMIT 1
1.298 ms 1 /src/Adapter/EntityMapper.php:71
1728
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
1.294 ms 1 /classes/Product.php:5659
2842
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 9596 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.294 ms 10 Yes /classes/SpecificPrice.php:576
1735
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3754) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
1.294 ms 1 /classes/stock/StockAvailable.php:453
4312
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2791) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.294 ms 1 Yes Yes /classes/Product.php:4524
4107
SELECT SQL_NO_CACHE c.*, cl.*
FROM `hgt78_category` c
INNER JOIN hgt78_category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1)
LEFT JOIN `hgt78_category_lang` cl ON c.`id_category` = cl.`id_category` AND cl.id_shop = 1 
LEFT JOIN `hgt78_category_group` cg ON c.`id_category` = cg.`id_category`
RIGHT JOIN `hgt78_category` c2 ON c2.`id_category` = 344 AND c.`nleft` >= c2.`nleft` AND c.`nright` <= c2.`nright`
WHERE 1  AND `id_lang` = 1
AND c.`active` = 1
AND cg.`id_group` IN (1)
GROUP BY c.`id_category`
ORDER BY c.`level_depth` ASC
, category_shop.`position` ASC
1.293 ms 15 Yes Yes /classes/Category.php:799
1440
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3107
ORDER BY f.position ASC
1.292 ms 5 Yes /classes/Product.php:6021
2116
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 5093
AND image_shop.`cover` = 1 LIMIT 1
1.290 ms 4 /classes/Product.php:3570
2370
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 6183
ORDER BY f.position ASC
1.290 ms 5 Yes /classes/Product.php:6021
809
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2793 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2793 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.288 ms 0 /classes/Cart.php:1430
2337
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 6180
ORDER BY f.position ASC
1.288 ms 5 Yes /classes/Product.php:6021
328
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 5134 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.287 ms 10 Yes /classes/SpecificPrice.php:576
3078
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 95 LIMIT 1
1.287 ms 1 /classes/Product.php:5659
2164
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 5970
ORDER BY `id_specific_price_priority` DESC LIMIT 1
1.280 ms 0 /classes/SpecificPrice.php:259
4254
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (5142) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.280 ms 1 Yes Yes /classes/Product.php:4524
705
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2795 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.280 ms 10 Yes /classes/SpecificPrice.php:576
4464
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (7942) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.278 ms 1 Yes Yes /classes/Product.php:4524
2575
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 7943 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.275 ms 10 Yes /classes/SpecificPrice.php:576
1783
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3764
AND image_shop.`cover` = 1 LIMIT 1
1.273 ms 1 /classes/Product.php:3570
415
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2694
ORDER BY `id_specific_price_priority` DESC LIMIT 1
1.273 ms 0 /classes/SpecificPrice.php:259
3834
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 6189
ORDER BY `position`
1.273 ms 1 Yes /classes/Product.php:3545
2855
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 9597 AND id_shop=1 LIMIT 1
1.272 ms 1 /classes/Product.php:6876
3611
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3639) AND (b.`id_shop` = 1) LIMIT 1
1.272 ms 1 /src/Adapter/EntityMapper.php:71
273
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 5139 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.270 ms 10 Yes /classes/SpecificPrice.php:576
4243
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (7542) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.269 ms 1 Yes Yes /classes/Product.php:4524
3455
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2630) AND (b.`id_shop` = 1) LIMIT 1
1.268 ms 1 /src/Adapter/EntityMapper.php:71
2789
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 9321 AND id_shop=1 LIMIT 1
1.267 ms 1 /classes/Product.php:6876
2884
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 334 LIMIT 1
1.267 ms 1 /classes/Product.php:5659
1754
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3756)
1.264 ms 1 /classes/Product.php:3860
4257
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (5139) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.261 ms 1 Yes Yes /classes/Product.php:4524
4456
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (6194) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.259 ms 1 Yes Yes /classes/Product.php:4524
1748
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3755
ORDER BY f.position ASC
1.258 ms 5 Yes /classes/Product.php:6021
3068
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 10073 LIMIT 1
1.257 ms 10 /classes/SpecificPrice.php:435
1759
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3756
ORDER BY f.position ASC
1.255 ms 5 Yes /classes/Product.php:6021
229
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 5143 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.255 ms 10 Yes /classes/SpecificPrice.php:576
4277
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2769) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.254 ms 1 Yes Yes /classes/Product.php:4524
2733
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 8419 AND `id_group` = 1 LIMIT 1
1.253 ms 0 /classes/GroupReduction.php:156
974
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2634 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2634 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.252 ms 0 /classes/Cart.php:1430
3291
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2652
ORDER BY `position`
1.252 ms 1 Yes /classes/Product.php:3545
2420
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 6188)
1.251 ms 1 /classes/Product.php:3860
1314
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2644 AND `id_group` = 1 LIMIT 1
1.250 ms 0 /classes/GroupReduction.php:156
2347
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 6181 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 6181 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.250 ms 0 /classes/Cart.php:1430
3522
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2642
ORDER BY `position`
1.249 ms 1 Yes /classes/Product.php:3545
2450
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 6192 LIMIT 1
1.248 ms 10 /classes/SpecificPrice.php:435
2613
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 7946 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 7946 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.246 ms 0 /classes/Cart.php:1430
3175
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 12552 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 12552 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.245 ms 0 /classes/Cart.php:1430
804
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2793 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.244 ms 10 Yes /classes/SpecificPrice.php:576
2531
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 7938 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.244 ms 10 Yes /classes/SpecificPrice.php:576
3020
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 10069 LIMIT 1
1.241 ms 10 /classes/SpecificPrice.php:435
2216
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 6047
ORDER BY f.position ASC
1.237 ms 5 Yes /classes/Product.php:6021
3221
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 5147) AND (b.`id_shop` = 1) LIMIT 1
1.237 ms 1 /src/Adapter/EntityMapper.php:71
1284
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2642
ORDER BY f.position ASC
1.235 ms 5 Yes /classes/Product.php:6021
3127
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 10302 AND id_shop=1 LIMIT 1
1.235 ms 1 /classes/Product.php:6876
2271
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 6173
ORDER BY f.position ASC
1.234 ms 5 Yes /classes/Product.php:6021
2836
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 9535 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 9535 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.230 ms 0 /classes/Cart.php:1430
3413
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2791) AND (b.`id_shop` = 1) LIMIT 1
1.229 ms 1 /src/Adapter/EntityMapper.php:71
4211
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 79 AND `id_shop` = 1
1.228 ms 6 /src/Adapter/EntityMapper.php:79
3386
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3176) AND (b.`id_shop` = 1) LIMIT 1
1.227 ms 1 /src/Adapter/EntityMapper.php:71
1851
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3777 LIMIT 1
1.226 ms 10 /classes/SpecificPrice.php:435
700
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2779
ORDER BY f.position ASC
1.226 ms 5 Yes /classes/Product.php:6021
2390
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 6185) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
1.226 ms 1 /classes/stock/StockAvailable.php:453
989
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
1.225 ms 1 /classes/Product.php:5659
999
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2637
AND image_shop.`cover` = 1 LIMIT 1
1.225 ms 1 /classes/Product.php:3570
1308
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
1.225 ms 1 /classes/Product.php:5659
1439
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3107 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3107 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.224 ms 0 /classes/Cart.php:1430
2891
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 9686) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
1.224 ms 1 /classes/stock/StockAvailable.php:453
815
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2780 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.223 ms 10 Yes /classes/SpecificPrice.php:576
694
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2779 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.222 ms 10 Yes /classes/SpecificPrice.php:576
908
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3177 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3177 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.221 ms 0 /classes/Cart.php:1430
2824
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 9325) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
1.220 ms 1 /classes/stock/StockAvailable.php:453
2664
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 8395 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.218 ms 10 Yes /classes/SpecificPrice.php:576
4036
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 11001) AND (b.`id_shop` = 1) LIMIT 1
1.218 ms 1 /src/Adapter/EntityMapper.php:71
2442
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 6191)
1.217 ms 1 /classes/Product.php:3860
4303
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3176) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.217 ms 1 Yes Yes /classes/Product.php:4524
3119
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 10299 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 10299 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.216 ms 0 /classes/Cart.php:1430
4069
SELECT SQL_NO_CACHE hs.`id_tab` as id_tab, hssl.`title`, hssl.`label`, hssl.`url`,
hss.`position`,  hss.`active_label`, hss.`url_type`, hss.`id_url`, hss.`icon_type`, hss.`icon_class`, hss.`icon`, hss.`legend_icon`,
hss.`new_window`, hss.`float`, hss.`submenu_type`, hss.`submenu_content`, hss.`submenu_width`, hss.`group_access`
FROM hgt78_iqitmegamenu_tabs_shop hs
LEFT JOIN hgt78_iqitmegamenu_tabs hss ON (hs.id_tab = hss.id_tab)
LEFT JOIN hgt78_iqitmegamenu_tabs_lang hssl ON (hss.id_tab = hssl.id_tab)
WHERE id_shop = 1 AND menu_type = 1 AND active = 1
AND hssl.id_lang = 1
ORDER BY hss.position
1.216 ms 12 Yes /modules/iqitmegamenu/models/IqitMenuTab.php:178
278
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 5139 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 5139 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.215 ms 0 /classes/Cart.php:1430
3102
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 10298
ORDER BY `id_specific_price_priority` DESC LIMIT 1
1.215 ms 1 /classes/SpecificPrice.php:259
2128
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `hgt78_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 198 LIMIT 1
1.211 ms 1 /classes/Category.php:1378
1948
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4575
ORDER BY f.position ASC
1.210 ms 5 Yes /classes/Product.php:6021
2491
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 6195
ORDER BY f.position ASC
1.209 ms 5 Yes /classes/Product.php:6021
2892
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 9686 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 9686 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.209 ms 0 /classes/Cart.php:1430
1318
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2645
AND image_shop.`cover` = 1 LIMIT 1
1.208 ms 1 /classes/Product.php:3570
3158
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 10305 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.208 ms 10 Yes /classes/SpecificPrice.php:576
347
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 185 LIMIT 1
1.207 ms 1 /classes/Product.php:5659
3497
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2656) AND (b.`id_shop` = 1) LIMIT 1
1.206 ms 1 /src/Adapter/EntityMapper.php:71
2961
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 334 LIMIT 1
1.205 ms 1 /classes/Product.php:5659
4021
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 10303) AND (b.`id_shop` = 1) LIMIT 1
1.204 ms 1 /src/Adapter/EntityMapper.php:71
96
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE `from` BETWEEN '2025-05-01 00:00:00' AND '2025-05-01 23:59:59' LIMIT 1
1.203 ms 1 /classes/SpecificPrice.php:377
1704
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3751
ORDER BY f.position ASC
1.203 ms 5 Yes /classes/Product.php:6021
2993
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 10067
AND image_shop.`cover` = 1 LIMIT 1
1.203 ms 1 /classes/Product.php:3570
4270
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2694) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.201 ms 1 Yes Yes /classes/Product.php:4524
2453
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 6192)
1.200 ms 1 /classes/Product.php:3860
3576
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2621
ORDER BY `position`
1.200 ms 1 Yes /classes/Product.php:3545
1240
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2649
ORDER BY f.position ASC
1.199 ms 5 Yes /classes/Product.php:6021
2072
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 5283
AND image_shop.`cover` = 1 LIMIT 1
1.198 ms 2 /classes/Product.php:3570
3516
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2647
ORDER BY `position`
1.197 ms 1 Yes /classes/Product.php:3545
1904
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3807
ORDER BY f.position ASC
1.195 ms 5 Yes /classes/Product.php:6021
3900
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 8396
ORDER BY `position`
1.195 ms 1 Yes /classes/Product.php:3545
3309
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2770
ORDER BY `position`
1.193 ms 1 Yes /classes/Product.php:3545
2806
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 173 LIMIT 1
1.192 ms 1 /classes/Product.php:5659
2857
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 9597) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
1.190 ms 1 /classes/stock/StockAvailable.php:453
1118
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3458 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3458 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.188 ms 0 /classes/Cart.php:1430
829
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2781 AND `id_group` = 1 LIMIT 1
1.186 ms 0 /classes/GroupReduction.php:156
3284
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2694) AND (b.`id_shop` = 1) LIMIT 1
1.185 ms 1 /src/Adapter/EntityMapper.php:71
2475
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 6194)
1.184 ms 1 /classes/Product.php:3860
3952
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 9687) AND (b.`id_shop` = 1) LIMIT 1
1.184 ms 1 /src/Adapter/EntityMapper.php:71
2800
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 9323 AND id_shop=1 LIMIT 1
1.182 ms 1 /classes/Product.php:6876
2038
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4964
ORDER BY f.position ASC
1.181 ms 5 Yes /classes/Product.php:6021
2266
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 6173)
1.181 ms 1 /classes/Product.php:3860
1882
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3805
ORDER BY f.position ASC
1.180 ms 5 Yes /classes/Product.php:6021
4159
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 161) LIMIT 1
1.179 ms 1 /src/Adapter/EntityMapper.php:71
4296
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2795) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.179 ms 1 Yes Yes /classes/Product.php:4524
1699
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3751)
1.178 ms 1 /classes/Product.php:3860
2955
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 9693 AND id_shop=1 LIMIT 1
1.178 ms 1 /classes/Product.php:6876
3215
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 6727) AND (b.`id_shop` = 1) LIMIT 1
1.178 ms 1 /src/Adapter/EntityMapper.php:71
2730
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 8419 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.176 ms 10 Yes /classes/SpecificPrice.php:576
1947
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4575 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4575 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.175 ms 0 /classes/Cart.php:1430
3600
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3558
ORDER BY `position`
1.174 ms 1 Yes /classes/Product.php:3545
3067
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 10073) AND (b.`id_shop` = 1) LIMIT 1
1.172 ms 1 /src/Adapter/EntityMapper.php:71
2950
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 334 LIMIT 1
1.171 ms 1 /classes/Product.php:5659
2860
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 9598
AND image_shop.`cover` = 1 LIMIT 1
1.168 ms 1 /classes/Product.php:3570
3905
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 8401) AND (b.`id_shop` = 1) LIMIT 1
1.167 ms 1 /src/Adapter/EntityMapper.php:71
3480
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2624
ORDER BY `position`
1.167 ms 1 Yes /classes/Product.php:3545
3871
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 7942
1.167 ms 1 /classes/Product.php:2902
2856
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 9597 AND `id_group` = 1 LIMIT 1
1.165 ms 0 /classes/GroupReduction.php:156
1643
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3746 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.165 ms 10 Yes /classes/SpecificPrice.php:576
2642
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 8392 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.165 ms 10 Yes /classes/SpecificPrice.php:576
4326
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2630) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.165 ms 1 Yes Yes /classes/Product.php:4524
738
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2799 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.164 ms 10 Yes /classes/SpecificPrice.php:576
2946
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 9692) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
1.163 ms 1 /classes/stock/StockAvailable.php:453
4012
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 10298) AND (b.`id_shop` = 1) LIMIT 1
1.161 ms 1 /src/Adapter/EntityMapper.php:71
1038
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2630 AND id_shop=1 LIMIT 1
1.161 ms 1 /classes/Product.php:6876
2237
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 6108 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 6108 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.161 ms 0 /classes/Cart.php:1430
179
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 5148 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 5148 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.159 ms 0 /classes/Cart.php:1430
428
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2660 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.158 ms 10 Yes /classes/SpecificPrice.php:576
3055
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 10072) AND (b.`id_shop` = 1) LIMIT 1
1.158 ms 1 /src/Adapter/EntityMapper.php:71
2397
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 6186 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.157 ms 10 Yes /classes/SpecificPrice.php:576
988
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2636
AND image_shop.`cover` = 1 LIMIT 1
1.156 ms 1 /classes/Product.php:3570
760
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3178 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.154 ms 10 Yes /classes/SpecificPrice.php:576
2604
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 7946
AND image_shop.`cover` = 1 LIMIT 1
1.154 ms 1 /classes/Product.php:3570
2741
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 8420 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.154 ms 10 Yes /classes/SpecificPrice.php:576
2351
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 6182 LIMIT 1
1.153 ms 10 /classes/SpecificPrice.php:435
3407
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2789) AND (b.`id_shop` = 1) LIMIT 1
1.153 ms 1 /src/Adapter/EntityMapper.php:71
1276
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2642 LIMIT 1
1.152 ms 10 /classes/SpecificPrice.php:435
3263
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 5133) AND (b.`id_shop` = 1) LIMIT 1
1.152 ms 1 /src/Adapter/EntityMapper.php:71
100
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 7543)
1.151 ms 1 /classes/Product.php:3860
2138
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 5589
ORDER BY f.position ASC
1.151 ms 5 Yes /classes/Product.php:6021
1190
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2656 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.150 ms 10 Yes /classes/SpecificPrice.php:576
2883
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 9686
AND image_shop.`cover` = 1 LIMIT 1
1.150 ms 1 /classes/Product.php:3570
1401
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2818 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.149 ms 10 Yes /classes/SpecificPrice.php:576
3583
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2650
1.149 ms 1 /classes/Product.php:2902
2343
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 6181)
1.148 ms 1 /classes/Product.php:3860
2553
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 7941 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.148 ms 10 Yes /classes/SpecificPrice.php:576
4141
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 56) LIMIT 1
1.148 ms 1 /src/Adapter/EntityMapper.php:71
3121
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 10302
AND image_shop.`cover` = 1 LIMIT 1
1.147 ms 1 /classes/Product.php:3570
1955
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4932)
1.147 ms 1 /classes/Product.php:3860
3002
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 10067) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
1.147 ms 1 /classes/stock/StockAvailable.php:453
3100
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
1.146 ms 1 /classes/Product.php:5659
2459
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 6193
AND image_shop.`cover` = 1 LIMIT 1
1.145 ms 1 /classes/Product.php:3570
501
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2769
ORDER BY f.position ASC
1.144 ms 5 Yes /classes/Product.php:6021
4283
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2766) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.144 ms 1 Yes Yes /classes/Product.php:4524
2468
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 6193 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 6193 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.143 ms 0 /classes/Cart.php:1430
2787
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 9321 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.141 ms 10 Yes /classes/SpecificPrice.php:576
2797
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 9323
ORDER BY `id_specific_price_priority` DESC LIMIT 1
1.141 ms 0 /classes/SpecificPrice.php:259
2326
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 6179
ORDER BY f.position ASC
1.141 ms 5 Yes /classes/Product.php:6021
1692
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3750 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3750 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.140 ms 0 /classes/Cart.php:1430
1662
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
1.139 ms 1 /classes/Product.php:5659
2049
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4965
ORDER BY f.position ASC
1.137 ms 5 Yes /classes/Product.php:6021
4234
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 39) LIMIT 1
1.136 ms 1 /src/Adapter/EntityMapper.php:71
941
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2631 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2631 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.135 ms 0 /classes/Cart.php:1430
2184
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
1.135 ms 1 /classes/Product.php:5659
2680
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 8396 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 8396 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.134 ms 0 /classes/Cart.php:1430
2507
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 6500 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.133 ms 10 Yes /classes/SpecificPrice.php:576
2816
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 9325
AND image_shop.`cover` = 1 LIMIT 1
1.133 ms 1 /classes/Product.php:3570
2887
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 9686 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.133 ms 11 Yes /classes/SpecificPrice.php:576
4152
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 48 AND `id_shop` = 1
1.133 ms 6 /src/Adapter/EntityMapper.php:79
2261
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 6173
AND image_shop.`cover` = 1 LIMIT 1
1.131 ms 1 /classes/Product.php:3570
3181
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 12551 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.131 ms 11 Yes /classes/SpecificPrice.php:576
4185
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 59 AND `id_shop` = 1
1.131 ms 6 /src/Adapter/EntityMapper.php:79
727
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2798 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.129 ms 10 Yes /classes/SpecificPrice.php:576
952
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2632 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2632 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.127 ms 0 /classes/Cart.php:1430
2022
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4963)
1.126 ms 1 /classes/Product.php:3860
3305
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2769) AND (b.`id_shop` = 1) LIMIT 1
1.126 ms 1 /src/Adapter/EntityMapper.php:71
4253
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (5143) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.126 ms 1 Yes Yes /classes/Product.php:4524
1261
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2647 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2647 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.125 ms 0 /classes/Cart.php:1430
4333
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3458) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.125 ms 1 Yes Yes /classes/Product.php:4524
2988
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 9697 AND id_shop=1 LIMIT 1
1.124 ms 1 /classes/Product.php:6876
2942
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 9692 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.123 ms 11 Yes /classes/SpecificPrice.php:576
2226
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 6107 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 6107 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.122 ms 0 /classes/Cart.php:1430
4323
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2637) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.122 ms 1 Yes Yes /classes/Product.php:4524
3870
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 7942
ORDER BY `position`
1.118 ms 1 Yes /classes/Product.php:3545
2962
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 9694 LIMIT 1
1.117 ms 11 /classes/SpecificPrice.php:435
1522
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3454 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.114 ms 10 Yes /classes/SpecificPrice.php:576
1764
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3757 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.114 ms 10 Yes /classes/SpecificPrice.php:576
3145
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 10304 LIMIT 1
1.112 ms 10 /classes/SpecificPrice.php:435
3290
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2652) AND (b.`id_shop` = 1) LIMIT 1
1.111 ms 1 /src/Adapter/EntityMapper.php:71
2165
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 5970 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.110 ms 10 Yes /classes/SpecificPrice.php:576
2820
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 9325 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.110 ms 10 Yes /classes/SpecificPrice.php:576
3260
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 5134) AND (b.`id_shop` = 1) LIMIT 1
1.109 ms 1 /src/Adapter/EntityMapper.php:71
2496
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 6499 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.107 ms 10 Yes /classes/SpecificPrice.php:576
2081
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 5283 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 5283 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.106 ms 0 /classes/Cart.php:1430
3890
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 8392) AND (b.`id_shop` = 1) LIMIT 1
1.106 ms 1 /src/Adapter/EntityMapper.php:71
4330
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2620) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.105 ms 1 Yes Yes /classes/Product.php:4524
109
SELECT SQL_NO_CACHE tr.*
FROM `hgt78_tax_rule` tr
JOIN `hgt78_tax_rules_group` trg ON (tr.`id_tax_rules_group` = trg.`id_tax_rules_group`)
WHERE trg.`active` = 1
AND tr.`id_country` = 8
AND tr.`id_tax_rules_group` = 0
AND tr.`id_state` IN (0, 0)
AND ('04510' BETWEEN tr.`zipcode_from` AND tr.`zipcode_to`
OR (tr.`zipcode_to` = 0 AND tr.`zipcode_from` IN(0, '04510')))
ORDER BY tr.`zipcode_from` DESC, tr.`zipcode_to` DESC, tr.`id_state` DESC, tr.`id_country` DESC
1.104 ms 0 /classes/tax/TaxRulesTaxManager.php:109
2564
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 7942 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.104 ms 10 Yes /classes/SpecificPrice.php:576
3982
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 9697) AND (b.`id_shop` = 1) LIMIT 1
1.104 ms 1 /src/Adapter/EntityMapper.php:71
1982
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4935
ORDER BY f.position ASC
1.103 ms 5 Yes /classes/Product.php:6021
1952
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4932 LIMIT 1
1.101 ms 10 /classes/SpecificPrice.php:435
4336
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2626) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.101 ms 1 Yes Yes /classes/Product.php:4524
517
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2773 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.098 ms 10 Yes /classes/SpecificPrice.php:576
1645
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3746 AND id_shop=1 LIMIT 1
1.098 ms 1 /classes/Product.php:6876
1810
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3766)
1.098 ms 1 /classes/Product.php:3860
2756
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 8975) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
1.098 ms 1 /classes/stock/StockAvailable.php:453
3103
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 10298 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.098 ms 10 Yes /classes/SpecificPrice.php:576
4297
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2797) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.097 ms 1 Yes Yes /classes/Product.php:4524
2110
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 5296)
1.096 ms 1 /classes/Product.php:3860
4045
SELECT SQL_NO_CACHE 1 FROM hgt78_cart_product cp INNER JOIN hgt78_product p
ON (p.id_product = cp.id_product) INNER JOIN hgt78_product_shop ps
ON (ps.id_shop = cp.id_shop AND ps.id_product = p.id_product) WHERE cp.id_cart=0 LIMIT 1
1.095 ms 1 /classes/Cart.php:4255
3449
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2638) AND (b.`id_shop` = 1) LIMIT 1
1.094 ms 1 /src/Adapter/EntityMapper.php:71
3635
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3751) AND (b.`id_shop` = 1) LIMIT 1
1.093 ms 1 /src/Adapter/EntityMapper.php:71
914
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2659 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.091 ms 10 Yes /classes/SpecificPrice.php:576
1223
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3456 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.091 ms 10 Yes /classes/SpecificPrice.php:576
3623
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3747) AND (b.`id_shop` = 1) LIMIT 1
1.090 ms 1 /src/Adapter/EntityMapper.php:71
2408
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 6187 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.089 ms 10 Yes /classes/SpecificPrice.php:576
2542
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 7940 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.088 ms 10 Yes /classes/SpecificPrice.php:576
2673
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 8396 LIMIT 1
1.088 ms 10 /classes/SpecificPrice.php:435
2444
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 6191 AND `id_group` = 1 LIMIT 1
1.087 ms 0 /classes/GroupReduction.php:156
4024
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 10304) AND (b.`id_shop` = 1) LIMIT 1
1.087 ms 1 /src/Adapter/EntityMapper.php:71
919
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2659 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2659 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.086 ms 0 /classes/Cart.php:1430
1721
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3753)
1.086 ms 1 /classes/Product.php:3860
2371
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 6184
AND image_shop.`cover` = 1 LIMIT 1
1.086 ms 1 /classes/Product.php:3570
3944
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 9596) AND (b.`id_shop` = 1) LIMIT 1
1.086 ms 1 /src/Adapter/EntityMapper.php:71
567
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2766
ORDER BY f.position ASC
1.085 ms 5 Yes /classes/Product.php:6021
3389
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2794) AND (b.`id_shop` = 1) LIMIT 1
1.084 ms 1 /src/Adapter/EntityMapper.php:71
4292
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2764) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.084 ms 1 Yes Yes /classes/Product.php:4524
3212
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 7539) AND (b.`id_shop` = 1) LIMIT 1
1.084 ms 1 /src/Adapter/EntityMapper.php:71
2134
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 5589 AND id_shop=1 LIMIT 1
1.083 ms 1 /classes/Product.php:6876
4320
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2634) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.083 ms 1 Yes Yes /classes/Product.php:4524
284
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 5138 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.083 ms 10 Yes /classes/SpecificPrice.php:576
3647
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3755) AND (b.`id_shop` = 1) LIMIT 1
1.081 ms 1 /src/Adapter/EntityMapper.php:71
2653
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 8393 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.081 ms 10 Yes /classes/SpecificPrice.php:576
2753
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 8975)
1.081 ms 1 /classes/Product.php:3860
4278
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2770) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.081 ms 1 Yes Yes /classes/Product.php:4524
3286
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2694
1.080 ms 1 /classes/Product.php:2902
1445
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3132 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.079 ms 10 Yes /classes/SpecificPrice.php:576
2458
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 6192
ORDER BY f.position ASC
1.079 ms 5 Yes /classes/Product.php:6021
3606
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3585
ORDER BY `position`
1.079 ms 1 Yes /classes/Product.php:3545
2717
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 8418 LIMIT 1
1.078 ms 10 /classes/SpecificPrice.php:435
1289
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2643 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.077 ms 10 Yes /classes/SpecificPrice.php:576
3092
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 10297 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.076 ms 10 Yes /classes/SpecificPrice.php:576
4252
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (5144) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.076 ms 1 Yes Yes /classes/Product.php:4524
688
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2778 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2778 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.075 ms 0 /classes/Cart.php:1430
782
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3176 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.075 ms 10 Yes /classes/SpecificPrice.php:576
3605
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3585) AND (b.`id_shop` = 1) LIMIT 1
1.074 ms 1 /src/Adapter/EntityMapper.php:71
4170
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 262 AND `id_shop` = 1
1.074 ms 6 /src/Adapter/EntityMapper.php:79
4258
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (5138) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.074 ms 1 Yes Yes /classes/Product.php:4524
2221
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 6107 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.073 ms 10 Yes /classes/SpecificPrice.php:576
1725
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3753 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3753 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.073 ms 0 /classes/Cart.php:1430
561
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2766 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.072 ms 10 Yes /classes/SpecificPrice.php:576
3132
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 10303
AND image_shop.`cover` = 1 LIMIT 1
1.071 ms 1 /classes/Product.php:3570
3644
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3754) AND (b.`id_shop` = 1) LIMIT 1
1.071 ms 1 /src/Adapter/EntityMapper.php:71
2633
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 7773 AND id_shop=1 LIMIT 1
1.070 ms 1 /classes/Product.php:6876
3065
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 10073
AND image_shop.`cover` = 1 LIMIT 1
1.070 ms 1 /classes/Product.php:3570
3231
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5144
ORDER BY `position`
1.070 ms 1 Yes /classes/Product.php:3545
3257
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 5135) AND (b.`id_shop` = 1) LIMIT 1
1.070 ms 1 /src/Adapter/EntityMapper.php:71
3578
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2733) AND (b.`id_shop` = 1) LIMIT 1
1.070 ms 1 /src/Adapter/EntityMapper.php:71
4260
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (5136) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.068 ms 1 Yes Yes /classes/Product.php:4524
3579
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2733
ORDER BY `position`
1.067 ms 1 Yes /classes/Product.php:3545
771
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3075 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.067 ms 10 Yes /classes/SpecificPrice.php:576
1423
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3099 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.067 ms 10 Yes /classes/SpecificPrice.php:576
2159
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 5591 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 5591 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.065 ms 0 /classes/Cart.php:1430
3057
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 10072
ORDER BY `id_specific_price_priority` DESC LIMIT 1
1.065 ms 0 /classes/SpecificPrice.php:259
1074
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3477 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3477 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.065 ms 0 /classes/Cart.php:1430
1577
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3584 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.063 ms 10 Yes /classes/SpecificPrice.php:576
2384
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 6185 LIMIT 1
1.063 ms 10 /classes/SpecificPrice.php:435
903
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3177 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.062 ms 10 Yes /classes/SpecificPrice.php:576
3836
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 6191) AND (b.`id_shop` = 1) LIMIT 1
1.062 ms 1 /src/Adapter/EntityMapper.php:71
1661
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3748
AND image_shop.`cover` = 1 LIMIT 1
1.060 ms 1 /classes/Product.php:3570
1711
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3752 AND id_shop=1 LIMIT 1
1.060 ms 1 /classes/Product.php:6876
1305
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2655 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2655 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.059 ms 0 /classes/Cart.php:1430
2215
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 6047 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 6047 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.059 ms 0 /classes/Cart.php:1430
3683
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3805) AND (b.`id_shop` = 1) LIMIT 1
1.059 ms 1 /src/Adapter/EntityMapper.php:71
3183
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 12551 AND id_shop=1 LIMIT 1
1.059 ms 1 /classes/Product.php:6876
4255
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (5141) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.058 ms 1 Yes Yes /classes/Product.php:4524
3395
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2780) AND (b.`id_shop` = 1) LIMIT 1
1.057 ms 1 /src/Adapter/EntityMapper.php:71
17
SELECT SQL_NO_CACHE m.`id_module`, m.`name`, ms.`id_module`as `mshop`
FROM `hgt78_module` m
LEFT JOIN `hgt78_module_shop` ms
ON m.`id_module` = ms.`id_module`
AND ms.`id_shop` = 1
1.056 ms 118 /classes/module/Module.php:346
2381
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 6184
ORDER BY f.position ASC
1.056 ms 5 Yes /classes/Product.php:6021
3193
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 11001 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.055 ms 10 Yes /classes/SpecificPrice.php:576
3239
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 5141) AND (b.`id_shop` = 1) LIMIT 1
1.054 ms 1 /src/Adapter/EntityMapper.php:71
3833
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 6189) AND (b.`id_shop` = 1) LIMIT 1
1.054 ms 1 /src/Adapter/EntityMapper.php:71
1798
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3765 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.054 ms 11 Yes /classes/SpecificPrice.php:576
3908
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 8417) AND (b.`id_shop` = 1) LIMIT 1
1.054 ms 1 /src/Adapter/EntityMapper.php:71
1610
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3639 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.052 ms 10 Yes /classes/SpecificPrice.php:576
2360
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 6183
AND image_shop.`cover` = 1 LIMIT 1
1.052 ms 1 /classes/Product.php:3570
69
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a0
LEFT JOIN `hgt78_category_lang` `a1` ON (a0.`id_category` = a1.`id_category`)
WHERE (a0.`nleft` < 2) AND (a0.`nright` > 577) AND (a1.`id_lang` = 1) AND (a1.`id_shop` = 1)
ORDER BY a0.`nleft` asc
1.051 ms 1 /classes/PrestaShopCollection.php:383
251
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 5141 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.050 ms 10 Yes /classes/SpecificPrice.php:576
1250
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2658 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2658 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.050 ms 0 /classes/Cart.php:1430
969
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2634 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.048 ms 10 Yes /classes/SpecificPrice.php:576
2463
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 6193 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.048 ms 10 Yes /classes/SpecificPrice.php:576
1824
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3771) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
1.047 ms 1 /classes/stock/StockAvailable.php:453
4271
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2660) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.047 ms 1 Yes Yes /classes/Product.php:4524
4479
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (8419) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.047 ms 1 Yes Yes /classes/Product.php:4524
4249
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (5147) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.045 ms 1 Yes Yes /classes/Product.php:4524
4251
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (5145) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.045 ms 1 Yes Yes /classes/Product.php:4524
2902
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 9688) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
1.043 ms 1 /classes/stock/StockAvailable.php:453
4351
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2644) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.042 ms 1 Yes Yes /classes/Product.php:4524
716
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2797 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.042 ms 10 Yes /classes/SpecificPrice.php:576
550
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2776 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.040 ms 10 Yes /classes/SpecificPrice.php:576
936
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2631 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.040 ms 10 Yes /classes/SpecificPrice.php:576
943
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2632
AND image_shop.`cover` = 1 LIMIT 1
1.040 ms 1 /classes/Product.php:3570
2861
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
1.040 ms 1 /classes/Product.php:5659
1840
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3776 LIMIT 1
1.039 ms 10 /classes/SpecificPrice.php:435
2986
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 9697 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.039 ms 11 Yes /classes/SpecificPrice.php:576
1746
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3755) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
1.038 ms 1 /classes/stock/StockAvailable.php:453
3016
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 10068
ORDER BY f.position ASC
1.038 ms 5 Yes /classes/Product.php:6021
3122
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 184 LIMIT 1
1.035 ms 1 /classes/Product.php:5659
3641
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3753) AND (b.`id_shop` = 1) LIMIT 1
1.035 ms 1 /src/Adapter/EntityMapper.php:71
4466
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (7944) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.034 ms 1 Yes Yes /classes/Product.php:4524
3857
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 6501) AND (b.`id_shop` = 1) LIMIT 1
1.032 ms 1 /src/Adapter/EntityMapper.php:71
1489
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2733 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.032 ms 10 Yes /classes/SpecificPrice.php:576
1742
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3755 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.030 ms 10 Yes /classes/SpecificPrice.php:576
1977
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4935)
1.029 ms 1 /classes/Product.php:3860
2425
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 6188
ORDER BY f.position ASC
1.029 ms 5 Yes /classes/Product.php:6021
1905
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3808
AND image_shop.`cover` = 1 LIMIT 1
1.028 ms 1 /classes/Product.php:3570
3988
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 10068) AND (b.`id_shop` = 1) LIMIT 1
1.028 ms 1 /src/Adapter/EntityMapper.php:71
4327
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2629) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.028 ms 1 Yes Yes /classes/Product.php:4524
110
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 7543) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
1.027 ms 1 /classes/stock/StockAvailable.php:453
2076
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 5283 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.027 ms 9 Yes /classes/SpecificPrice.php:576
2213
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 6047 AND `id_group` = 1 LIMIT 1
1.027 ms 0 /classes/GroupReduction.php:156
2960
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 9694
AND image_shop.`cover` = 1 LIMIT 1
1.027 ms 1 /classes/Product.php:3570
3653
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3757) AND (b.`id_shop` = 1) LIMIT 1
1.027 ms 1 /src/Adapter/EntityMapper.php:71
3970
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 9692) AND (b.`id_shop` = 1) LIMIT 1
1.026 ms 1 /src/Adapter/EntityMapper.php:71
2773
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 9055 LIMIT 1
1.026 ms 13 /classes/SpecificPrice.php:435
3019
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 10069) AND (b.`id_shop` = 1) LIMIT 1
1.026 ms 1 /src/Adapter/EntityMapper.php:71
3282
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2893
ORDER BY `position`
1.025 ms 1 Yes /classes/Product.php:3545
3498
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2656
ORDER BY `position`
1.025 ms 1 Yes /classes/Product.php:3545
3491
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2640) AND (b.`id_shop` = 1) LIMIT 1
1.023 ms 1 /src/Adapter/EntityMapper.php:71
4329
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3477) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.023 ms 1 Yes Yes /classes/Product.php:4524
3926
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 9055) AND (b.`id_shop` = 1) LIMIT 1
1.022 ms 1 /src/Adapter/EntityMapper.php:71
506
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2770 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.022 ms 10 Yes /classes/SpecificPrice.php:576
1816
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3771
AND image_shop.`cover` = 1 LIMIT 1
1.021 ms 1 /classes/Product.php:3570
3056
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 10072 LIMIT 1
1.020 ms 10 /classes/SpecificPrice.php:435
2124
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 5093) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
1.019 ms 1 /classes/stock/StockAvailable.php:453
2192
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 5972 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 5972 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.019 ms 0 /classes/Cart.php:1430
1932
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4574)
1.018 ms 1 /classes/Product.php:3860
2966
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 9694 AND id_shop=1 LIMIT 1
1.018 ms 1 /classes/Product.php:6876
3086
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 10111 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 10111 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.018 ms 0 /classes/Cart.php:1430
3650
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3756) AND (b.`id_shop` = 1) LIMIT 1
1.017 ms 1 /src/Adapter/EntityMapper.php:71
2235
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 6108 AND `id_group` = 1 LIMIT 1
1.016 ms 0 /classes/GroupReduction.php:156
7
SELECT SQL_NO_CACHE *
FROM `hgt78_country` a
LEFT JOIN `hgt78_country_lang` `b` ON a.`id_country` = b.`id_country` AND b.`id_lang` = 1
LEFT JOIN `hgt78_country_shop` `c` ON a.`id_country` = c.`id_country` AND c.`id_shop` = 1
WHERE (a.`id_country` = 8) LIMIT 1
1.016 ms 1 /src/Adapter/EntityMapper.php:71
1772
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `hgt78_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 174 LIMIT 1
1.016 ms 1 /classes/Category.php:1378
947
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2632 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.015 ms 10 Yes /classes/SpecificPrice.php:576
2353
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 6182 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.015 ms 10 Yes /classes/SpecificPrice.php:576
1566
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3558 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.013 ms 10 Yes /classes/SpecificPrice.php:576
3037
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 10070 AND `id_group` = 1 LIMIT 1
1.013 ms 0 /classes/GroupReduction.php:156
3224
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 5146) AND (b.`id_shop` = 1) LIMIT 1
1.013 ms 1 /src/Adapter/EntityMapper.php:71
3684
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3805
ORDER BY `position`
1.013 ms 1 Yes /classes/Product.php:3545
238
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 5142 LIMIT 1
1.011 ms 10 /classes/SpecificPrice.php:435
1327
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2645 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2645 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.011 ms 0 /classes/Cart.php:1430
1660
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3747
ORDER BY f.position ASC
1.011 ms 5 Yes /classes/Product.php:6021
2929
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 9691 LIMIT 1
1.011 ms 11 /classes/SpecificPrice.php:435
1621
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3689 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.010 ms 10 Yes /classes/SpecificPrice.php:576
568
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2765
AND image_shop.`cover` = 1 LIMIT 1
1.009 ms 1 /classes/Product.php:3570
732
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2798 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2798 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.009 ms 0 /classes/Cart.php:1430
2342
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 6181 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.009 ms 10 Yes /classes/SpecificPrice.php:576
2967
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 9694 AND `id_group` = 1 LIMIT 1
1.009 ms 0 /classes/GroupReduction.php:156
2675
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 8396 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.008 ms 10 Yes /classes/SpecificPrice.php:576
3153
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 10304
ORDER BY f.position ASC
1.008 ms 5 Yes /classes/Product.php:6021
3620
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3746) AND (b.`id_shop` = 1) LIMIT 1
1.008 ms 1 /src/Adapter/EntityMapper.php:71
2120
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 5093 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.006 ms 9 Yes /classes/SpecificPrice.php:576
3941
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 9535) AND (b.`id_shop` = 1) LIMIT 1
1.006 ms 1 /src/Adapter/EntityMapper.php:71
1681
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3749 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3749 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.005 ms 0 /classes/Cart.php:1430
1971
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4934
ORDER BY f.position ASC
1.005 ms 5 Yes /classes/Product.php:6021
140
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 7540 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.005 ms 10 Yes /classes/SpecificPrice.php:576
683
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2778 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.005 ms 10 Yes /classes/SpecificPrice.php:576
2643
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 8392)
1.005 ms 1 /classes/Product.php:3860
3614
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3689) AND (b.`id_shop` = 1) LIMIT 1
1.005 ms 1 /src/Adapter/EntityMapper.php:71
3866
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 7941) AND (b.`id_shop` = 1) LIMIT 1
1.005 ms 1 /src/Adapter/EntityMapper.php:71
4335
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2625) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.005 ms 1 Yes Yes /classes/Product.php:4524
2610
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 7946 AND id_shop=1 LIMIT 1
1.004 ms 1 /classes/Product.php:6876
2751
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 8975
ORDER BY `id_specific_price_priority` DESC LIMIT 1
1.004 ms 0 /classes/SpecificPrice.php:259
826
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2781 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.001 ms 10 Yes /classes/SpecificPrice.php:576
3108
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 10298 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 10298 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.001 ms 0 /classes/Cart.php:1430
1245
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2658 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.001 ms 10 Yes /classes/SpecificPrice.php:576
3015
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 10068 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 10068 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.001 ms 0 /classes/Cart.php:1430
963
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2633 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2633 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.000 ms 0 /classes/Cart.php:1430
981
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2782 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.999 ms 10 Yes /classes/SpecificPrice.php:576
4289
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2693) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.999 ms 1 Yes Yes /classes/Product.php:4524
2276
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 6174 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.998 ms 10 Yes /classes/SpecificPrice.php:576
1356
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3264 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.997 ms 10 Yes /classes/SpecificPrice.php:576
1961
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4934
AND image_shop.`cover` = 1 LIMIT 1
0.996 ms 1 /classes/Product.php:3570
4481
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (8975) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.996 ms 1 Yes Yes /classes/Product.php:4524
3362
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2795) AND (b.`id_shop` = 1) LIMIT 1
0.996 ms 1 /src/Adapter/EntityMapper.php:71
3812
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 6182) AND (b.`id_shop` = 1) LIMIT 1
0.996 ms 1 /src/Adapter/EntityMapper.php:71
3315
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2774
ORDER BY `position`
0.995 ms 1 Yes /classes/Product.php:3545
2233
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 6108)
0.994 ms 1 /classes/Product.php:3860
2190
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 5972 AND `id_group` = 1 LIMIT 1
0.993 ms 0 /classes/GroupReduction.php:156
3602
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3584) AND (b.`id_shop` = 1) LIMIT 1
0.992 ms 1 /src/Adapter/EntityMapper.php:71
4048
SELECT SQL_NO_CACHE 1 FROM `hgt78_cart_rule` WHERE ((date_to >= "2025-05-01 00:00:00" AND date_to <= "2025-05-01 23:59:59") OR (date_from >= "2025-05-01 00:00:00" AND date_from <= "2025-05-01 23:59:59") OR (date_from < "2025-05-01 00:00:00" AND date_to > "2025-05-01 23:59:59")) AND `id_customer` IN (0,0) LIMIT 1
0.992 ms 29 /classes/CartRule.php:357
56
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 13) AND (b.`id_shop` = 1) LIMIT 1
0.991 ms 1 /src/Adapter/EntityMapper.php:71
300
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 5137 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 5137 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.991 ms 0 /classes/Cart.php:1430
1667
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3748 AND id_shop=1 LIMIT 1
0.991 ms 1 /classes/Product.php:6876
1672
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3749
AND image_shop.`cover` = 1 LIMIT 1
0.991 ms 1 /classes/Product.php:3570
1920
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4256 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.991 ms 10 Yes /classes/SpecificPrice.php:576
2849
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 9597
AND image_shop.`cover` = 1 LIMIT 1
0.991 ms 1 /classes/Product.php:3570
2398
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 6186)
0.990 ms 1 /classes/Product.php:3860
1113
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3458 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.990 ms 10 Yes /classes/SpecificPrice.php:576
267
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 5140 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 5140 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.989 ms 0 /classes/Cart.php:1430
2998
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 10067 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.989 ms 10 Yes /classes/SpecificPrice.php:576
3388
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3176
0.989 ms 1 /classes/Product.php:2902
1086
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2620
ORDER BY f.position ASC
0.987 ms 5 Yes /classes/Product.php:6021
4133
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 35) LIMIT 1
0.987 ms 1 /src/Adapter/EntityMapper.php:71
2365
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 6183)
0.987 ms 1 /classes/Product.php:3860
3227
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 5145) AND (b.`id_shop` = 1) LIMIT 1
0.987 ms 1 /src/Adapter/EntityMapper.php:71
2114
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 5296 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 5296 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.986 ms 0 /classes/Cart.php:1430
2658
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 8393 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 8393 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.985 ms 0 /classes/Cart.php:1430
925
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2635 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.985 ms 10 Yes /classes/SpecificPrice.php:576
4343
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3456) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.985 ms 1 Yes Yes /classes/Product.php:4524
2032
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4964 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.984 ms 10 Yes /classes/SpecificPrice.php:576
2478
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 6194) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.984 ms 1 /classes/stock/StockAvailable.php:453
241
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 5142)
0.983 ms 1 /classes/Product.php:3860
2558
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 7941 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 7941 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.983 ms 0 /classes/Cart.php:1430
2622
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 7769 AND id_shop=1 LIMIT 1
0.982 ms 1 /classes/Product.php:6876
430
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2660 AND id_shop=1 LIMIT 1
0.981 ms 1 /classes/Product.php:6876
3911
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 8418) AND (b.`id_shop` = 1) LIMIT 1
0.980 ms 1 /src/Adapter/EntityMapper.php:71
3938
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 9325) AND (b.`id_shop` = 1) LIMIT 1
0.980 ms 1 /src/Adapter/EntityMapper.php:71
2167
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 5970 AND id_shop=1 LIMIT 1
0.980 ms 1 /classes/Product.php:6876
3553
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3155
0.980 ms 1 /classes/Product.php:2902
2219
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 6107 LIMIT 1
0.979 ms 10 /classes/SpecificPrice.php:435
322
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 5135 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 5135 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.978 ms 0 /classes/Cart.php:1430
3515
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2647) AND (b.`id_shop` = 1) LIMIT 1
0.977 ms 1 /src/Adapter/EntityMapper.php:71
3929
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 9321) AND (b.`id_shop` = 1) LIMIT 1
0.977 ms 1 /src/Adapter/EntityMapper.php:71
892
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2792 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.976 ms 10 Yes /classes/SpecificPrice.php:576
4015
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 10299) AND (b.`id_shop` = 1) LIMIT 1
0.975 ms 1 /src/Adapter/EntityMapper.php:71
2749
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 181 LIMIT 1
0.975 ms 1 /classes/Product.php:5659
564
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2766 AND `id_group` = 1 LIMIT 1
0.974 ms 0 /classes/GroupReduction.php:156
262
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 5140 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.974 ms 10 Yes /classes/SpecificPrice.php:576
2620
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 7769 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.974 ms 10 Yes /classes/SpecificPrice.php:576
2108
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 5296
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.973 ms 1 /classes/SpecificPrice.php:259
2909
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 9689 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.973 ms 11 Yes /classes/SpecificPrice.php:576
3570
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3327
ORDER BY `position`
0.973 ms 2 Yes /classes/Product.php:3545
3912
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 8418
ORDER BY `position`
0.973 ms 1 Yes /classes/Product.php:3545
4313
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2792) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.973 ms 1 Yes Yes /classes/Product.php:4524
3500
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2648) AND (b.`id_shop` = 1) LIMIT 1
0.971 ms 1 /src/Adapter/EntityMapper.php:71
2140
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 198 LIMIT 1
0.969 ms 1 /classes/Product.php:5659
4324
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2638) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.969 ms 1 Yes Yes /classes/Product.php:4524
361
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3743 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.968 ms 10 Yes /classes/SpecificPrice.php:576
4304
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2794) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.968 ms 1 Yes Yes /classes/Product.php:4524
416
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2694 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.967 ms 10 Yes /classes/SpecificPrice.php:576
2832
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 9535)
0.967 ms 1 /classes/Product.php:3860
3143
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 10304
AND image_shop.`cover` = 1 LIMIT 1
0.967 ms 1 /classes/Product.php:3570
4317
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2631) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.967 ms 1 Yes Yes /classes/Product.php:4524
1268
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2646)
0.966 ms 1 /classes/Product.php:3860
3398
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2781) AND (b.`id_shop` = 1) LIMIT 1
0.966 ms 1 /src/Adapter/EntityMapper.php:71
3494
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2641) AND (b.`id_shop` = 1) LIMIT 1
0.966 ms 1 /src/Adapter/EntityMapper.php:71
1753
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3756 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.966 ms 10 Yes /classes/SpecificPrice.php:576
4033
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 12551) AND (b.`id_shop` = 1) LIMIT 1
0.965 ms 1 /src/Adapter/EntityMapper.php:71
3958
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 9688) AND (b.`id_shop` = 1) LIMIT 1
0.965 ms 1 /src/Adapter/EntityMapper.php:71
522
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2773 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2773 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.964 ms 0 /classes/Cart.php:1430
4344
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2649) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.964 ms 1 Yes Yes /classes/Product.php:4524
1960
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4932
ORDER BY f.position ASC
0.962 ms 5 Yes /classes/Product.php:6021
2185
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 5972 LIMIT 1
0.962 ms 10 /classes/SpecificPrice.php:435
2810
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 9324)
0.962 ms 1 /classes/Product.php:3860
253
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 5141 AND id_shop=1 LIMIT 1
0.961 ms 1 /classes/Product.php:6876
4027
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 10305) AND (b.`id_shop` = 1) LIMIT 1
0.961 ms 1 /src/Adapter/EntityMapper.php:71
881
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2791 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.960 ms 10 Yes /classes/SpecificPrice.php:576
1707
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3752 LIMIT 1
0.959 ms 10 /classes/SpecificPrice.php:435
3198
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 11001 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 11001 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.959 ms 0 /classes/Cart.php:1430
3955
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 9686) AND (b.`id_shop` = 1) LIMIT 1
0.959 ms 1 /src/Adapter/EntityMapper.php:71
3106
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 10298 AND `id_group` = 1 LIMIT 1
0.958 ms 0 /classes/GroupReduction.php:156
2070
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 5282 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 5282 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.958 ms 0 /classes/Cart.php:1430
4338
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2640) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.958 ms 1 Yes Yes /classes/Product.php:4524
1664
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3748
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.957 ms 0 /classes/SpecificPrice.php:259
3824
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 6186) AND (b.`id_shop` = 1) LIMIT 1
0.957 ms 1 /src/Adapter/EntityMapper.php:71
3302
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2768) AND (b.`id_shop` = 1) LIMIT 1
0.956 ms 1 /src/Adapter/EntityMapper.php:71
2304
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 6177
ORDER BY f.position ASC
0.954 ms 5 Yes /classes/Product.php:6021
3831
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 6188
ORDER BY `position`
0.954 ms 1 Yes /classes/Product.php:3545
2670
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 8395
ORDER BY f.position ASC
0.954 ms 5 Yes /classes/Product.php:6021
3036
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 10070 AND id_shop=1 LIMIT 1
0.954 ms 1 /classes/Product.php:6876
4298
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2798) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.954 ms 1 Yes Yes /classes/Product.php:4524
2087
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 5284 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.953 ms 9 Yes /classes/SpecificPrice.php:576
754
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2800 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2800 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.952 ms 0 /classes/Cart.php:1430
1712
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3752 AND `id_group` = 1 LIMIT 1
0.952 ms 0 /classes/GroupReduction.php:156
2287
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 6176 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.952 ms 10 Yes /classes/SpecificPrice.php:576
2419
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 6188 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.952 ms 10 Yes /classes/SpecificPrice.php:576
2456
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 6192) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.952 ms 1 /classes/stock/StockAvailable.php:453
1599
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3586 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.951 ms 10 Yes /classes/SpecificPrice.php:576
2882
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 9687
ORDER BY f.position ASC
0.951 ms 5 Yes /classes/Product.php:6021
4307
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2781) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.951 ms 1 Yes Yes /classes/Product.php:4524
1844
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3776 AND id_shop=1 LIMIT 1
0.950 ms 1 /classes/Product.php:6876
1976
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4935 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.950 ms 10 Yes /classes/SpecificPrice.php:576
3053
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 10072
AND image_shop.`cover` = 1 LIMIT 1
0.950 ms 1 /classes/Product.php:3570
3014
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 10068) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.950 ms 1 /classes/stock/StockAvailable.php:453
1184
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2641 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2641 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.949 ms 0 /classes/Cart.php:1430
2349
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 6182
AND image_shop.`cover` = 1 LIMIT 1
0.949 ms 1 /classes/Product.php:3570
4179
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 307) LIMIT 1
0.949 ms 1 /src/Adapter/EntityMapper.php:71
4276
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2768) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.949 ms 1 Yes Yes /classes/Product.php:4524
256
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 5141 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 5141 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.948 ms 0 /classes/Cart.php:1430
2897
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 9688
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.948 ms 0 /classes/SpecificPrice.php:259
2131
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 5589
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.947 ms 0 /classes/SpecificPrice.php:259
1802
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3765) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.946 ms 1 /classes/stock/StockAvailable.php:453
2567
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 7942 AND `id_group` = 1 LIMIT 1
0.946 ms 0 /classes/GroupReduction.php:156
2803
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 9323 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 9323 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.946 ms 0 /classes/Cart.php:1430
3662
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3765) AND (b.`id_shop` = 1) LIMIT 1
0.946 ms 1 /src/Adapter/EntityMapper.php:71
3963
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 9689
0.946 ms 1 /classes/Product.php:2902
1269
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2646 AND id_shop=1 LIMIT 1
0.945 ms 1 /classes/Product.php:6876
1036
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2630 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.944 ms 10 Yes /classes/SpecificPrice.php:576
1683
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3750
AND image_shop.`cover` = 1 LIMIT 1
0.944 ms 1 /classes/Product.php:3570
2903
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 9688 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 9688 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.944 ms 0 /classes/Cart.php:1430
4000
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 10072) AND (b.`id_shop` = 1) LIMIT 1
0.941 ms 1 /src/Adapter/EntityMapper.php:71
4288
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2692) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.941 ms 1 Yes Yes /classes/Product.php:4524
1874
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3805 LIMIT 1
0.940 ms 10 /classes/SpecificPrice.php:435
3060
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 10072 AND id_shop=1 LIMIT 1
0.940 ms 1 /classes/Product.php:6876
4322
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2636) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.940 ms 1 Yes Yes /classes/Product.php:4524
2850
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.940 ms 1 /classes/Product.php:5659
1322
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2645 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.939 ms 10 Yes /classes/SpecificPrice.php:576
3935
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 9324) AND (b.`id_shop` = 1) LIMIT 1
0.939 ms 1 /src/Adapter/EntityMapper.php:71
1389
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3155 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.938 ms 10 Yes /classes/SpecificPrice.php:576
1946
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4575) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.938 ms 1 /classes/stock/StockAvailable.php:453
3608
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3586) AND (b.`id_shop` = 1) LIMIT 1
0.938 ms 1 /src/Adapter/EntityMapper.php:71
3914
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 8419) AND (b.`id_shop` = 1) LIMIT 1
0.938 ms 1 /src/Adapter/EntityMapper.php:71
3876
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 7944
ORDER BY `position`
0.937 ms 1 Yes /classes/Product.php:3545
2778
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 9055 AND `id_group` = 1 LIMIT 1
0.937 ms 0 /classes/GroupReduction.php:156
317
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 5135 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.936 ms 10 Yes /classes/SpecificPrice.php:576
1500
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2650 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.936 ms 10 Yes /classes/SpecificPrice.php:576
2461
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 6193 LIMIT 1
0.936 ms 10 /classes/SpecificPrice.php:435
3209
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 7540) AND (b.`id_shop` = 1) LIMIT 1
0.936 ms 1 /src/Adapter/EntityMapper.php:71
240
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 5142 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.935 ms 10 Yes /classes/SpecificPrice.php:576
394
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3587 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.935 ms 11 Yes /classes/SpecificPrice.php:576
2010
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4944 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.935 ms 10 Yes /classes/SpecificPrice.php:576
3997
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 10071) AND (b.`id_shop` = 1) LIMIT 1
0.935 ms 1 /src/Adapter/EntityMapper.php:71
2959
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 9693
ORDER BY f.position ASC
0.935 ms 5 Yes /classes/Product.php:6021
2109
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 5296 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.934 ms 11 Yes /classes/SpecificPrice.php:576
1865
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3804 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.933 ms 10 Yes /classes/SpecificPrice.php:576
3964
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 9690) AND (b.`id_shop` = 1) LIMIT 1
0.933 ms 1 /src/Adapter/EntityMapper.php:71
461
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2623 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.933 ms 10 Yes /classes/SpecificPrice.php:576
2320
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 6179 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.933 ms 10 Yes /classes/SpecificPrice.php:576
2991
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 9697 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 9697 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.932 ms 0 /classes/Cart.php:1430
1674
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3749 LIMIT 1
0.930 ms 10 /classes/SpecificPrice.php:435
4149
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 37) LIMIT 1
0.930 ms 1 /src/Adapter/EntityMapper.php:71
2254
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 6172 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.929 ms 10 Yes /classes/SpecificPrice.php:576
2098
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 5293 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.928 ms 10 Yes /classes/SpecificPrice.php:576
572
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2765 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.927 ms 10 Yes /classes/SpecificPrice.php:576
1345
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3254 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.927 ms 10 Yes /classes/SpecificPrice.php:576
2555
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 7941 AND id_shop=1 LIMIT 1
0.926 ms 1 /classes/Product.php:6876
2005
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4943
ORDER BY f.position ASC
0.925 ms 5 Yes /classes/Product.php:6021
2168
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 5970 AND `id_group` = 1 LIMIT 1
0.925 ms 0 /classes/GroupReduction.php:156
3401
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3179) AND (b.`id_shop` = 1) LIMIT 1
0.925 ms 1 /src/Adapter/EntityMapper.php:71
98
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 7543
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.924 ms 0 /classes/SpecificPrice.php:259
1179
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2641 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.924 ms 10 Yes /classes/SpecificPrice.php:576
2021
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4963 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.924 ms 10 Yes /classes/SpecificPrice.php:576
3902
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 8397) AND (b.`id_shop` = 1) LIMIT 1
0.923 ms 1 /src/Adapter/EntityMapper.php:71
2602
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 7945 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 7945 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.923 ms 0 /classes/Cart.php:1430
2865
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 9598)
0.923 ms 1 /classes/Product.php:3860
4284
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2765) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.923 ms 1 Yes Yes /classes/Product.php:4524
1787
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3764 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.922 ms 10 Yes /classes/SpecificPrice.php:576
323
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 5135
ORDER BY f.position ASC
0.922 ms 5 Yes /classes/Product.php:6021
2181
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 5971 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 5971 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.922 ms 0 /classes/Cart.php:1430
2764
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 8976)
0.921 ms 1 /classes/Product.php:3860
3509
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2649) AND (b.`id_shop` = 1) LIMIT 1
0.921 ms 1 /src/Adapter/EntityMapper.php:71
3899
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 8396) AND (b.`id_shop` = 1) LIMIT 1
0.921 ms 1 /src/Adapter/EntityMapper.php:71
4468
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (7946) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.921 ms 1 Yes Yes /classes/Product.php:4524
4246
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (7539) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.920 ms 1 Yes Yes /classes/Product.php:4524
4279
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2773) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.920 ms 1 Yes Yes /classes/Product.php:4524
4275
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2767) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.920 ms 1 Yes Yes /classes/Product.php:4524
2310
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 6178)
0.919 ms 1 /classes/Product.php:3860
4018
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 10302) AND (b.`id_shop` = 1) LIMIT 1
0.919 ms 1 /src/Adapter/EntityMapper.php:71
4328
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2628) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.919 ms 1 Yes Yes /classes/Product.php:4524
2280
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 6174) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.919 ms 1 /classes/stock/StockAvailable.php:453
3142
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 10303
ORDER BY f.position ASC
0.919 ms 5 Yes /classes/Product.php:6021
3563
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3107) AND (b.`id_shop` = 1) LIMIT 1
0.919 ms 1 /src/Adapter/EntityMapper.php:71
3950
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 9598) AND (b.`id_shop` = 1) LIMIT 1
0.918 ms 1 /src/Adapter/EntityMapper.php:71
4034
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 12551
ORDER BY `position`
0.918 ms 1 Yes /classes/Product.php:3545
4434
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (6108) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.918 ms 1 Yes Yes /classes/Product.php:4524
2471
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 182 LIMIT 1
0.918 ms 1 /classes/Product.php:5659
1801
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3765 AND `id_group` = 1 LIMIT 1
0.917 ms 0 /classes/GroupReduction.php:156
1435
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3107)
0.916 ms 1 /classes/Product.php:3860
2924
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 9690) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.916 ms 1 /classes/stock/StockAvailable.php:453
3410
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2790) AND (b.`id_shop` = 1) LIMIT 1
0.916 ms 1 /src/Adapter/EntityMapper.php:71
54
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 11) AND (b.`id_shop` = 1) LIMIT 1
0.915 ms 1 /src/Adapter/EntityMapper.php:71
3156
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 10305 LIMIT 1
0.915 ms 10 /classes/SpecificPrice.php:435
2132
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 5589 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.914 ms 10 Yes /classes/SpecificPrice.php:576
2979
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 9695) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.914 ms 1 /classes/stock/StockAvailable.php:453
3400
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2781
0.914 ms 1 /classes/Product.php:2902
450
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2651 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.913 ms 10 Yes /classes/SpecificPrice.php:576
1860
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3804
AND image_shop.`cover` = 1 LIMIT 1
0.913 ms 1 /classes/Product.php:3570
3408
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2789
ORDER BY `position`
0.913 ms 1 Yes /classes/Product.php:3545
3806
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 6180) AND (b.`id_shop` = 1) LIMIT 1
0.913 ms 1 /src/Adapter/EntityMapper.php:71
4444
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (6181) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.913 ms 1 Yes Yes /classes/Product.php:4524
2307
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 6178 LIMIT 1
0.912 ms 10 /classes/SpecificPrice.php:435
749
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2800 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.911 ms 10 Yes /classes/SpecificPrice.php:576
1047
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2629 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.911 ms 10 Yes /classes/SpecificPrice.php:576
2228
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 6108
AND image_shop.`cover` = 1 LIMIT 1
0.911 ms 1 /classes/Product.php:3570
1234
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2649 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.910 ms 10 Yes /classes/SpecificPrice.php:576
3976
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 9694) AND (b.`id_shop` = 1) LIMIT 1
0.910 ms 1 /src/Adapter/EntityMapper.php:71
234
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 5143 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 5143 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.909 ms 0 /classes/Cart.php:1430
2364
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 6183 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.909 ms 10 Yes /classes/SpecificPrice.php:576
3994
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 10070) AND (b.`id_shop` = 1) LIMIT 1
0.909 ms 1 /src/Adapter/EntityMapper.php:71
1064
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2628
ORDER BY f.position ASC
0.908 ms 5 Yes /classes/Product.php:6021
2813
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 9324) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.908 ms 1 /classes/stock/StockAvailable.php:453
425
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.907 ms 1 /classes/Product.php:5659
4078
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 71 AND `id_shop` = 1
0.907 ms 6 /src/Adapter/EntityMapper.php:79
848
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2788 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.906 ms 10 Yes /classes/SpecificPrice.php:576
2474
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 6194 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.906 ms 10 Yes /classes/SpecificPrice.php:576
3203
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 7542) AND (b.`id_shop` = 1) LIMIT 1
0.906 ms 1 /src/Adapter/EntityMapper.php:71
3109
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 10298
ORDER BY f.position ASC
0.905 ms 5 Yes /classes/Product.php:6021
699
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2779 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2779 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.905 ms 0 /classes/Cart.php:1430
3903
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 8397
ORDER BY `position`
0.904 ms 1 Yes /classes/Product.php:3545
4006
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 10111) AND (b.`id_shop` = 1) LIMIT 1
0.904 ms 1 /src/Adapter/EntityMapper.php:71
4309
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2788) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.904 ms 1 Yes Yes /classes/Product.php:4524
2791
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 9321) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.902 ms 1 /classes/stock/StockAvailable.php:453
3569
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3327) AND (b.`id_shop` = 1) LIMIT 1
0.902 ms 1 /src/Adapter/EntityMapper.php:71
2939
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 334 LIMIT 1
0.901 ms 1 /classes/Product.php:5659
528
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2774 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.900 ms 10 Yes /classes/SpecificPrice.php:576
2272
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 6174
AND image_shop.`cover` = 1 LIMIT 1
0.900 ms 1 /classes/Product.php:3570
3005
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 10068
AND image_shop.`cover` = 1 LIMIT 1
0.900 ms 1 /classes/Product.php:3570
4220
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 42) LIMIT 1
0.900 ms 1 /src/Adapter/EntityMapper.php:71
4475
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (8397) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.900 ms 1 Yes Yes /classes/Product.php:4524
2490
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 6195 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 6195 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.899 ms 0 /classes/Cart.php:1430
743
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2799 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2799 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.898 ms 0 /classes/Cart.php:1430
3961
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 9689) AND (b.`id_shop` = 1) LIMIT 1
0.898 ms 1 /src/Adapter/EntityMapper.php:71
1412
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2892 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.897 ms 10 Yes /classes/SpecificPrice.php:576
3177
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 12551
AND image_shop.`cover` = 1 LIMIT 1
0.897 ms 1 /classes/Product.php:3570
4290
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2771) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.897 ms 1 Yes Yes /classes/Product.php:4524
4447
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (6184) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.897 ms 1 Yes Yes /classes/Product.php:4524
484
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2768 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.896 ms 10 Yes /classes/SpecificPrice.php:576
121
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 7542 AND `id_group` = 1 LIMIT 1
0.896 ms 0 /classes/GroupReduction.php:156
1944
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4575 AND id_shop=1 LIMIT 1
0.896 ms 1 /classes/Product.php:6876
4030
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 12552) AND (b.`id_shop` = 1) LIMIT 1
0.896 ms 1 /src/Adapter/EntityMapper.php:71
4176
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 265 AND `id_shop` = 1
0.895 ms 6 /src/Adapter/EntityMapper.php:79
793
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2794 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.894 ms 10 Yes /classes/SpecificPrice.php:576
4009
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 10297) AND (b.`id_shop` = 1) LIMIT 1
0.894 ms 1 /src/Adapter/EntityMapper.php:71
4294
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2778) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.894 ms 1 Yes Yes /classes/Product.php:4524
1954
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4932 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.893 ms 10 Yes /classes/SpecificPrice.php:576
3923
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 8976) AND (b.`id_shop` = 1) LIMIT 1
0.893 ms 1 /src/Adapter/EntityMapper.php:71
91
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 185 LIMIT 1
0.892 ms 1 /classes/Product.php:5659
3359
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2779) AND (b.`id_shop` = 1) LIMIT 1
0.892 ms 1 /src/Adapter/EntityMapper.php:71
638
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2771 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.892 ms 10 Yes /classes/SpecificPrice.php:576
1220
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.892 ms 1 /classes/Product.php:5659
3991
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 10069) AND (b.`id_shop` = 1) LIMIT 1
0.891 ms 1 /src/Adapter/EntityMapper.php:71
3878
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 7945) AND (b.`id_shop` = 1) LIMIT 1
0.891 ms 1 /src/Adapter/EntityMapper.php:71
4263
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (5133) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.891 ms 1 Yes Yes /classes/Product.php:4524
566
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2766 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2766 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.889 ms 0 /classes/Cart.php:1430
2739
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 8420 LIMIT 1
0.889 ms 10 /classes/SpecificPrice.php:435
3024
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 10069 AND id_shop=1 LIMIT 1
0.889 ms 1 /classes/Product.php:6876
4017
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 10299
0.889 ms 1 /classes/Product.php:2902
4341
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2648) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.889 ms 1 Yes Yes /classes/Product.php:4524
1897
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3807
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.889 ms 0 /classes/SpecificPrice.php:259
3462
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2628
ORDER BY `position`
0.888 ms 1 Yes /classes/Product.php:3545
1999
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4943 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.888 ms 10 Yes /classes/SpecificPrice.php:576
2877
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 9687)
0.887 ms 1 /classes/Product.php:3860
4519
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (12551) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.887 ms 1 Yes Yes /classes/Product.php:4524
4368
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2650) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.886 ms 1 Yes Yes /classes/Product.php:4524
1283
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2642 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2642 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.886 ms 0 /classes/Cart.php:1430
1511
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2654 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.886 ms 10 Yes /classes/SpecificPrice.php:576
1710
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3752)
0.886 ms 1 /classes/Product.php:3860
1778
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3763 AND id_shop=1 LIMIT 1
0.885 ms 1 /classes/Product.php:6876
59
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 20) AND (b.`id_shop` = 1) LIMIT 1
0.885 ms 1 /src/Adapter/EntityMapper.php:71
2501
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 6499 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 6499 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.884 ms 0 /classes/Cart.php:1430
4262
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (5134) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.884 ms 1 Yes Yes /classes/Product.php:4524
3281
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2893) AND (b.`id_shop` = 1) LIMIT 1
0.884 ms 1 /src/Adapter/EntityMapper.php:71
3517
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2647
0.884 ms 1 /classes/Product.php:2902
466
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2623 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2623 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.883 ms 0 /classes/Cart.php:1430
1467
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2490 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.883 ms 10 Yes /classes/SpecificPrice.php:576
2830
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 9535
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.883 ms 0 /classes/SpecificPrice.php:259
3378
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3178
ORDER BY `position`
0.883 ms 1 Yes /classes/Product.php:3545
1868
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3804 AND `id_group` = 1 LIMIT 1
0.882 ms 0 /classes/GroupReduction.php:156
3615
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3689
ORDER BY `position`
0.882 ms 1 Yes /classes/Product.php:3545
3297
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2623
ORDER BY `position`
0.882 ms 1 Yes /classes/Product.php:3545
2931
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 9691 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.880 ms 11 Yes /classes/SpecificPrice.php:576
2944
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 9692 AND id_shop=1 LIMIT 1
0.880 ms 1 /classes/Product.php:6876
3990
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 10068
0.878 ms 1 /classes/Product.php:2902
2045
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4965 AND id_shop=1 LIMIT 1
0.877 ms 1 /classes/Product.php:6876
79
SELECT SQL_NO_CACHE * FROM hgt78_range_price WHERE id_carrier = 282 LIMIT 1
0.877 ms 2 /modules/colissimo_simplicite/colissimo_simplicite.php:1415
473
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2767 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.877 ms 10 Yes /classes/SpecificPrice.php:576
3186
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 12551 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 12551 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.877 ms 0 /classes/Cart.php:1430
3377
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3178) AND (b.`id_shop` = 1) LIMIT 1
0.877 ms 1 /src/Adapter/EntityMapper.php:71
539
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2775 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.876 ms 10 Yes /classes/SpecificPrice.php:576
2047
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4965) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.876 ms 1 /classes/stock/StockAvailable.php:453
1708
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3752
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.874 ms 0 /classes/SpecificPrice.php:259
3099
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 10298
AND image_shop.`cover` = 1 LIMIT 1
0.874 ms 1 /classes/Product.php:3570
1909
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3808 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.874 ms 10 Yes /classes/SpecificPrice.php:576
2080
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 5283) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.873 ms 1 /classes/stock/StockAvailable.php:453
1162
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2627 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2627 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.872 ms 0 /classes/Cart.php:1430
3365
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2797) AND (b.`id_shop` = 1) LIMIT 1
0.872 ms 1 /src/Adapter/EntityMapper.php:71
2204
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 5973
ORDER BY f.position ASC
0.871 ms 5 Yes /classes/Product.php:6021
2473
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 6194
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.871 ms 0 /classes/SpecificPrice.php:259
1975
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4935
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.870 ms 0 /classes/SpecificPrice.php:259
1738
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3755
AND image_shop.`cover` = 1 LIMIT 1
0.870 ms 1 /classes/Product.php:3570
1795
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 174 LIMIT 1
0.870 ms 1 /classes/Product.php:5659
2580
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 7943 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 7943 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.870 ms 0 /classes/Cart.php:1430
4467
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (7945) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.868 ms 1 Yes Yes /classes/Product.php:4524
3584
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2654) AND (b.`id_shop` = 1) LIMIT 1
0.867 ms 1 /src/Adapter/EntityMapper.php:71
1796
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3765 LIMIT 1
0.866 ms 10 /classes/SpecificPrice.php:435
3354
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2777
ORDER BY `position`
0.866 ms 1 Yes /classes/Product.php:3545
2325
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 6179 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 6179 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.865 ms 0 /classes/Cart.php:1430
3698
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4574) AND (b.`id_shop` = 1) LIMIT 1
0.865 ms 1 /src/Adapter/EntityMapper.php:71
3366
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2797
ORDER BY `position`
0.863 ms 1 Yes /classes/Product.php:3545
2576
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 7943)
0.863 ms 1 /classes/Product.php:3860
4261
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (5135) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.863 ms 1 Yes Yes /classes/Product.php:4524
3236
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 5142) AND (b.`id_shop` = 1) LIMIT 1
0.862 ms 1 /src/Adapter/EntityMapper.php:71
2734
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 8419) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.862 ms 1 /classes/stock/StockAvailable.php:453
820
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2780 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2780 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.861 ms 0 /classes/Cart.php:1430
913
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2659
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.861 ms 0 /classes/SpecificPrice.php:259
2122
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 5093 AND id_shop=1 LIMIT 1
0.861 ms 1 /classes/Product.php:6876
3358
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2778
0.861 ms 1 /classes/Product.php:2902
3531
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2644
ORDER BY `position`
0.860 ms 1 Yes /classes/Product.php:3545
594
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2690 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.859 ms 10 Yes /classes/SpecificPrice.php:576
3689
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3807) AND (b.`id_shop` = 1) LIMIT 1
0.859 ms 1 /src/Adapter/EntityMapper.php:71
1307
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2644
AND image_shop.`cover` = 1 LIMIT 1
0.858 ms 1 /classes/Product.php:3570
2500
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 6499) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.858 ms 1 /classes/stock/StockAvailable.php:453
2916
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 9690
AND image_shop.`cover` = 1 LIMIT 1
0.858 ms 1 /classes/Product.php:3570
3830
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 6188) AND (b.`id_shop` = 1) LIMIT 1
0.858 ms 1 /src/Adapter/EntityMapper.php:71
245
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 5142 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 5142 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.857 ms 0 /classes/Cart.php:1430
1940
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4575 LIMIT 1
0.857 ms 10 /classes/SpecificPrice.php:435
2161
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 5970
AND image_shop.`cover` = 1 LIMIT 1
0.857 ms 1 /classes/Product.php:3570
1887
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3806 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.856 ms 10 Yes /classes/SpecificPrice.php:576
2828
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 174 LIMIT 1
0.856 ms 1 /classes/Product.php:5659
243
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 5142 AND `id_group` = 1 LIMIT 1
0.855 ms 0 /classes/GroupReduction.php:156
4259
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (5137) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.855 ms 1 Yes Yes /classes/Product.php:4524
3120
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 10299
ORDER BY f.position ASC
0.855 ms 5 Yes /classes/Product.php:6021
3854
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 6500) AND (b.`id_shop` = 1) LIMIT 1
0.855 ms 1 /src/Adapter/EntityMapper.php:71
2031
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4964
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.854 ms 0 /classes/SpecificPrice.php:259
2129
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 198 LIMIT 1
0.854 ms 1 /classes/Product.php:5659
4186
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 60) LIMIT 1
0.854 ms 1 /src/Adapter/EntityMapper.php:71
661
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2764 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.853 ms 10 Yes /classes/SpecificPrice.php:576
1997
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4943 LIMIT 1
0.853 ms 10 /classes/SpecificPrice.php:435
733
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2798
ORDER BY f.position ASC
0.853 ms 5 Yes /classes/Product.php:6021
1267
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2646 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.852 ms 10 Yes /classes/SpecificPrice.php:576
2862
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 9598 LIMIT 1
0.852 ms 10 /classes/SpecificPrice.php:435
1931
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4574 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.851 ms 10 Yes /classes/SpecificPrice.php:576
191
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 5147
ORDER BY f.position ASC
0.850 ms 5 Yes /classes/Product.php:6021
1256
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2647 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.850 ms 10 Yes /classes/SpecificPrice.php:576
1716
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3753
AND image_shop.`cover` = 1 LIMIT 1
0.849 ms 1 /classes/Product.php:3570
2788
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 9321)
0.849 ms 1 /classes/Product.php:3860
2970
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 9694
ORDER BY f.position ASC
0.849 ms 5 Yes /classes/Product.php:6021
4347
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2646) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.849 ms 1 Yes Yes /classes/Product.php:4524
4517
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (10305) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.849 ms 1 Yes Yes /classes/Product.php:4524
1281
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2642 AND `id_group` = 1 LIMIT 1
0.848 ms 0 /classes/GroupReduction.php:156
3292
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2652
0.848 ms 1 /classes/Product.php:2902
1848
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3776
ORDER BY f.position ASC
0.848 ms 5 Yes /classes/Product.php:6021
495
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2769 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.847 ms 10 Yes /classes/SpecificPrice.php:576
3527
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2655) AND (b.`id_shop` = 1) LIMIT 1
0.847 ms 1 /src/Adapter/EntityMapper.php:71
3881
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 7946) AND (b.`id_shop` = 1) LIMIT 1
0.847 ms 1 /src/Adapter/EntityMapper.php:71
616
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2692 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.846 ms 10 Yes /classes/SpecificPrice.php:576
3089
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.846 ms 1 /classes/Product.php:5659
1071
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3477 AND id_shop=1 LIMIT 1
0.845 ms 1 /classes/Product.php:6876
3030
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 184 LIMIT 1
0.845 ms 1 /classes/Product.php:5659
3495
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2641
ORDER BY `position`
0.845 ms 1 Yes /classes/Product.php:3545
1901
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3807 AND `id_group` = 1 LIMIT 1
0.844 ms 0 /classes/GroupReduction.php:156
3299
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2767) AND (b.`id_shop` = 1) LIMIT 1
0.844 ms 1 /src/Adapter/EntityMapper.php:71
3848
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 6195) AND (b.`id_shop` = 1) LIMIT 1
0.843 ms 1 /src/Adapter/EntityMapper.php:71
4245
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (7540) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.843 ms 1 Yes Yes /classes/Product.php:4524
2198
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 5973 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.842 ms 10 Yes /classes/SpecificPrice.php:576
3549
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3326
ORDER BY `position`
0.842 ms 2 Yes /classes/Product.php:3545
3821
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 6185) AND (b.`id_shop` = 1) LIMIT 1
0.842 ms 1 /src/Adapter/EntityMapper.php:71
1697
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3751
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.841 ms 0 /classes/SpecificPrice.php:259
2016
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4944
ORDER BY f.position ASC
0.841 ms 5 Yes /classes/Product.php:6021
2629
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 7773 LIMIT 1
0.841 ms 10 /classes/SpecificPrice.php:435
1700
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3751 AND id_shop=1 LIMIT 1
0.840 ms 1 /classes/Product.php:6876
3973
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 9693) AND (b.`id_shop` = 1) LIMIT 1
0.840 ms 1 /src/Adapter/EntityMapper.php:71
1406
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2818 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2818 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.839 ms 0 /classes/Cart.php:1430
2230
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 6108 LIMIT 1
0.839 ms 10 /classes/SpecificPrice.php:435
677
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2777 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2777 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.838 ms 0 /classes/Cart.php:1430
2495
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 6499
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.836 ms 0 /classes/SpecificPrice.php:259
118
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 7542 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.835 ms 10 Yes /classes/SpecificPrice.php:576
1085
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2620 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2620 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.835 ms 0 /classes/Cart.php:1430
1516
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2654 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2654 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.835 ms 0 /classes/Cart.php:1430
2203
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 5973 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 5973 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.835 ms 0 /classes/Cart.php:1430
930
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2635 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2635 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.834 ms 0 /classes/Cart.php:1430
2690
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 8397) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.834 ms 1 /classes/stock/StockAvailable.php:453
3654
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3757
ORDER BY `position`
0.834 ms 1 Yes /classes/Product.php:3545
1876
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3805 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.833 ms 10 Yes /classes/SpecificPrice.php:576
3839
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 6192) AND (b.`id_shop` = 1) LIMIT 1
0.833 ms 1 /src/Adapter/EntityMapper.php:71
3840
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 6192
ORDER BY `position`
0.833 ms 1 Yes /classes/Product.php:3545
218
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 5144 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.833 ms 10 Yes /classes/SpecificPrice.php:576
3031
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 10070) AND (b.`id_shop` = 1) LIMIT 1
0.833 ms 1 /src/Adapter/EntityMapper.php:71
650
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2738 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.832 ms 11 Yes /classes/SpecificPrice.php:576
3893
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 8393) AND (b.`id_shop` = 1) LIMIT 1
0.832 ms 1 /src/Adapter/EntityMapper.php:71
816
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2780)
0.831 ms 1 /classes/Product.php:3860
842
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3179 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3179 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.831 ms 0 /classes/Cart.php:1430
583
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2661 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.830 ms 10 Yes /classes/SpecificPrice.php:576
627
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2693 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.830 ms 10 Yes /classes/SpecificPrice.php:576
722
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2797
ORDER BY f.position ASC
0.830 ms 5 Yes /classes/Product.php:6021
108
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_group`
WHERE `id_group` = 1 LIMIT 1
0.829 ms 1 /classes/Group.php:154
2492
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 6499
AND image_shop.`cover` = 1 LIMIT 1
0.829 ms 2 /classes/Product.php:3570
3887
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 7773) AND (b.`id_shop` = 1) LIMIT 1
0.829 ms 1 /src/Adapter/EntityMapper.php:71
4308
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3179) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.829 ms 1 Yes Yes /classes/Product.php:4524
2346
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 6181) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.828 ms 1 /classes/stock/StockAvailable.php:453
1678
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3749 AND id_shop=1 LIMIT 1
0.827 ms 1 /classes/Product.php:6876
605
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2691 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.826 ms 10 Yes /classes/SpecificPrice.php:576
1926
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4256
ORDER BY f.position ASC
0.826 ms 5 Yes /classes/Product.php:6021
1095
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3459) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.825 ms 1 /classes/stock/StockAvailable.php:453
312
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 5136
ORDER BY f.position ASC
0.824 ms 5 Yes /classes/Product.php:6021
2715
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 8418
AND image_shop.`cover` = 1 LIMIT 1
0.824 ms 1 /classes/Product.php:3570
1942
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4575 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.822 ms 10 Yes /classes/SpecificPrice.php:576
3710
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4935) AND (b.`id_shop` = 1) LIMIT 1
0.822 ms 1 /src/Adapter/EntityMapper.php:71
4205
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 33 AND `id_shop` = 1
0.820 ms 6 /src/Adapter/EntityMapper.php:79
1957
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4932 AND `id_group` = 1 LIMIT 1
0.818 ms 0 /classes/GroupReduction.php:156
3560
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3099) AND (b.`id_shop` = 1) LIMIT 1
0.818 ms 1 /src/Adapter/EntityMapper.php:71
2780
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 9055 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 9055 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.817 ms 0 /classes/Cart.php:1430
2612
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 7946) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.816 ms 1 /classes/stock/StockAvailable.php:453
3272
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3741) AND (b.`id_shop` = 1) LIMIT 1
0.816 ms 1 /src/Adapter/EntityMapper.php:71
1108
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2622
ORDER BY f.position ASC
0.815 ms 5 Yes /classes/Product.php:6021
2011
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4944)
0.815 ms 1 /classes/Product.php:3860
2283
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 6176
AND image_shop.`cover` = 1 LIMIT 1
0.815 ms 1 /classes/Product.php:3570
4478
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (8418) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.815 ms 1 Yes Yes /classes/Product.php:4524
2506
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 6500
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.814 ms 0 /classes/SpecificPrice.php:259
3566
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3132) AND (b.`id_shop` = 1) LIMIT 1
0.814 ms 1 /src/Adapter/EntityMapper.php:71
1195
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2656 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2656 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.813 ms 0 /classes/Cart.php:1430
1990
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4942 AND id_shop=1 LIMIT 1
0.813 ms 1 /classes/Product.php:6876
3617
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3745) AND (b.`id_shop` = 1) LIMIT 1
0.813 ms 1 /src/Adapter/EntityMapper.php:71
3761
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 5970) AND (b.`id_shop` = 1) LIMIT 1
0.812 ms 1 /src/Adapter/EntityMapper.php:71
94
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 7543 LIMIT 1
0.811 ms 9 /classes/SpecificPrice.php:435
3818
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 6184) AND (b.`id_shop` = 1) LIMIT 1
0.810 ms 1 /src/Adapter/EntityMapper.php:71
1959
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4932 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4932 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.810 ms 0 /classes/Cart.php:1430
3329
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2661) AND (b.`id_shop` = 1) LIMIT 1
0.810 ms 1 /src/Adapter/EntityMapper.php:71
1077
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.809 ms 1 /classes/Product.php:5659
2591
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 7944 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 7944 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.809 ms 0 /classes/Cart.php:1430
4314
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3177) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.809 ms 1 Yes Yes /classes/Product.php:4524
3191
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 11001 LIMIT 1
0.807 ms 10 /classes/SpecificPrice.php:435
3273
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3741
ORDER BY `position`
0.807 ms 1 Yes /classes/Product.php:3545
3845
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 6194) AND (b.`id_shop` = 1) LIMIT 1
0.807 ms 1 /src/Adapter/EntityMapper.php:71
3998
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 10071
ORDER BY `position`
0.807 ms 1 Yes /classes/Product.php:3545
4236
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 83) LIMIT 1
0.807 ms 1 /src/Adapter/EntityMapper.php:71
1615
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3639 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3639 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.806 ms 0 /classes/Cart.php:1430
2062
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 95 LIMIT 1
0.806 ms 1 /classes/Product.php:5659
3003
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 10067 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 10067 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.806 ms 0 /classes/Cart.php:1430
3719
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4944) AND (b.`id_shop` = 1) LIMIT 1
0.806 ms 1 /src/Adapter/EntityMapper.php:71
3568
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3132
0.805 ms 1 /classes/Product.php:2902
2275
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 6174
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.805 ms 0 /classes/SpecificPrice.php:259
3254
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 5136) AND (b.`id_shop` = 1) LIMIT 1
0.805 ms 1 /src/Adapter/EntityMapper.php:71
3492
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2640
ORDER BY `position`
0.805 ms 1 Yes /classes/Product.php:3545
1006
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2637 AND `id_group` = 1 LIMIT 1
0.804 ms 0 /classes/GroupReduction.php:156
1218
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2657
ORDER BY f.position ASC
0.804 ms 5 Yes /classes/Product.php:6021
2630
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 7773
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.804 ms 0 /classes/SpecificPrice.php:259
2759
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 8976
AND image_shop.`cover` = 1 LIMIT 1
0.804 ms 1 /classes/Product.php:3570
3588
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3454
ORDER BY `position`
0.804 ms 1 Yes /classes/Product.php:3545
1264
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.803 ms 1 /classes/Product.php:5659
1361
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3264 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3264 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.803 ms 0 /classes/Cart.php:1430
3939
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 9325
ORDER BY `position`
0.803 ms 1 Yes /classes/Product.php:3545
2847
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 9596 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 9596 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.802 ms 0 /classes/Cart.php:1430
1430
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3107
AND image_shop.`cover` = 1 LIMIT 1
0.801 ms 1 /classes/Product.php:3570
1847
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3776 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3776 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.801 ms 0 /classes/Cart.php:1430
3452
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2639) AND (b.`id_shop` = 1) LIMIT 1
0.801 ms 1 /src/Adapter/EntityMapper.php:71
2906
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 334 LIMIT 1
0.800 ms 1 /classes/Product.php:5659
3508
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3456
0.800 ms 1 /classes/Product.php:2902
1350
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3254 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3254 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.799 ms 0 /classes/Cart.php:1430
2669
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 8395 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 8395 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.799 ms 0 /classes/Cart.php:1430
2925
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 9690 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 9690 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.799 ms 0 /classes/Cart.php:1430
3906
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 8401
ORDER BY `position`
0.799 ms 1 Yes /classes/Product.php:3545
1082
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2620 AND id_shop=1 LIMIT 1
0.798 ms 1 /classes/Product.php:6876
2936
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 9691 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 9691 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.798 ms 0 /classes/Cart.php:1430
3728
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4965) AND (b.`id_shop` = 1) LIMIT 1
0.798 ms 1 /src/Adapter/EntityMapper.php:71
162
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 6727 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.797 ms 10 Yes /classes/SpecificPrice.php:576
3656
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3763) AND (b.`id_shop` = 1) LIMIT 1
0.797 ms 1 /src/Adapter/EntityMapper.php:71
3863
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 7940) AND (b.`id_shop` = 1) LIMIT 1
0.797 ms 1 /src/Adapter/EntityMapper.php:71
2467
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 6193) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.796 ms 1 /classes/stock/StockAvailable.php:453
2423
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 6188) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.795 ms 1 /classes/stock/StockAvailable.php:453
55
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 12) AND (b.`id_shop` = 1) LIMIT 1
0.794 ms 1 /src/Adapter/EntityMapper.php:71
311
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 5136 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 5136 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.794 ms 0 /classes/Cart.php:1430
1863
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3804 LIMIT 1
0.794 ms 10 /classes/SpecificPrice.php:435
4037
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 11001
ORDER BY `position`
0.794 ms 3 Yes /classes/Product.php:3545
145
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 7540 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 7540 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.793 ms 0 /classes/Cart.php:1430
250
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 5141
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.793 ms 0 /classes/SpecificPrice.php:259
2004
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4943 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4943 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.793 ms 0 /classes/Cart.php:1430
4463
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (7941) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.793 ms 1 Yes Yes /classes/Product.php:4524
710
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2795 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2795 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.792 ms 0 /classes/Cart.php:1430
3293
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2651) AND (b.`id_shop` = 1) LIMIT 1
0.791 ms 1 /src/Adapter/EntityMapper.php:71
3482
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2625) AND (b.`id_shop` = 1) LIMIT 1
0.791 ms 1 /src/Adapter/EntityMapper.php:71
2614
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 7946
ORDER BY f.position ASC
0.791 ms 5 Yes /classes/Product.php:6021
3039
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 10070 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 10070 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.791 ms 0 /classes/Cart.php:1430
3238
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 5142
0.791 ms 1 /classes/Product.php:2902
2243
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 6129 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.790 ms 10 Yes /classes/SpecificPrice.php:576
3267
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4902
ORDER BY `position`
0.790 ms 1 Yes /classes/Product.php:3545
2781
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 9055
ORDER BY f.position ASC
0.790 ms 5 Yes /classes/Product.php:6021
2814
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 9324 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 9324 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.790 ms 0 /classes/Cart.php:1430
2232
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 6108 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.789 ms 10 Yes /classes/SpecificPrice.php:576
2637
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 7773
ORDER BY f.position ASC
0.789 ms 5 Yes /classes/Product.php:6021
1206
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2648 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2648 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.788 ms 0 /classes/Cart.php:1430
1794
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3765
AND image_shop.`cover` = 1 LIMIT 1
0.788 ms 1 /classes/Product.php:3570
2512
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 6500 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 6500 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.788 ms 0 /classes/Cart.php:1430
3326
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2765) AND (b.`id_shop` = 1) LIMIT 1
0.787 ms 1 /src/Adapter/EntityMapper.php:71
1116
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3458 AND `id_group` = 1 LIMIT 1
0.786 ms 0 /classes/GroupReduction.php:156
3476
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3458) AND (b.`id_shop` = 1) LIMIT 1
0.786 ms 1 /src/Adapter/EntityMapper.php:71
3627
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3748
ORDER BY `position`
0.786 ms 1 Yes /classes/Product.php:3545
3094
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 10297 AND id_shop=1 LIMIT 1
0.785 ms 1 /classes/Product.php:6876
3138
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 10303 AND id_shop=1 LIMIT 1
0.785 ms 1 /classes/Product.php:6876
306
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 5136 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.785 ms 10 Yes /classes/SpecificPrice.php:576
2838
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 9596
AND image_shop.`cover` = 1 LIMIT 1
0.785 ms 1 /classes/Product.php:3570
1604
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3586 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3586 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.784 ms 0 /classes/Cart.php:1430
1051
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2629) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.783 ms 1 /classes/stock/StockAvailable.php:453
3851
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 6499) AND (b.`id_shop` = 1) LIMIT 1
0.783 ms 1 /src/Adapter/EntityMapper.php:71
3529
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2655
0.782 ms 1 /classes/Product.php:2902
3897
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 8395
ORDER BY `position`
0.782 ms 1 Yes /classes/Product.php:3545
4493
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (9686) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.782 ms 1 Yes Yes /classes/Product.php:4524
433
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2660 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2660 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.781 ms 0 /classes/Cart.php:1430
2435
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 6189 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 6189 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.781 ms 0 /classes/Cart.php:1430
942
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2631
ORDER BY f.position ASC
0.781 ms 5 Yes /classes/Product.php:6021
3218
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 5148) AND (b.`id_shop` = 1) LIMIT 1
0.781 ms 1 /src/Adapter/EntityMapper.php:71
3651
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3756
ORDER BY `position`
0.781 ms 1 Yes /classes/Product.php:3545
3695
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4256) AND (b.`id_shop` = 1) LIMIT 1
0.780 ms 1 /src/Adapter/EntityMapper.php:71
4280
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2774) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.780 ms 1 Yes Yes /classes/Product.php:4524
46
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 38) AND (b.`id_shop` = 1) LIMIT 1
0.780 ms 1 /src/Adapter/EntityMapper.php:71
897
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2792 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2792 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.779 ms 0 /classes/Cart.php:1430
954
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2633
AND image_shop.`cover` = 1 LIMIT 1
0.779 ms 1 /classes/Product.php:3570
1378
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3326 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.778 ms 10 Yes /classes/SpecificPrice.php:576
3546
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3265
ORDER BY `position`
0.778 ms 1 Yes /classes/Product.php:3545
2494
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 6499 LIMIT 1
0.777 ms 10 /classes/SpecificPrice.php:435
1494
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2733 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2733 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.776 ms 0 /classes/Cart.php:1430
1650
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3747
AND image_shop.`cover` = 1 LIMIT 1
0.776 ms 1 /classes/Product.php:3570
3187
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 12551
ORDER BY f.position ASC
0.776 ms 5 Yes /classes/Product.php:6021
4208
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 66) LIMIT 1
0.776 ms 1 /src/Adapter/EntityMapper.php:71
412
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2694
AND image_shop.`cover` = 1 LIMIT 1
0.775 ms 1 /classes/Product.php:3570
3308
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2770) AND (b.`id_shop` = 1) LIMIT 1
0.775 ms 1 /src/Adapter/EntityMapper.php:71
2677
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 8396 AND id_shop=1 LIMIT 1
0.774 ms 1 /classes/Product.php:6876
1921
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4256)
0.773 ms 1 /classes/Product.php:3860
3860
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 7938) AND (b.`id_shop` = 1) LIMIT 1
0.773 ms 1 /src/Adapter/EntityMapper.php:71
2014
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4944) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.772 ms 1 /classes/stock/StockAvailable.php:453
2329
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 6180 LIMIT 1
0.772 ms 10 /classes/SpecificPrice.php:435
3278
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3587) AND (b.`id_shop` = 1) LIMIT 1
0.772 ms 1 /src/Adapter/EntityMapper.php:71
3591
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3455
ORDER BY `position`
0.772 ms 1 Yes /classes/Product.php:3545
3666
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3766
ORDER BY `position`
0.772 ms 1 Yes /classes/Product.php:3545
4334
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2624) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.772 ms 1 Yes Yes /classes/Product.php:4524
1657
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3747 AND `id_group` = 1 LIMIT 1
0.771 ms 0 /classes/GroupReduction.php:156
1758
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3756 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3756 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.771 ms 0 /classes/Cart.php:1430
2281
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 6174 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 6174 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.771 ms 0 /classes/Cart.php:1430
2413
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 6187 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 6187 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.771 ms 0 /classes/Cart.php:1430
3096
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 10297) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.771 ms 1 /classes/stock/StockAvailable.php:453
3948
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 9597
ORDER BY `position`
0.771 ms 1 Yes /classes/Product.php:3545
678
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2777
ORDER BY f.position ASC
0.771 ms 5 Yes /classes/Product.php:6021
2293
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 6176
ORDER BY f.position ASC
0.771 ms 5 Yes /classes/Product.php:6021
2305
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 6178
AND image_shop.`cover` = 1 LIMIT 1
0.771 ms 1 /classes/Product.php:3570
2380
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 6184 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 6184 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.770 ms 0 /classes/Cart.php:1430
279
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 5139
ORDER BY f.position ASC
0.769 ms 5 Yes /classes/Product.php:6021
882
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2791)
0.769 ms 1 /classes/Product.php:3860
3967
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 9691) AND (b.`id_shop` = 1) LIMIT 1
0.769 ms 1 /src/Adapter/EntityMapper.php:71
2015
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4944 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4944 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.769 ms 0 /classes/Cart.php:1430
1316
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2644 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2644 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.767 ms 0 /classes/Cart.php:1430
2958
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 9693 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 9693 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.767 ms 0 /classes/Cart.php:1430
3746
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 5296) AND (b.`id_shop` = 1) LIMIT 1
0.767 ms 1 /src/Adapter/EntityMapper.php:71
242
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 5142 AND id_shop=1 LIMIT 1
0.766 ms 1 /classes/Product.php:6876
1963
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4934 LIMIT 1
0.766 ms 10 /classes/SpecificPrice.php:435
4321
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2782) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.766 ms 1 Yes Yes /classes/Product.php:4524
3028
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 10069
ORDER BY f.position ASC
0.765 ms 5 Yes /classes/Product.php:6021
3638
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3752) AND (b.`id_shop` = 1) LIMIT 1
0.764 ms 1 /src/Adapter/EntityMapper.php:71
1571
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3558 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3558 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.764 ms 0 /classes/Cart.php:1430
1792
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3764 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3764 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.764 ms 0 /classes/Cart.php:1430
3575
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2621) AND (b.`id_shop` = 1) LIMIT 1
0.763 ms 1 /src/Adapter/EntityMapper.php:71
1870
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3804 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3804 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.763 ms 0 /classes/Cart.php:1430
3113
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 10299
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.763 ms 1 /classes/SpecificPrice.php:259
3707
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4934) AND (b.`id_shop` = 1) LIMIT 1
0.763 ms 1 /src/Adapter/EntityMapper.php:71
4019
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 10302
ORDER BY `position`
0.763 ms 1 Yes /classes/Product.php:3545
113
SELECT SQL_NO_CACHE tr.*
FROM `hgt78_tax_rule` tr
JOIN `hgt78_tax_rules_group` trg ON (tr.`id_tax_rules_group` = trg.`id_tax_rules_group`)
WHERE trg.`active` = 1
AND tr.`id_country` = 8
AND tr.`id_tax_rules_group` = 28
AND tr.`id_state` IN (0, 0)
AND ('0' BETWEEN tr.`zipcode_from` AND tr.`zipcode_to`
OR (tr.`zipcode_to` = 0 AND tr.`zipcode_from` IN(0, '0')))
ORDER BY tr.`zipcode_from` DESC, tr.`zipcode_to` DESC, tr.`id_state` DESC, tr.`id_country` DESC
0.762 ms 1 /classes/tax/TaxRulesTaxManager.php:109
2424
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 6188 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 6188 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.762 ms 0 /classes/Cart.php:1430
3920
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 8975) AND (b.`id_shop` = 1) LIMIT 1
0.762 ms 1 /src/Adapter/EntityMapper.php:71
4352
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2645) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.762 ms 1 Yes Yes /classes/Product.php:4524
2601
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 7945) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.761 ms 1 /classes/stock/StockAvailable.php:453
2170
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 5970 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 5970 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.760 ms 0 /classes/Cart.php:1430
2825
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 9325 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 9325 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.760 ms 0 /classes/Cart.php:1430
3332
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2690) AND (b.`id_shop` = 1) LIMIT 1
0.759 ms 1 /src/Adapter/EntityMapper.php:71
1505
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2650 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2650 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.759 ms 0 /classes/Cart.php:1430
533
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2774 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2774 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.758 ms 0 /classes/Cart.php:1430
2393
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 6186
AND image_shop.`cover` = 1 LIMIT 1
0.758 ms 1 /classes/Product.php:3570
2868
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 9598) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.758 ms 1 /classes/stock/StockAvailable.php:453
3152
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 10304 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 10304 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.758 ms 0 /classes/Cart.php:1430
2248
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 6129 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 6129 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.757 ms 0 /classes/Cart.php:1430
1593
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3585 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3585 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.757 ms 0 /classes/Cart.php:1430
4028
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 10305
ORDER BY `position`
0.757 ms 1 Yes /classes/Product.php:3545
4459
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (6500) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.757 ms 1 Yes Yes /classes/Product.php:4524
2465
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 6193 AND id_shop=1 LIMIT 1
0.755 ms 1 /classes/Product.php:6876
3320
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2776) AND (b.`id_shop` = 1) LIMIT 1
0.755 ms 1 /src/Adapter/EntityMapper.php:71
2678
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 8396 AND `id_group` = 1 LIMIT 1
0.754 ms 0 /classes/GroupReduction.php:156
4226
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 77) LIMIT 1
0.754 ms 1 /src/Adapter/EntityMapper.php:71
859
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2789 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.754 ms 10 Yes /classes/SpecificPrice.php:576
4026
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 10304
0.754 ms 1 /classes/Product.php:2902
2659
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 8393
ORDER BY f.position ASC
0.753 ms 5 Yes /classes/Product.php:6021
3140
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 10303) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.752 ms 1 /classes/stock/StockAvailable.php:453
137
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 185 LIMIT 1
0.752 ms 1 /classes/Product.php:5659
765
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3178 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3178 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.752 ms 0 /classes/Cart.php:1430
1747
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3755 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3755 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.752 ms 0 /classes/Cart.php:1430
174
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 5148 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.751 ms 10 Yes /classes/SpecificPrice.php:576
2720
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 8418)
0.751 ms 1 /classes/Product.php:3860
377
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3741 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3741 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.750 ms 0 /classes/Cart.php:1430
4449
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (6186) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.750 ms 1 Yes Yes /classes/Product.php:4524
1880
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3805) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.750 ms 1 /classes/stock/StockAvailable.php:453
2117
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 177 LIMIT 1
0.749 ms 1 /classes/Product.php:5659
4266
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3741) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.749 ms 1 Yes Yes /classes/Product.php:4524
3791
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 6174) AND (b.`id_shop` = 1) LIMIT 1
0.749 ms 1 /src/Adapter/EntityMapper.php:71
4016
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 10299
ORDER BY `position`
0.749 ms 1 Yes /classes/Product.php:3545
1296
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2655
AND image_shop.`cover` = 1 LIMIT 1
0.748 ms 1 /classes/Product.php:3570
1983
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4942
AND image_shop.`cover` = 1 LIMIT 1
0.748 ms 1 /classes/Product.php:3570
2822
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 9325 AND id_shop=1 LIMIT 1
0.748 ms 1 /classes/Product.php:6876
116
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 7542 LIMIT 1
0.747 ms 10 /classes/SpecificPrice.php:435
146
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 7540
ORDER BY f.position ASC
0.747 ms 5 Yes /classes/Product.php:6021
80
SELECT SQL_NO_CACHE * FROM hgt78_delivery WHERE id_carrier = 282 LIMIT 1
0.746 ms 8 /modules/colissimo_simplicite/colissimo_simplicite.php:1420
1826
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3771
ORDER BY f.position ASC
0.746 ms 5 Yes /classes/Product.php:6021
1334
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3252 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.745 ms 10 Yes /classes/SpecificPrice.php:576
4046
SELECT SQL_NO_CACHE 1 FROM `hgt78_cart_rule` WHERE ((date_to >= "2025-05-01 00:00:00" AND date_to <= "2025-05-01 23:59:59") OR (date_from >= "2025-05-01 00:00:00" AND date_from <= "2025-05-01 23:59:59") OR (date_from < "2025-05-01 00:00:00" AND date_to > "2025-05-01 23:59:59")) AND `id_customer` IN (0,0) LIMIT 1
0.745 ms 29 /classes/CartRule.php:357
3704
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4932) AND (b.`id_shop` = 1) LIMIT 1
0.745 ms 1 /src/Adapter/EntityMapper.php:71
1287
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2643 LIMIT 1
0.744 ms 10 /classes/SpecificPrice.php:435
1659
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3747 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3747 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.744 ms 0 /classes/Cart.php:1430
3416
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2792) AND (b.`id_shop` = 1) LIMIT 1
0.744 ms 1 /src/Adapter/EntityMapper.php:71
3437
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2634) AND (b.`id_shop` = 1) LIMIT 1
0.744 ms 1 /src/Adapter/EntityMapper.php:71
1782
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3763
ORDER BY f.position ASC
0.742 ms 5 Yes /classes/Product.php:6021
2137
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 5589 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 5589 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.742 ms 0 /classes/Cart.php:1430
2766
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 8976 AND `id_group` = 1 LIMIT 1
0.742 ms 0 /classes/GroupReduction.php:156
289
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 5138 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 5138 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.741 ms 0 /classes/Cart.php:1430
511
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2770 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2770 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.741 ms 0 /classes/Cart.php:1430
755
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2800
ORDER BY f.position ASC
0.741 ms 5 Yes /classes/Product.php:6021
1301
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2655)
0.741 ms 1 /classes/Product.php:3860
1814
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3766 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3766 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.741 ms 0 /classes/Cart.php:1430
3971
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 9692
ORDER BY `position`
0.741 ms 1 Yes /classes/Product.php:3545
3992
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 10069
ORDER BY `position`
0.741 ms 1 Yes /classes/Product.php:3545
75
SELECT SQL_NO_CACHE *
FROM `hgt78_carrier` a
LEFT JOIN `hgt78_carrier_shop` `c` ON a.`id_carrier` = c.`id_carrier` AND c.`id_shop` = 1
WHERE (a.`id_carrier` = 282) LIMIT 1
0.740 ms 1 /src/Adapter/EntityMapper.php:71
1846
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3776) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.740 ms 1 /classes/stock/StockAvailable.php:453
3642
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3753
ORDER BY `position`
0.740 ms 1 Yes /classes/Product.php:3545
3788
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 6173) AND (b.`id_shop` = 1) LIMIT 1
0.740 ms 1 /src/Adapter/EntityMapper.php:71
4268
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3587) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.740 ms 1 Yes Yes /classes/Product.php:4524
1426
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3099 AND `id_group` = 1 LIMIT 1
0.739 ms 0 /classes/GroupReduction.php:156
3680
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3804) AND (b.`id_shop` = 1) LIMIT 1
0.739 ms 1 /src/Adapter/EntityMapper.php:71
3785
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 6172) AND (b.`id_shop` = 1) LIMIT 1
0.739 ms 1 /src/Adapter/EntityMapper.php:71
2020
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4963
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.739 ms 0 /classes/SpecificPrice.php:259
821
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2780
ORDER BY f.position ASC
0.738 ms 5 Yes /classes/Product.php:6021
3383
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3075) AND (b.`id_shop` = 1) LIMIT 1
0.737 ms 1 /src/Adapter/EntityMapper.php:71
3815
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 6183) AND (b.`id_shop` = 1) LIMIT 1
0.737 ms 1 /src/Adapter/EntityMapper.php:71
777
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3075
ORDER BY f.position ASC
0.736 ms 5 Yes /classes/Product.php:6021
3632
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3750) AND (b.`id_shop` = 1) LIMIT 1
0.736 ms 1 /src/Adapter/EntityMapper.php:71
3896
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 8395) AND (b.`id_shop` = 1) LIMIT 1
0.736 ms 1 /src/Adapter/EntityMapper.php:71
3936
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 9324
ORDER BY `position`
0.736 ms 1 Yes /classes/Product.php:3545
1825
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3771 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3771 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.735 ms 0 /classes/Cart.php:1430
1858
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3777 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3777 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.735 ms 0 /classes/Cart.php:1430
2621
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 7769)
0.735 ms 1 /classes/Product.php:3860
2638
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 8392
AND image_shop.`cover` = 1 LIMIT 1
0.735 ms 1 /classes/Product.php:3570
3135
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 10303
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.735 ms 1 /classes/SpecificPrice.php:259
3716
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4943) AND (b.`id_shop` = 1) LIMIT 1
0.735 ms 1 /src/Adapter/EntityMapper.php:71
478
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2767 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2767 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.735 ms 0 /classes/Cart.php:1430
3853
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 6499
0.735 ms 1 /classes/Product.php:2902
1263
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2646
AND image_shop.`cover` = 1 LIMIT 1
0.734 ms 1 /classes/Product.php:3570
38
SELECT SQL_NO_CACHE `id_category`
FROM `hgt78_category_shop`
WHERE `id_category` = 2
AND `id_shop` = 1 LIMIT 1
0.734 ms 1 /classes/Category.php:2450
577
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2765 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2765 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.734 ms 0 /classes/Cart.php:1430
1762
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3757 LIMIT 1
0.734 ms 10 /classes/SpecificPrice.php:435
2769
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 8976
ORDER BY f.position ASC
0.734 ms 5 Yes /classes/Product.php:6021
423
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2660
AND image_shop.`cover` = 1 LIMIT 1
0.733 ms 1 /classes/Product.php:3570
926
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2635)
0.733 ms 1 /classes/Product.php:3860
1483
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2621 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2621 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.733 ms 0 /classes/Cart.php:1430
1805
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3766
AND image_shop.`cover` = 1 LIMIT 1
0.733 ms 1 /classes/Product.php:3570
3743
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 5293) AND (b.`id_shop` = 1) LIMIT 1
0.733 ms 1 /src/Adapter/EntityMapper.php:71
3521
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2642) AND (b.`id_shop` = 1) LIMIT 1
0.732 ms 1 /src/Adapter/EntityMapper.php:71
28
SELECT SQL_NO_CACHE `id_lang` FROM `hgt78_lang`
WHERE `locale` = 'fr-fr'
OR `language_code` = 'fr-fr' LIMIT 1
0.732 ms 6 /classes/Language.php:883
221
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 5144 AND `id_group` = 1 LIMIT 1
0.732 ms 0 /classes/GroupReduction.php:156
410
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2893 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2893 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.732 ms 0 /classes/Cart.php:1430
1295
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2643
ORDER BY f.position ASC
0.732 ms 5 Yes /classes/Product.php:6021
1549
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3484 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3484 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.732 ms 0 /classes/Cart.php:1430
3133
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 184 LIMIT 1
0.732 ms 1 /classes/Product.php:5659
3884
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 7769) AND (b.`id_shop` = 1) LIMIT 1
0.732 ms 1 /src/Adapter/EntityMapper.php:71
3586
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2654
0.731 ms 1 /classes/Product.php:2902
1925
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4256 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4256 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.730 ms 0 /classes/Cart.php:1430
929
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2635) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.730 ms 1 /classes/stock/StockAvailable.php:453
1249
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2658) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.729 ms 1 /classes/stock/StockAvailable.php:453
2354
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 6182)
0.729 ms 1 /classes/Product.php:3860
4490
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (9597) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.729 ms 1 Yes Yes /classes/Product.php:4524
4244
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (7541) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.728 ms 1 Yes Yes /classes/Product.php:4524
4272
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2652) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.728 ms 1 Yes Yes /classes/Product.php:4524
901
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3177 LIMIT 1
0.728 ms 10 /classes/SpecificPrice.php:435
1743
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3755)
0.728 ms 1 /classes/Product.php:3860
2000
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4943)
0.727 ms 1 /classes/Product.php:3860
2483
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 6195 LIMIT 1
0.727 ms 10 /classes/SpecificPrice.php:435
2594
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 320 LIMIT 1
0.727 ms 1 /classes/Product.php:5659
2890
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 9686 AND `id_group` = 1 LIMIT 1
0.727 ms 0 /classes/GroupReduction.php:156
168
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 6727
ORDER BY f.position ASC
0.726 ms 5 Yes /classes/Product.php:6021
3701
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4575) AND (b.`id_shop` = 1) LIMIT 1
0.726 ms 1 /src/Adapter/EntityMapper.php:71
3956
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 9686
ORDER BY `position`
0.726 ms 1 Yes /classes/Product.php:3545
388
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3740 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3740 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.725 ms 0 /classes/Cart.php:1430
436
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 185 LIMIT 1
0.725 ms 1 /classes/Product.php:5659
910
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2659
AND image_shop.`cover` = 1 LIMIT 1
0.725 ms 1 /classes/Product.php:3570
3577
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2621
0.725 ms 1 /classes/Product.php:2902
500
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2769 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2769 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.724 ms 0 /classes/Cart.php:1430
3713
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4942) AND (b.`id_shop` = 1) LIMIT 1
0.724 ms 1 /src/Adapter/EntityMapper.php:71
4489
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (9596) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.724 ms 1 Yes Yes /classes/Product.php:4524
3169
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 12552
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.723 ms 1 /classes/SpecificPrice.php:259
3752
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 5589) AND (b.`id_shop` = 1) LIMIT 1
0.723 ms 1 /src/Adapter/EntityMapper.php:71
3749
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 5093) AND (b.`id_shop` = 1) LIMIT 1
0.723 ms 1 /src/Adapter/EntityMapper.php:71
3794
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 6176) AND (b.`id_shop` = 1) LIMIT 1
0.723 ms 1 /src/Adapter/EntityMapper.php:71
76
SELECT SQL_NO_CACHE *
FROM `hgt78_carrier_lang`
WHERE `id_carrier` = 282 AND `id_shop` = 1
0.722 ms 198 /src/Adapter/EntityMapper.php:79
4494
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (9688) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.722 ms 1 Yes Yes /classes/Product.php:4524
2479
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 6194 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 6194 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.722 ms 0 /classes/Cart.php:1430
2532
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 7938)
0.722 ms 1 /classes/Product.php:3860
1803
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3765 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3765 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.721 ms 0 /classes/Cart.php:1430
399
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3587 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3587 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.721 ms 0 /classes/Cart.php:1430
1025
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2639 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.721 ms 10 Yes /classes/SpecificPrice.php:576
1251
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2658
ORDER BY f.position ASC
0.721 ms 5 Yes /classes/Product.php:6021
3234
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5143
ORDER BY `position`
0.721 ms 1 Yes /classes/Product.php:3545
1280
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2642 AND id_shop=1 LIMIT 1
0.720 ms 1 /classes/Product.php:6876
4194
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 96) LIMIT 1
0.720 ms 1 /src/Adapter/EntityMapper.php:71
968
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2634
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.719 ms 0 /classes/SpecificPrice.php:259
2036
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4964) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.719 ms 1 /classes/stock/StockAvailable.php:453
2640
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 8392 LIMIT 1
0.719 ms 10 /classes/SpecificPrice.php:435
2910
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 9689)
0.719 ms 1 /classes/Product.php:3860
3079
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 10111 LIMIT 1
0.719 ms 10 /classes/SpecificPrice.php:435
3098
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 10297
ORDER BY f.position ASC
0.719 ms 5 Yes /classes/Product.php:6021
4491
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (9598) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.719 ms 1 Yes Yes /classes/Product.php:4524
2457
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 6192 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 6192 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.719 ms 0 /classes/Cart.php:1430
1271
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2646) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.718 ms 1 /classes/stock/StockAvailable.php:453
3842
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 6193) AND (b.`id_shop` = 1) LIMIT 1
0.718 ms 1 /src/Adapter/EntityMapper.php:71
4001
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 10072
ORDER BY `position`
0.718 ms 1 Yes /classes/Product.php:3545
3023
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 10069)
0.718 ms 1 /classes/Product.php:3860
3046
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 10071 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.718 ms 10 Yes /classes/SpecificPrice.php:576
744
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2799
ORDER BY f.position ASC
0.717 ms 5 Yes /classes/Product.php:6021
3443
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2636) AND (b.`id_shop` = 1) LIMIT 1
0.717 ms 1 /src/Adapter/EntityMapper.php:71
1120
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2624
AND image_shop.`cover` = 1 LIMIT 1
0.716 ms 1 /classes/Product.php:3570
2075
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 5283
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.716 ms 0 /classes/SpecificPrice.php:259
3255
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5136
ORDER BY `position`
0.716 ms 1 Yes /classes/Product.php:3545
389
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3740
ORDER BY f.position ASC
0.715 ms 5 Yes /classes/Product.php:6021
776
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3075 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3075 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.715 ms 0 /classes/Cart.php:1430
3659
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3764) AND (b.`id_shop` = 1) LIMIT 1
0.715 ms 1 /src/Adapter/EntityMapper.php:71
3734
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 5282) AND (b.`id_shop` = 1) LIMIT 1
0.715 ms 1 /src/Adapter/EntityMapper.php:71
1899
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3807)
0.715 ms 1 /classes/Product.php:3860
1914
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3808 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3808 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.714 ms 0 /classes/Cart.php:1430
2048
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4965 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4965 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.714 ms 0 /classes/Cart.php:1430
2654
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 8393)
0.714 ms 1 /classes/Product.php:3860
4223
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 47 AND `id_shop` = 1
0.714 ms 6 /src/Adapter/EntityMapper.php:79
3875
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 7944) AND (b.`id_shop` = 1) LIMIT 1
0.713 ms 1 /src/Adapter/EntityMapper.php:71
3983
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 9697
ORDER BY `position`
0.713 ms 1 Yes /classes/Product.php:3545
1285
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2643
AND image_shop.`cover` = 1 LIMIT 1
0.712 ms 1 /classes/Product.php:3570
1836
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3775 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3775 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.712 ms 0 /classes/Cart.php:1430
3945
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 9596
ORDER BY `position`
0.712 ms 1 Yes /classes/Product.php:3545
196
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 5146 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.712 ms 10 Yes /classes/SpecificPrice.php:576
1714
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3752 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3752 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.712 ms 0 /classes/Cart.php:1430
3731
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4966) AND (b.`id_shop` = 1) LIMIT 1
0.712 ms 1 /src/Adapter/EntityMapper.php:71
3773
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 6047) AND (b.`id_shop` = 1) LIMIT 1
0.712 ms 1 /src/Adapter/EntityMapper.php:71
666
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2764 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2764 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.711 ms 0 /classes/Cart.php:1430
1857
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3777) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.711 ms 1 /classes/stock/StockAvailable.php:453
2750
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 8975 LIMIT 1
0.711 ms 16 /classes/SpecificPrice.php:435
798
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2794 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2794 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.710 ms 0 /classes/Cart.php:1430
1226
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3456 AND `id_group` = 1 LIMIT 1
0.710 ms 0 /classes/GroupReduction.php:156
342
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 5133 AND `id_group` = 1 LIMIT 1
0.709 ms 0 /classes/GroupReduction.php:156
3440
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2782) AND (b.`id_shop` = 1) LIMIT 1
0.709 ms 1 /src/Adapter/EntityMapper.php:71
788
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3176
ORDER BY f.position ASC
0.709 ms 5 Yes /classes/Product.php:6021
4265
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3743) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.709 ms 1 Yes Yes /classes/Product.php:4524
1133
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2625 LIMIT 1
0.708 ms 10 /classes/SpecificPrice.php:435
3843
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 6193
ORDER BY `position`
0.707 ms 1 Yes /classes/Product.php:3545
3977
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 9694
ORDER BY `position`
0.707 ms 1 Yes /classes/Product.php:3545
1140
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2625 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2625 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.707 ms 0 /classes/Cart.php:1430
2625
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 7769 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 7769 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.707 ms 0 /classes/Cart.php:1430
1765
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3757)
0.705 ms 1 /classes/Product.php:3860
4285
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2661) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.705 ms 1 Yes Yes /classes/Product.php:4524
3206
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 7541) AND (b.`id_shop` = 1) LIMIT 1
0.704 ms 1 /src/Adapter/EntityMapper.php:71
1970
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4934 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4934 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.704 ms 0 /classes/Cart.php:1430
2676
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 8396)
0.704 ms 1 /classes/Product.php:3860
2391
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 6185 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 6185 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.703 ms 0 /classes/Cart.php:1430
3585
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2654
ORDER BY `position`
0.703 ms 1 Yes /classes/Product.php:3545
4496
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (9690) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.703 ms 1 Yes Yes /classes/Product.php:4524
1260
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2647) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.703 ms 1 /classes/stock/StockAvailable.php:453
3639
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3752
ORDER BY `position`
0.702 ms 1 Yes /classes/Product.php:3545
3867
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 7941
ORDER BY `position`
0.702 ms 1 Yes /classes/Product.php:3545
766
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3178
ORDER BY f.position ASC
0.702 ms 5 Yes /classes/Product.php:6021
2264
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 6173
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.702 ms 1 /classes/SpecificPrice.php:259
2503
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 6500
AND image_shop.`cover` = 1 LIMIT 1
0.702 ms 2 /classes/Product.php:3570
3767
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 5972) AND (b.`id_shop` = 1) LIMIT 1
0.702 ms 1 /src/Adapter/EntityMapper.php:71
129
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 7541 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.701 ms 10 Yes /classes/SpecificPrice.php:576
190
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 5147 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 5147 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.701 ms 0 /classes/Cart.php:1430
2646
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 8392) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.701 ms 1 /classes/stock/StockAvailable.php:453
4274
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2623) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.701 ms 1 Yes Yes /classes/Product.php:4524
1069
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3477 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.700 ms 10 Yes /classes/SpecificPrice.php:576
1383
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3326 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3326 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.700 ms 0 /classes/Cart.php:1430
1903
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3807 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3807 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.700 ms 0 /classes/Cart.php:1430
2874
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 9687 LIMIT 1
0.700 ms 11 /classes/SpecificPrice.php:435
3061
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 10072 AND `id_group` = 1 LIMIT 1
0.700 ms 0 /classes/GroupReduction.php:156
3164
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 10305
ORDER BY f.position ASC
0.700 ms 5 Yes /classes/Product.php:6021
489
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2768 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2768 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.699 ms 0 /classes/Cart.php:1430
1637
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3745 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3745 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.699 ms 0 /classes/Cart.php:1430
1881
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3805 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3805 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.699 ms 0 /classes/Cart.php:1430
2179
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 5971 AND `id_group` = 1 LIMIT 1
0.699 ms 0 /classes/GroupReduction.php:156
555
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2776 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2776 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.698 ms 0 /classes/Cart.php:1430
3242
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 5140) AND (b.`id_shop` = 1) LIMIT 1
0.698 ms 1 /src/Adapter/EntityMapper.php:71
2980
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 9695 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 9695 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.698 ms 0 /classes/Cart.php:1430
4022
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 10303
ORDER BY `position`
0.698 ms 1 Yes /classes/Product.php:3545
909
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3177
ORDER BY f.position ASC
0.697 ms 5 Yes /classes/Product.php:6021
3567
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3132
ORDER BY `position`
0.697 ms 1 Yes /classes/Product.php:3545
1894
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3807
AND image_shop.`cover` = 1 LIMIT 1
0.697 ms 1 /classes/Product.php:3570
77
SELECT SQL_NO_CACHE * FROM hgt78_carrier_zone WHERE id_carrier = 282 LIMIT 1
0.696 ms 4 /modules/colissimo_simplicite/colissimo_simplicite.php:1383
1835
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3775) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.696 ms 1 /classes/stock/StockAvailable.php:453
3357
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2778
ORDER BY `position`
0.696 ms 1 Yes /classes/Product.php:3545
1838
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3776
AND image_shop.`cover` = 1 LIMIT 1
0.695 ms 2 /classes/Product.php:3570
3371
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2799) AND (b.`id_shop` = 1) LIMIT 1
0.695 ms 1 /src/Adapter/EntityMapper.php:71
3609
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3586
ORDER BY `position`
0.695 ms 1 Yes /classes/Product.php:3545
2214
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 6047) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.694 ms 1 /classes/stock/StockAvailable.php:453
3233
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 5143) AND (b.`id_shop` = 1) LIMIT 1
0.694 ms 1 /src/Adapter/EntityMapper.php:71
3285
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2694
ORDER BY `position`
0.694 ms 1 Yes /classes/Product.php:3545
3888
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 7773
ORDER BY `position`
0.693 ms 1 Yes /classes/Product.php:3545
787
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3176 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3176 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.692 ms 0 /classes/Cart.php:1430
2227
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 6107
ORDER BY f.position ASC
0.692 ms 5 Yes /classes/Product.php:6021
4492
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (9687) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.692 ms 1 Yes Yes /classes/Product.php:4524
401
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2893
AND image_shop.`cover` = 1 LIMIT 1
0.691 ms 1 /classes/Product.php:3570
1646
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3746 AND `id_group` = 1 LIMIT 1
0.691 ms 0 /classes/GroupReduction.php:156
4281
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2775) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.691 ms 1 Yes Yes /classes/Product.php:4524
1273
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2646
ORDER BY f.position ASC
0.690 ms 5 Yes /classes/Product.php:6021
1398
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2818) AND (b.`id_shop` = 1) LIMIT 1
0.690 ms 1 /src/Adapter/EntityMapper.php:71
2251
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 182 LIMIT 1
0.690 ms 1 /classes/Product.php:5659
3446
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2637) AND (b.`id_shop` = 1) LIMIT 1
0.690 ms 1 /src/Adapter/EntityMapper.php:71
3740
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 5284) AND (b.`id_shop` = 1) LIMIT 1
0.689 ms 1 /src/Adapter/EntityMapper.php:71
2985
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 9697
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.689 ms 0 /classes/SpecificPrice.php:259
1163
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2627
ORDER BY f.position ASC
0.688 ms 5 Yes /classes/Product.php:6021
3725
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4964) AND (b.`id_shop` = 1) LIMIT 1
0.688 ms 1 /src/Adapter/EntityMapper.php:71
4286
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2690) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.688 ms 1 Yes Yes /classes/Product.php:4524
4122
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 70 AND `id_shop` = 1
0.688 ms 6 /src/Adapter/EntityMapper.php:79
3559
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2892
0.687 ms 1 /classes/Product.php:2902
4267
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3740) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.687 ms 1 Yes Yes /classes/Product.php:4524
434
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2660
ORDER BY f.position ASC
0.687 ms 5 Yes /classes/Product.php:6021
3161
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 10305 AND `id_group` = 1 LIMIT 1
0.686 ms 0 /classes/GroupReduction.php:156
4264
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4902) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.686 ms 1 Yes Yes /classes/Product.php:4524
1168
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2640 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.686 ms 10 Yes /classes/SpecificPrice.php:576
3737
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 5283) AND (b.`id_shop` = 1) LIMIT 1
0.686 ms 1 /src/Adapter/EntityMapper.php:71
972
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2634 AND `id_group` = 1 LIMIT 1
0.685 ms 0 /classes/GroupReduction.php:156
2917
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 334 LIMIT 1
0.685 ms 1 /classes/Product.php:5659
3539
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3254) AND (b.`id_shop` = 1) LIMIT 1
0.685 ms 1 /src/Adapter/EntityMapper.php:71
4331
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3459) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.685 ms 1 Yes Yes /classes/Product.php:4524
4484
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (9321) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.685 ms 1 Yes Yes /classes/Product.php:4524
3134
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 10303 LIMIT 1
0.684 ms 10 /classes/SpecificPrice.php:435
3518
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2646) AND (b.`id_shop` = 1) LIMIT 1
0.684 ms 1 /src/Adapter/EntityMapper.php:71
3984
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 9697
0.684 ms 1 /classes/Product.php:2902
3989
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 10068
ORDER BY `position`
0.684 ms 1 Yes /classes/Product.php:3545
4144
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 192 AND `id_shop` = 1
0.684 ms 6 /src/Adapter/EntityMapper.php:79
4301
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3178) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.684 ms 1 Yes Yes /classes/Product.php:4524
207
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 5145 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.683 ms 10 Yes /classes/SpecificPrice.php:576
3074
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 10073) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.683 ms 1 /classes/stock/StockAvailable.php:453
4222
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 47) LIMIT 1
0.683 ms 1 /src/Adapter/EntityMapper.php:71
4161
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 162) LIMIT 1
0.683 ms 1 /src/Adapter/EntityMapper.php:71
4474
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (8396) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.681 ms 1 Yes Yes /classes/Product.php:4524
2395
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 6186 LIMIT 1
0.680 ms 10 /classes/SpecificPrice.php:435
3610
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3586
0.680 ms 1 /classes/Product.php:2902
2747
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 8420
ORDER BY f.position ASC
0.679 ms 5 Yes /classes/Product.php:6021
3557
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2892) AND (b.`id_shop` = 1) LIMIT 1
0.679 ms 1 /src/Adapter/EntityMapper.php:71
3339
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2692
ORDER BY `position`
0.678 ms 1 Yes /classes/Product.php:3545
3341
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2693) AND (b.`id_shop` = 1) LIMIT 1
0.678 ms 1 /src/Adapter/EntityMapper.php:71
721
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2797 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2797 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.678 ms 0 /classes/Cart.php:1430
4248
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (5148) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.678 ms 1 Yes Yes /classes/Product.php:4524
2317
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 182 LIMIT 1
0.677 ms 1 /classes/Product.php:5659
3287
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2660) AND (b.`id_shop` = 1) LIMIT 1
0.677 ms 1 /src/Adapter/EntityMapper.php:71
57
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 18) AND (b.`id_shop` = 1) LIMIT 1
0.677 ms 1 /src/Adapter/EntityMapper.php:71
1239
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2649 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2649 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.677 ms 0 /classes/Cart.php:1430
1135
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2625 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.676 ms 10 Yes /classes/SpecificPrice.php:576
1808
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3766
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.676 ms 1 /classes/SpecificPrice.php:259
3090
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 10297 LIMIT 1
0.676 ms 10 /classes/SpecificPrice.php:435
4355
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3264) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.676 ms 1 Yes Yes /classes/Product.php:4524
1002
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2637
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.675 ms 0 /classes/SpecificPrice.php:259
3657
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3763
ORDER BY `position`
0.675 ms 1 Yes /classes/Product.php:3545
4435
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (6129) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.675 ms 1 Yes Yes /classes/Product.php:4524
2505
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 6500 LIMIT 1
0.674 ms 10 /classes/SpecificPrice.php:435
2515
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `hgt78_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 113 LIMIT 1
0.674 ms 1 /classes/Category.php:1378
4450
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (6187) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.674 ms 1 Yes Yes /classes/Product.php:4524
870
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2790 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.673 ms 10 Yes /classes/SpecificPrice.php:576
1929
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4574 LIMIT 1
0.673 ms 10 /classes/SpecificPrice.php:435
2294
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 6177
AND image_shop.`cover` = 1 LIMIT 1
0.673 ms 1 /classes/Product.php:3570
2805
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 9324
AND image_shop.`cover` = 1 LIMIT 1
0.673 ms 1 /classes/Product.php:3570
185
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 5147 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.672 ms 10 Yes /classes/SpecificPrice.php:576
2808
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 9324
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.672 ms 0 /classes/SpecificPrice.php:259
3660
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3764
ORDER BY `position`
0.672 ms 1 Yes /classes/Product.php:3545
3980
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 9695
ORDER BY `position`
0.672 ms 1 Yes /classes/Product.php:3545
2584
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 7944 LIMIT 1
0.672 ms 10 /classes/SpecificPrice.php:435
2725
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 8418
ORDER BY f.position ASC
0.671 ms 5 Yes /classes/Product.php:6021
41
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 33) AND (b.`id_shop` = 1) LIMIT 1
0.671 ms 1 /src/Adapter/EntityMapper.php:71
4518
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (12552) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.671 ms 1 Yes Yes /classes/Product.php:4524
224
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 5144
ORDER BY f.position ASC
0.670 ms 5 Yes /classes/Product.php:6021
1242
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.670 ms 1 /classes/Product.php:5659
1885
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3806 LIMIT 1
0.670 ms 10 /classes/SpecificPrice.php:435
3368
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2798) AND (b.`id_shop` = 1) LIMIT 1
0.670 ms 1 /src/Adapter/EntityMapper.php:71
2359
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 6182
ORDER BY f.position ASC
0.669 ms 5 Yes /classes/Product.php:6021
3397
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2780
0.669 ms 1 /classes/Product.php:2902
544
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2775 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2775 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.668 ms 0 /classes/Cart.php:1430
2996
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 10067 LIMIT 1
0.668 ms 10 /classes/SpecificPrice.php:435
3050
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 10071) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.668 ms 1 /classes/stock/StockAvailable.php:453
3251
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 5137) AND (b.`id_shop` = 1) LIMIT 1
0.668 ms 1 /src/Adapter/EntityMapper.php:71
3040
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 10070
ORDER BY f.position ASC
0.667 ms 5 Yes /classes/Product.php:6021
3483
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2625
ORDER BY `position`
0.667 ms 1 Yes /classes/Product.php:3545
37
SELECT SQL_NO_CACHE id_shop
FROM `hgt78_group_shop`
WHERE `id_group` = 1
AND id_shop = 1 LIMIT 1
0.666 ms 1 /classes/ObjectModel.php:1729
3813
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 6182
ORDER BY `position`
0.666 ms 1 Yes /classes/Product.php:3545
228
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 5143
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.666 ms 0 /classes/SpecificPrice.php:259
1936
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4574 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4574 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.666 ms 0 /classes/Cart.php:1430
3084
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 10111 AND `id_group` = 1 LIMIT 1
0.665 ms 0 /classes/GroupReduction.php:156
3344
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2771) AND (b.`id_shop` = 1) LIMIT 1
0.665 ms 1 /src/Adapter/EntityMapper.php:71
3533
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2645) AND (b.`id_shop` = 1) LIMIT 1
0.665 ms 1 /src/Adapter/EntityMapper.php:71
3636
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3751
ORDER BY `position`
0.665 ms 1 Yes /classes/Product.php:3545
4206
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 61) LIMIT 1
0.665 ms 1 /src/Adapter/EntityMapper.php:71
3974
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 9693
ORDER BY `position`
0.664 ms 1 Yes /classes/Product.php:3545
4212
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 80) LIMIT 1
0.664 ms 1 /src/Adapter/EntityMapper.php:71
891
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2792
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.663 ms 0 /classes/SpecificPrice.php:259
1124
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2624 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.663 ms 10 Yes /classes/SpecificPrice.php:576
2285
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 6176 LIMIT 1
0.663 ms 10 /classes/SpecificPrice.php:435
4004
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 10073
ORDER BY `position`
0.663 ms 1 Yes /classes/Product.php:3545
4316
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2635) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.663 ms 1 Yes Yes /classes/Product.php:4524
610
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2691 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2691 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.663 ms 0 /classes/Cart.php:1430
2748
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 8975
AND image_shop.`cover` = 1 LIMIT 1
0.663 ms 1 /classes/Product.php:3570
2940
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 9692 LIMIT 1
0.663 ms 11 /classes/SpecificPrice.php:435
2158
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 5591) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.662 ms 1 /classes/stock/StockAvailable.php:453
3597
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3556
ORDER BY `position`
0.662 ms 1 Yes /classes/Product.php:3545
2651
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 8393 LIMIT 1
0.662 ms 10 /classes/SpecificPrice.php:435
151
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 7539 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.661 ms 10 Yes /classes/SpecificPrice.php:576
822
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2781
AND image_shop.`cover` = 1 LIMIT 1
0.661 ms 1 /classes/Product.php:3570
235
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 5143
ORDER BY f.position ASC
0.660 ms 5 Yes /classes/Product.php:6021
996
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2636) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.660 ms 1 /classes/stock/StockAvailable.php:453
3807
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 6180
ORDER BY `position`
0.660 ms 1 Yes /classes/Product.php:3545
212
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 5145 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 5145 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.659 ms 0 /classes/Cart.php:1430
599
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2690 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2690 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.659 ms 0 /classes/Cart.php:1430
2866
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 9598 AND id_shop=1 LIMIT 1
0.659 ms 1 /classes/Product.php:6876
4269
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2893) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.659 ms 1 Yes Yes /classes/Product.php:4524
4299
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2799) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.659 ms 1 Yes Yes /classes/Product.php:4524
810
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2793
ORDER BY f.position ASC
0.658 ms 5 Yes /classes/Product.php:6021
3855
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 6500
ORDER BY `position`
0.658 ms 2 Yes /classes/Product.php:3545
3861
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 7938
ORDER BY `position`
0.658 ms 1 Yes /classes/Product.php:3545
2270
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 6173 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 6173 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.658 ms 0 /classes/Cart.php:1430
1730
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3754
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.657 ms 0 /classes/SpecificPrice.php:259
3194
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 11001)
0.657 ms 1 /classes/Product.php:3860
1266
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2646
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.657 ms 0 /classes/SpecificPrice.php:259
4505
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (10069) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.657 ms 1 Yes Yes /classes/Product.php:4524
2336
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 6180 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 6180 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.655 ms 0 /classes/Cart.php:1430
916
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2659 AND id_shop=1 LIMIT 1
0.655 ms 1 /classes/Product.php:6876
3116
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 10299 AND id_shop=1 LIMIT 1
0.655 ms 1 /classes/Product.php:6876
4187
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 60 AND `id_shop` = 1
0.655 ms 6 /src/Adapter/EntityMapper.php:79
4305
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2793) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.654 ms 1 Yes Yes /classes/Product.php:4524
4356
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3265) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.654 ms 1 Yes Yes /classes/Product.php:4524
1262
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2647
ORDER BY f.position ASC
0.653 ms 5 Yes /classes/Product.php:6021
2040
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.653 ms 1 /classes/Product.php:5659
3245
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 5139) AND (b.`id_shop` = 1) LIMIT 1
0.653 ms 1 /src/Adapter/EntityMapper.php:71
3548
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3326) AND (b.`id_shop` = 1) LIMIT 1
0.653 ms 1 /src/Adapter/EntityMapper.php:71
1981
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4935 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4935 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.653 ms 0 /classes/Cart.php:1430
1417
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2892 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2892 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.652 ms 0 /classes/Cart.php:1430
1478
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2621 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.652 ms 11 Yes /classes/SpecificPrice.php:576
2706
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 8417 LIMIT 1
0.652 ms 10 /classes/SpecificPrice.php:435
3485
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2626) AND (b.`id_shop` = 1) LIMIT 1
0.652 ms 1 /src/Adapter/EntityMapper.php:71
455
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2651 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2651 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.651 ms 0 /classes/Cart.php:1430
1717
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.651 ms 1 /classes/Product.php:5659
4293
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2777) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.651 ms 1 Yes Yes /classes/Product.php:4524
3199
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 11001
ORDER BY f.position ASC
0.650 ms 5 Yes /classes/Product.php:6021
4147
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 37) AND (b.`id_shop` = 1) LIMIT 1
0.650 ms 1 /src/Adapter/EntityMapper.php:71
4306
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2780) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.650 ms 1 Yes Yes /classes/Product.php:4524
621
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2692 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2692 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.649 ms 0 /classes/Cart.php:1430
955
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.649 ms 1 /classes/Product.php:5659
1031
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2639
ORDER BY f.position ASC
0.649 ms 5 Yes /classes/Product.php:6021
1819
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3771
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.649 ms 0 /classes/SpecificPrice.php:259
1855
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3777 AND id_shop=1 LIMIT 1
0.649 ms 1 /classes/Product.php:6876
2711
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 8417 AND `id_group` = 1 LIMIT 1
0.649 ms 0 /classes/GroupReduction.php:156
4154
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 53 AND `id_shop` = 1
0.649 ms 6 /src/Adapter/EntityMapper.php:79
4502
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (9697) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.649 ms 1 Yes Yes /classes/Product.php:4524
479
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2767
ORDER BY f.position ASC
0.648 ms 5 Yes /classes/Product.php:6021
1956
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4932 AND id_shop=1 LIMIT 1
0.648 ms 1 /classes/Product.php:6876
4441
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (6178) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.648 ms 1 Yes Yes /classes/Product.php:4524
4483
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (9055) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.648 ms 1 Yes Yes /classes/Product.php:4524
119
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 7542)
0.648 ms 1 /classes/Product.php:3860
3846
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 6194
ORDER BY `position`
0.647 ms 1 Yes /classes/Product.php:3545
878
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 182 LIMIT 1
0.646 ms 1 /classes/Product.php:5659
44
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 36) AND (b.`id_shop` = 1) LIMIT 1
0.646 ms 1 /src/Adapter/EntityMapper.php:71
3816
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 6183
ORDER BY `position`
0.645 ms 1 Yes /classes/Product.php:3545
4513
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (10299) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.645 ms 1 Yes Yes /classes/Product.php:4524
16
SELECT SQL_NO_CACHE `id_hook`, `name` FROM `hgt78_hook`
0.645 ms 1185 /classes/Hook.php:1348
1146
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2626 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.645 ms 10 Yes /classes/SpecificPrice.php:576
2003
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4943) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.645 ms 1 /classes/stock/StockAvailable.php:453
3572
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2490) AND (b.`id_shop` = 1) LIMIT 1
0.645 ms 1 /src/Adapter/EntityMapper.php:71
1157
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2627 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.644 ms 10 Yes /classes/SpecificPrice.php:576
2644
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 8392 AND id_shop=1 LIMIT 1
0.644 ms 1 /classes/Product.php:6876
2904
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 9688
ORDER BY f.position ASC
0.644 ms 5 Yes /classes/Product.php:6021
3248
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 5138) AND (b.`id_shop` = 1) LIMIT 1
0.644 ms 1 /src/Adapter/EntityMapper.php:71
1582
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3584 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3584 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.643 ms 0 /classes/Cart.php:1430
4124
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 78) LIMIT 1
0.643 ms 1 /src/Adapter/EntityMapper.php:71
3197
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 11001) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.642 ms 1 /classes/stock/StockAvailable.php:453
3321
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2776
ORDER BY `position`
0.642 ms 1 Yes /classes/Product.php:3545
1048
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2629)
0.641 ms 1 /classes/Product.php:3860
3909
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 8417
ORDER BY `position`
0.641 ms 1 Yes /classes/Product.php:3545
4068
SELECT SQL_NO_CACHE `width`, `height`
FROM hgt78_image_type
WHERE `name` = 'small_default' LIMIT 1
0.641 ms 1 /classes/Image.php:563
156
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 7539 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 7539 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.641 ms 0 /classes/Cart.php:1430
3230
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 5144) AND (b.`id_shop` = 1) LIMIT 1
0.641 ms 1 /src/Adapter/EntityMapper.php:71
246
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 5142
ORDER BY f.position ASC
0.640 ms 5 Yes /classes/Product.php:6021
258
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 5140
AND image_shop.`cover` = 1 LIMIT 1
0.640 ms 1 /classes/Product.php:3570
2462
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 6193
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.640 ms 0 /classes/SpecificPrice.php:259
318
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 5135)
0.640 ms 1 /classes/Product.php:3860
1076
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2620
AND image_shop.`cover` = 1 LIMIT 1
0.640 ms 1 /classes/Product.php:3570
2770
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 9055
AND image_shop.`cover` = 1 LIMIT 1
0.640 ms 1 /classes/Product.php:3570
4112
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 45 AND `id_shop` = 1
0.640 ms 6 /src/Adapter/EntityMapper.php:79
3985
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 10067) AND (b.`id_shop` = 1) LIMIT 1
0.639 ms 1 /src/Adapter/EntityMapper.php:71
422
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2694
ORDER BY f.position ASC
0.639 ms 5 Yes /classes/Product.php:6021
3097
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 10297 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 10297 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.639 ms 0 /classes/Cart.php:1430
4047
SELECT SQL_NO_CACHE * FROM `hgt78_cart_rule` cr
LEFT JOIN `hgt78_cart_rule_lang` crl 
ON (cr.`id_cart_rule` = crl.`id_cart_rule` AND crl.`id_lang` = 1) WHERE (cr.`id_customer` = 0) AND NOW() BETWEEN cr.date_from AND cr.date_to
AND cr.`active` = 1
AND free_shipping = 1 AND carrier_restriction = 1
0.639 ms 6 /classes/CartRule.php:423
1673
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.638 ms 1 /classes/Product.php:5659
2101
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 5293 AND `id_group` = 1 LIMIT 1
0.638 ms 0 /classes/GroupReduction.php:156
2195
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.638 ms 1 /classes/Product.php:5659
2357
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 6182) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.638 ms 1 /classes/stock/StockAvailable.php:453
2481
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 6195
AND image_shop.`cover` = 1 LIMIT 1
0.638 ms 1 /classes/Product.php:3570
2945
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 9692 AND `id_group` = 1 LIMIT 1
0.638 ms 0 /classes/GroupReduction.php:156
3077
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 10111
AND image_shop.`cover` = 1 LIMIT 1
0.638 ms 2 /classes/Product.php:3570
3093
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 10297)
0.638 ms 1 /classes/Product.php:3860
4049
SELECT SQL_NO_CACHE * FROM `hgt78_cart_rule` cr
LEFT JOIN `hgt78_cart_rule_lang` crl 
ON (cr.`id_cart_rule` = crl.`id_cart_rule` AND crl.`id_lang` = 0) WHERE (cr.`id_customer` = 0) AND NOW() BETWEEN cr.date_from AND cr.date_to
AND cr.`active` = 1
AND cr.`quantity` > 0 AND highlight = 1 AND code NOT LIKE "BO_ORDER_%"
0.638 ms 1 /classes/CartRule.php:423
4488
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (9535) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.638 ms 1 Yes Yes /classes/Product.php:4524
512
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2770
ORDER BY f.position ASC
0.637 ms 5 Yes /classes/Product.php:6021
655
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2738 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2738 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.637 ms 0 /classes/Cart.php:1430
970
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2634)
0.637 ms 1 /classes/Product.php:3860
632
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2693 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2693 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.637 ms 0 /classes/Cart.php:1430
832
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2781
ORDER BY f.position ASC
0.637 ms 5 Yes /classes/Product.php:6021
2189
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 5972 AND id_shop=1 LIMIT 1
0.636 ms 1 /classes/Product.php:6876
2826
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 9325
ORDER BY f.position ASC
0.636 ms 5 Yes /classes/Product.php:6021
1555
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3556 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.636 ms 10 Yes /classes/SpecificPrice.php:576
1658
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3747) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.636 ms 1 /classes/stock/StockAvailable.php:453
1939
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.635 ms 1 /classes/Product.php:5659
3868
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 7941
0.635 ms 1 /classes/Product.php:2902
3201
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 7543
ORDER BY `position`
0.634 ms 1 Yes /classes/Product.php:3545
1112
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3458
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.634 ms 0 /classes/SpecificPrice.php:259
1362
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3264
ORDER BY f.position ASC
0.634 ms 5 Yes /classes/Product.php:6021
1949
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4932
AND image_shop.`cover` = 1 LIMIT 1
0.634 ms 1 /classes/Product.php:3570
3223
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 5147
0.634 ms 1 /classes/Product.php:2902
3822
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 6185
ORDER BY `position`
0.634 ms 1 Yes /classes/Product.php:3545
4516
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (10304) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.634 ms 1 Yes Yes /classes/Product.php:4524
3235
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 5143
0.633 ms 1 /classes/Product.php:2902
2565
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 7942)
0.632 ms 1 /classes/Product.php:3860
4053
SELECT SQL_NO_CACHE COUNT(DISTINCT c.id_currency) FROM `hgt78_currency` c
LEFT JOIN hgt78_currency_shop cs ON (cs.id_currency = c.id_currency AND cs.id_shop = 1)
WHERE c.`active` = 1 AND c.`deleted` = 0 LIMIT 1
0.632 ms 2 /classes/Currency.php:1136
2598
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 7945)
0.631 ms 1 /classes/Product.php:3860
2926
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 9690
ORDER BY f.position ASC
0.631 ms 5 Yes /classes/Product.php:6021
3105
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 10298 AND id_shop=1 LIMIT 1
0.631 ms 1 /classes/Product.php:6876
3146
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 10304
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.631 ms 1 /classes/SpecificPrice.php:259
4507
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (10071) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.631 ms 1 Yes Yes /classes/Product.php:4524
1306
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2655
ORDER BY f.position ASC
0.631 ms 5 Yes /classes/Product.php:6021
1632
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3745 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.631 ms 10 Yes /classes/SpecificPrice.php:576
993
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2636)
0.630 ms 1 /classes/Product.php:3860
2525
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 6501
ORDER BY f.position ASC
0.630 ms 5 Yes /classes/Product.php:6021
2593
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 7945
AND image_shop.`cover` = 1 LIMIT 1
0.630 ms 1 /classes/Product.php:3570
4501
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (9695) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.629 ms 1 Yes Yes /classes/Product.php:4524
4503
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (10067) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.629 ms 1 Yes Yes /classes/Product.php:4524
1372
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3265 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3265 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.629 ms 0 /classes/Cart.php:1430
2259
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 6172 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 6172 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.629 ms 0 /classes/Cart.php:1430
2339
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 182 LIMIT 1
0.629 ms 1 /classes/Product.php:5659
3375
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2800
ORDER BY `position`
0.629 ms 1 Yes /classes/Product.php:3545
4486
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (9324) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.629 ms 1 Yes Yes /classes/Product.php:4524
3007
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 10068) AND (b.`id_shop` = 1) LIMIT 1
0.628 ms 1 /src/Adapter/EntityMapper.php:71
269
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 5139
AND image_shop.`cover` = 1 LIMIT 1
0.627 ms 1 /classes/Product.php:3570
2543
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 7940)
0.627 ms 1 /classes/Product.php:3860
4480
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (8420) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.627 ms 1 Yes Yes /classes/Product.php:4524
213
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 5145
ORDER BY f.position ASC
0.626 ms 5 Yes /classes/Product.php:6021
3565
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3107
0.626 ms 1 /classes/Product.php:2902
4482
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (8976) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.626 ms 1 Yes Yes /classes/Product.php:4524
4509
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (10073) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.626 ms 1 Yes Yes /classes/Product.php:4524
192
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 5146
AND image_shop.`cover` = 1 LIMIT 1
0.625 ms 1 /classes/Product.php:3570
4511
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (10297) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.624 ms 1 Yes Yes /classes/Product.php:4524
1588
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3585 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.623 ms 10 Yes /classes/SpecificPrice.php:576
1806
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 174 LIMIT 1
0.623 ms 1 /classes/Product.php:5659
381
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3740 LIMIT 1
0.622 ms 10 /classes/SpecificPrice.php:435
1339
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3252 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3252 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.622 ms 0 /classes/Cart.php:1430
4515
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (10303) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.622 ms 1 Yes Yes /classes/Product.php:4524
4520
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (11001) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.622 ms 1 Yes Yes /classes/Product.php:4524
2519
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 6501 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.622 ms 10 Yes /classes/SpecificPrice.php:576
1544
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3484 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.621 ms 10 Yes /classes/SpecificPrice.php:576
1560
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3556 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3556 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.621 ms 0 /classes/Cart.php:1430
2302
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 6177) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.621 ms 1 /classes/stock/StockAvailable.php:453
2316
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 6179
AND image_shop.`cover` = 1 LIMIT 1
0.621 ms 1 /classes/Product.php:3570
2595
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 7945 LIMIT 1
0.621 ms 10 /classes/SpecificPrice.php:435
2716
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 184 LIMIT 1
0.621 ms 1 /classes/Product.php:5659
3029
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 10070
AND image_shop.`cover` = 1 LIMIT 1
0.621 ms 1 /classes/Product.php:3570
3458
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2629) AND (b.`id_shop` = 1) LIMIT 1
0.621 ms 1 /src/Adapter/EntityMapper.php:71
4506
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (10070) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.621 ms 1 Yes Yes /classes/Product.php:4524
2096
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 5293 LIMIT 1
0.620 ms 10 /classes/SpecificPrice.php:435
4510
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (10111) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.620 ms 1 Yes Yes /classes/Product.php:4524
2674
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 8396
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.619 ms 0 /classes/SpecificPrice.php:259
3112
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 10299 LIMIT 1
0.619 ms 10 /classes/SpecificPrice.php:435
6
SELECT SQL_NO_CACHE l.*, ls.`id_shop`
FROM `hgt78_lang` l
LEFT JOIN `hgt78_lang_shop` ls ON (l.id_lang = ls.id_lang)
0.619 ms 6 /classes/Language.php:1080
3350
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2764) AND (b.`id_shop` = 1) LIMIT 1
0.618 ms 1 /src/Adapter/EntityMapper.php:71
643
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2771 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2771 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.618 ms 0 /classes/Cart.php:1430
2745
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 8420) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.618 ms 1 /classes/stock/StockAvailable.php:453
3088
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 10297
AND image_shop.`cover` = 1 LIMIT 1
0.618 ms 1 /classes/Product.php:3570
3953
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 9687
ORDER BY `position`
0.618 ms 1 Yes /classes/Product.php:3545
783
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3176)
0.617 ms 1 /classes/Product.php:3860
4025
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 10304
ORDER BY `position`
0.617 ms 1 Yes /classes/Product.php:3545
880
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2791
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.616 ms 0 /classes/SpecificPrice.php:259
975
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2634
ORDER BY f.position ASC
0.616 ms 5 Yes /classes/Product.php:6021
2052
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4966 LIMIT 1
0.616 ms 10 /classes/SpecificPrice.php:435
3422
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2659) AND (b.`id_shop` = 1) LIMIT 1
0.616 ms 1 /src/Adapter/EntityMapper.php:71
1091
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3459 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.615 ms 10 Yes /classes/SpecificPrice.php:576
1352
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3264
AND image_shop.`cover` = 1 LIMIT 1
0.615 ms 1 /classes/Product.php:3570
1715
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3752
ORDER BY f.position ASC
0.615 ms 5 Yes /classes/Product.php:6021
3360
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2779
ORDER BY `position`
0.615 ms 1 Yes /classes/Product.php:3545
4504
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (10068) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.615 ms 1 Yes Yes /classes/Product.php:4524
588
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2661 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2661 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.614 ms 0 /classes/Cart.php:1430
1384
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3326
ORDER BY f.position ASC
0.614 ms 5 Yes /classes/Product.php:6021
3428
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2631) AND (b.`id_shop` = 1) LIMIT 1
0.614 ms 1 /src/Adapter/EntityMapper.php:71
853
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2788 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2788 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.613 ms 0 /classes/Cart.php:1430
2445
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 6191) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.613 ms 1 /classes/stock/StockAvailable.php:453
2559
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 7941
ORDER BY f.position ASC
0.613 ms 5 Yes /classes/Product.php:6021
4424
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (5093) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.613 ms 1 Yes Yes /classes/Product.php:4524
4514
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (10302) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.613 ms 1 Yes Yes /classes/Product.php:4524
4495
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (9689) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.612 ms 1 Yes Yes /classes/Product.php:4524
3693
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3808
ORDER BY `position`
0.611 ms 1 Yes /classes/Product.php:3545
711
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2795
ORDER BY f.position ASC
0.611 ms 5 Yes /classes/Product.php:6021
2172
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 5971
AND image_shop.`cover` = 1 LIMIT 1
0.610 ms 1 /classes/Product.php:3570
3488
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2627) AND (b.`id_shop` = 1) LIMIT 1
0.610 ms 1 /src/Adapter/EntityMapper.php:71
4145
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 195) LIMIT 1
0.610 ms 1 /src/Adapter/EntityMapper.php:71
280
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 5138
AND image_shop.`cover` = 1 LIMIT 1
0.608 ms 1 /classes/Product.php:3570
4406
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4256) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.608 ms 1 Yes Yes /classes/Product.php:4524
4485
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (9323) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.608 ms 1 Yes Yes /classes/Product.php:4524
1080
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2620 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.607 ms 10 Yes /classes/SpecificPrice.php:576
1433
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3107
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.607 ms 0 /classes/SpecificPrice.php:259
3490
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2627
0.607 ms 1 /classes/Product.php:2902
4415
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4963) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.607 ms 1 Yes Yes /classes/Product.php:4524
2009
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4944
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.606 ms 0 /classes/SpecificPrice.php:259
2060
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4966
ORDER BY f.position ASC
0.606 ms 5 Yes /classes/Product.php:6021
3968
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 9691
ORDER BY `position`
0.606 ms 1 Yes /classes/Product.php:3545
1785
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3764 LIMIT 1
0.606 ms 10 /classes/SpecificPrice.php:435
4311
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2790) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.606 ms 1 Yes Yes /classes/Product.php:4524
994
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2636 AND id_shop=1 LIMIT 1
0.605 ms 1 /classes/Product.php:6876
2013
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4944 AND `id_group` = 1 LIMIT 1
0.605 ms 0 /classes/GroupReduction.php:156
2727
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 184 LIMIT 1
0.605 ms 1 /classes/Product.php:5659
4318
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2632) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.605 ms 1 Yes Yes /classes/Product.php:4524
4031
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 12552
ORDER BY `position`
0.604 ms 1 Yes /classes/Product.php:3545
4359
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2818) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.604 ms 1 Yes Yes /classes/Product.php:4524
4512
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (10298) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.604 ms 1 Yes Yes /classes/Product.php:4524
4361
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3099) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.604 ms 1 Yes Yes /classes/Product.php:4524
3
SELECT SQL_NO_CACHE value FROM `hgt78_configuration` WHERE `name` = "PS_MULTISHOP_FEATURE_ACTIVE" LIMIT 1
0.603 ms 1 /classes/shop/Shop.php:1183
236
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 5142
AND image_shop.`cover` = 1 LIMIT 1
0.603 ms 1 /classes/Product.php:3570
2392
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 6185
ORDER BY f.position ASC
0.603 ms 5 Yes /classes/Product.php:6021
3809
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 6181) AND (b.`id_shop` = 1) LIMIT 1
0.603 ms 1 /src/Adapter/EntityMapper.php:71
695
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2779)
0.602 ms 1 /classes/Product.php:3860
1964
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4934
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.602 ms 0 /classes/SpecificPrice.php:259
2709
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 8417)
0.602 ms 1 /classes/Product.php:3860
4487
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (9325) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.602 ms 1 Yes Yes /classes/Product.php:4524
2712
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 8417) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.601 ms 1 /classes/stock/StockAvailable.php:453
2546
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 7940) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.600 ms 1 /classes/stock/StockAvailable.php:453
3012
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 10068 AND id_shop=1 LIMIT 1
0.600 ms 1 /classes/Product.php:6876
3069
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 10073
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.600 ms 1 /classes/SpecificPrice.php:259
4413
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4943) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.599 ms 1 Yes Yes /classes/Product.php:4524
3385
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3075
0.599 ms 1 /classes/Product.php:2902
4498
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (9692) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.599 ms 1 Yes Yes /classes/Product.php:4524
419
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2694 AND `id_group` = 1 LIMIT 1
0.598 ms 0 /classes/GroupReduction.php:156
3076
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 10073
ORDER BY f.position ASC
0.598 ms 5 Yes /classes/Product.php:6021
3202
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 7543
0.598 ms 1 /classes/Product.php:2902
3271
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3743
0.598 ms 1 /classes/Product.php:2902
4088
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 50 AND `id_shop` = 1
0.598 ms 6 /src/Adapter/EntityMapper.php:79
3237
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5142
ORDER BY `position`
0.597 ms 1 Yes /classes/Product.php:3545
2034
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4964 AND id_shop=1 LIMIT 1
0.596 ms 1 /classes/Product.php:6876
2309
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 6178 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.596 ms 10 Yes /classes/SpecificPrice.php:576
4426
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (5590) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.596 ms 1 Yes Yes /classes/Product.php:4524
1626
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3689 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3689 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.595 ms 0 /classes/Cart.php:1430
4074
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 40 AND `id_shop` = 1
0.595 ms 6 /src/Adapter/EntityMapper.php:79
1097
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3459
ORDER BY f.position ASC
0.595 ms 5 Yes /classes/Product.php:6021
2585
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 7944
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.595 ms 0 /classes/SpecificPrice.php:259
2298
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 6177 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.594 ms 10 Yes /classes/SpecificPrice.php:576
3345
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2771
ORDER BY `position`
0.594 ms 2 Yes /classes/Product.php:3545
3503
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2657) AND (b.`id_shop` = 1) LIMIT 1
0.593 ms 1 /src/Adapter/EntityMapper.php:71
1014
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2638 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.593 ms 10 Yes /classes/SpecificPrice.php:576
2414
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 6187
ORDER BY f.position ASC
0.593 ms 5 Yes /classes/Product.php:6021
4508
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (10072) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.593 ms 1 Yes Yes /classes/Product.php:4524
295
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 5137 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.592 ms 10 Yes /classes/SpecificPrice.php:576
3349
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2738
0.592 ms 1 /classes/Product.php:2902
134
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 7541 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 7541 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.591 ms 0 /classes/Cart.php:1430
3017
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 10069
AND image_shop.`cover` = 1 LIMIT 1
0.591 ms 1 /classes/Product.php:3570
3738
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5283
ORDER BY `position`
0.591 ms 2 Yes /classes/Product.php:3545
4497
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (9691) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.591 ms 1 Yes Yes /classes/Product.php:4524
2695
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 8401 LIMIT 1
0.590 ms 10 /classes/SpecificPrice.php:435
4366
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2621) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.590 ms 1 Yes Yes /classes/Product.php:4524
3351
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2764
ORDER BY `position`
0.590 ms 1 Yes /classes/Product.php:3545
1980
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4935) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.589 ms 1 /classes/stock/StockAvailable.php:453
1988
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4942 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.589 ms 10 Yes /classes/SpecificPrice.php:576
991
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2636
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.588 ms 0 /classes/SpecificPrice.php:259
1204
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2648 AND `id_group` = 1 LIMIT 1
0.588 ms 0 /classes/GroupReduction.php:156
3336
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2691
ORDER BY `position`
0.588 ms 1 Yes /classes/Product.php:3545
3803
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 6179) AND (b.`id_shop` = 1) LIMIT 1
0.588 ms 1 /src/Adapter/EntityMapper.php:71
4436
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (6172) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.588 ms 1 Yes Yes /classes/Product.php:4524
2093
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 5284
ORDER BY f.position ASC
0.586 ms 5 Yes /classes/Product.php:6021
4191
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 81 AND `id_shop` = 1
0.585 ms 6 /src/Adapter/EntityMapper.php:79
4011
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 10297
0.584 ms 1 /classes/Product.php:2902
1395
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3155
ORDER BY f.position ASC
0.583 ms 5 Yes /classes/Product.php:6021
60
SELECT SQL_NO_CACHE `id_module` FROM `hgt78_module` WHERE `name` = "ps_accounts" LIMIT 1
0.583 ms 1 /src/Adapter/Module/ModuleDataProvider.php:257
225
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 5143
AND image_shop.`cover` = 1 LIMIT 1
0.582 ms 1 /classes/Product.php:3570
690
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2779
AND image_shop.`cover` = 1 LIMIT 1
0.582 ms 1 /classes/Product.php:3570
1767
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3757 AND `id_group` = 1 LIMIT 1
0.582 ms 0 /classes/GroupReduction.php:156
1770
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3757
ORDER BY f.position ASC
0.582 ms 5 Yes /classes/Product.php:6021
2935
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 9691) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.582 ms 1 /classes/stock/StockAvailable.php:453
4421
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (5284) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.582 ms 1 Yes Yes /classes/Product.php:4524
337
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 5133 LIMIT 1
0.581 ms 10 /classes/SpecificPrice.php:435
1737
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3754
ORDER BY f.position ASC
0.581 ms 5 Yes /classes/Product.php:6021
1781
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3763 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3763 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.581 ms 0 /classes/Cart.php:1430
2919
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 9690
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.581 ms 0 /classes/SpecificPrice.php:259
4376
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3585) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.581 ms 1 Yes Yes /classes/Product.php:4524
2893
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 9686
ORDER BY f.position ASC
0.580 ms 5 Yes /classes/Product.php:6021
3645
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3754
ORDER BY `position`
0.580 ms 1 Yes /classes/Product.php:3545
4374
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3558) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.580 ms 1 Yes Yes /classes/Product.php:4524
2166
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 5970)
0.579 ms 1 /classes/Product.php:3860
2655
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 8393 AND id_shop=1 LIMIT 1
0.579 ms 1 /classes/Product.php:6876
3117
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 10299 AND `id_group` = 1 LIMIT 1
0.579 ms 0 /classes/GroupReduction.php:156
2432
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 6189 AND id_shop=1 LIMIT 1
0.578 ms 1 /classes/Product.php:6876
4500
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (9694) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.578 ms 1 Yes Yes /classes/Product.php:4524
36
SELECT SQL_NO_CACHE *
FROM `hgt78_group_lang`
WHERE `id_group` = 1
0.578 ms 6 /src/Adapter/EntityMapper.php:79
3744
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5293
ORDER BY `position`
0.578 ms 2 Yes /classes/Product.php:3545
1172
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2640) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.577 ms 1 /classes/stock/StockAvailable.php:453
1994
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4942
ORDER BY f.position ASC
0.577 ms 5 Yes /classes/Product.php:6021
4388
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3753) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.577 ms 1 Yes Yes /classes/Product.php:4524
1005
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2637 AND id_shop=1 LIMIT 1
0.576 ms 1 /classes/Product.php:6876
2551
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 7941 LIMIT 1
0.576 ms 10 /classes/SpecificPrice.php:435
1456
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3327 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.575 ms 10 Yes /classes/SpecificPrice.php:576
728
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2798)
0.574 ms 1 /classes/Product.php:3860
3801
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 6178
ORDER BY `position`
0.574 ms 1 Yes /classes/Product.php:3545
4390
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3755) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.574 ms 1 Yes Yes /classes/Product.php:4524
876
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2790
ORDER BY f.position ASC
0.574 ms 5 Yes /classes/Product.php:6021
2286
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 6176
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.574 ms 0 /classes/SpecificPrice.php:259
3544
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3264
0.574 ms 1 /classes/Product.php:2902
4127
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 199) LIMIT 1
0.573 ms 1 /src/Adapter/EntityMapper.php:71
4371
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3455) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.572 ms 1 Yes Yes /classes/Product.php:4524
924
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2635
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.572 ms 0 /classes/SpecificPrice.php:259
4010
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 10297
ORDER BY `position`
0.572 ms 1 Yes /classes/Product.php:3545
4429
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (5971) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.572 ms 1 Yes Yes /classes/Product.php:4524
67
SELECT SQL_NO_CACHE *
FROM `hgt78_country_lang`
WHERE `id_country` = 8
0.571 ms 6 /src/Adapter/EntityMapper.php:79
143
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 7540 AND `id_group` = 1 LIMIT 1
0.571 ms 0 /classes/GroupReduction.php:156
167
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 6727 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 6727 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.571 ms 0 /classes/Cart.php:1430
2282
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 6174
ORDER BY f.position ASC
0.571 ms 5 Yes /classes/Product.php:6021
3942
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 9535
ORDER BY `position`
0.571 ms 1 Yes /classes/Product.php:3545
3885
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 7769
ORDER BY `position`
0.571 ms 1 Yes /classes/Product.php:3545
24
SELECT SQL_NO_CACHE `id_lang` FROM `hgt78_lang`
WHERE `locale` = 'fr-fr'
OR `language_code` = 'fr-fr' LIMIT 1
0.570 ms 6 /classes/Language.php:883
964
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2633
ORDER BY f.position ASC
0.570 ms 5 Yes /classes/Product.php:6021
1394
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3155 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3155 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.570 ms 0 /classes/Cart.php:1430
1421
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3099 LIMIT 1
0.570 ms 10 /classes/SpecificPrice.php:435
4389
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3754) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.570 ms 1 Yes Yes /classes/Product.php:4524
4395
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3765) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.570 ms 1 Yes Yes /classes/Product.php:4524
4414
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4944) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.570 ms 1 Yes Yes /classes/Product.php:4524
4360
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2892) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.570 ms 1 Yes Yes /classes/Product.php:4524
2582
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 7944
AND image_shop.`cover` = 1 LIMIT 1
0.569 ms 1 /classes/Product.php:3570
4384
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3749) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.569 ms 1 Yes Yes /classes/Product.php:4524
4419
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (5282) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.569 ms 1 Yes Yes /classes/Product.php:4524
2516
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 113 LIMIT 1
0.568 ms 1 /classes/Product.php:5659
948
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2632)
0.567 ms 1 /classes/Product.php:3860
3496
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2641
0.567 ms 1 /classes/Product.php:2902
1125
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2624)
0.567 ms 1 /classes/Product.php:3860
2249
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 6129
ORDER BY f.position ASC
0.567 ms 5 Yes /classes/Product.php:6021
2914
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 9689 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 9689 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.567 ms 0 /classes/Cart.php:1430
3434
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2633) AND (b.`id_shop` = 1) LIMIT 1
0.567 ms 1 /src/Adapter/EntityMapper.php:71
4378
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3639) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.567 ms 1 Yes Yes /classes/Product.php:4524
1668
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3748 AND `id_group` = 1 LIMIT 1
0.566 ms 0 /classes/GroupReduction.php:156
1756
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3756 AND `id_group` = 1 LIMIT 1
0.566 ms 0 /classes/GroupReduction.php:156
3879
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 7945
ORDER BY `position`
0.566 ms 1 Yes /classes/Product.php:3545
257
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 5141
ORDER BY f.position ASC
0.565 ms 5 Yes /classes/Product.php:6021
1462
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3327
ORDER BY f.position ASC
0.565 ms 5 Yes /classes/Product.php:6021
4397
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3771) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.565 ms 1 Yes Yes /classes/Product.php:4524
4425
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (5589) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.565 ms 1 Yes Yes /classes/Product.php:4524
4375
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3584) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.565 ms 1 Yes Yes /classes/Product.php:4524
1233
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2649
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.564 ms 0 /classes/SpecificPrice.php:259
3091
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 10297
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.564 ms 1 /classes/SpecificPrice.php:259
4439
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (6176) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.564 ms 1 Yes Yes /classes/Product.php:4524
1484
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2621
ORDER BY f.position ASC
0.563 ms 5 Yes /classes/Product.php:6021
523
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2773
ORDER BY f.position ASC
0.563 ms 5 Yes /classes/Product.php:6021
2290
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 6176 AND `id_group` = 1 LIMIT 1
0.563 ms 0 /classes/GroupReduction.php:156
3798
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 6177
ORDER BY `position`
0.563 ms 1 Yes /classes/Product.php:3545
4402
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3805) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.563 ms 1 Yes Yes /classes/Product.php:4524
3456
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2630
ORDER BY `position`
0.562 ms 1 Yes /classes/Product.php:3545
4405
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3808) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.562 ms 1 Yes Yes /classes/Product.php:4524
879
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2791 LIMIT 1
0.562 ms 10 /classes/SpecificPrice.php:435
2841
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 9596
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.562 ms 1 /classes/SpecificPrice.php:259
4423
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (5296) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.562 ms 1 Yes Yes /classes/Product.php:4524
4524
SELECT SQL_NO_CACHE DISTINCT c.*
FROM `hgt78_category` c
LEFT JOIN `hgt78_category_lang` cl ON (c.`id_category` = cl.`id_category` AND cl.`id_lang` = 1)
WHERE `level_depth` = 1
0.562 ms 21 /classes/Category.php:2242
600
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2690
ORDER BY f.position ASC
0.561 ms 5 Yes /classes/Product.php:6021
3520
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2646
0.561 ms 1 /classes/Product.php:2902
3962
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 9689
ORDER BY `position`
0.561 ms 1 Yes /classes/Product.php:3545
4418
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4966) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.561 ms 1 Yes Yes /classes/Product.php:4524
4430
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (5972) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.561 ms 1 Yes Yes /classes/Product.php:4524
701
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2795
AND image_shop.`cover` = 1 LIMIT 1
0.560 ms 1 /classes/Product.php:3570
4083
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 38) AND (b.`id_shop` = 1) LIMIT 1
0.560 ms 1 /src/Adapter/EntityMapper.php:71
4377
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3586) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.559 ms 1 Yes Yes /classes/Product.php:4524
4499
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (9693) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.559 ms 1 Yes Yes /classes/Product.php:4524
1705
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3752
AND image_shop.`cover` = 1 LIMIT 1
0.558 ms 1 /classes/Product.php:3570
1938
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4575
AND image_shop.`cover` = 1 LIMIT 1
0.558 ms 1 /classes/Product.php:3570
400
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3587
ORDER BY f.position ASC
0.558 ms 5 Yes /classes/Product.php:6021
4135
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 216) AND (b.`id_shop` = 1) LIMIT 1
0.558 ms 1 /src/Adapter/EntityMapper.php:71
4370
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3454) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.558 ms 1 Yes Yes /classes/Product.php:4524
1216
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2657) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.557 ms 1 /classes/stock/StockAvailable.php:453
1298
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2655 LIMIT 1
0.557 ms 10 /classes/SpecificPrice.php:435
877
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2791
AND image_shop.`cover` = 1 LIMIT 1
0.556 ms 1 /classes/Product.php:3570
3071
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 10073)
0.556 ms 1 /classes/Product.php:3860
3996
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 10070
0.556 ms 1 /classes/Product.php:2902
4109
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 344 AND `id_shop` = 1
0.556 ms 6 /src/Adapter/EntityMapper.php:79
1533
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3455 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.555 ms 10 Yes /classes/SpecificPrice.php:576
2499
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 6499 AND `id_group` = 1 LIMIT 1
0.555 ms 0 /classes/GroupReduction.php:156
2641
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 8392
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.555 ms 0 /classes/SpecificPrice.php:259
3582
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2650
ORDER BY `position`
0.555 ms 1 Yes /classes/Product.php:3545
4438
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (6174) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.555 ms 1 Yes Yes /classes/Product.php:4524
1969
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4934) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.554 ms 1 /classes/stock/StockAvailable.php:453
1989
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4942)
0.554 ms 1 /classes/Product.php:3860
2835
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 9535) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.554 ms 1 /classes/stock/StockAvailable.php:453
4202
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 33) AND (b.`id_shop` = 1) LIMIT 1
0.554 ms 1 /src/Adapter/EntityMapper.php:71
4379
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3689) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.554 ms 1 Yes Yes /classes/Product.php:4524
4432
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (6047) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.554 ms 1 Yes Yes /classes/Product.php:4524
70
SELECT SQL_NO_CACHE * FROM hgt78_revslider_sliders
0.553 ms 2 /modules/revsliderprestashop/includes/revslider_db.class.php:214
898
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2792
ORDER BY f.position ASC
0.553 ms 5 Yes /classes/Product.php:6021
4373
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3556) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.553 ms 1 Yes Yes /classes/Product.php:4524
875
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2790 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2790 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.553 ms 0 /classes/Cart.php:1430
3894
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 8393
ORDER BY `position`
0.553 ms 1 Yes /classes/Product.php:3545
1390
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3155)
0.552 ms 1 /classes/Product.php:3860
1813
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3766) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.552 ms 1 /classes/stock/StockAvailable.php:453
2848
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 9596
ORDER BY f.position ASC
0.552 ms 5 Yes /classes/Product.php:6021
4416
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4964) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.551 ms 1 Yes Yes /classes/Product.php:4524
1438
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3107) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.550 ms 1 /classes/stock/StockAvailable.php:453
4007
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 10111
ORDER BY `position`
0.550 ms 2 Yes /classes/Product.php:3545
201
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 5146 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 5146 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.549 ms 0 /classes/Cart.php:1430
1432
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3107 LIMIT 1
0.549 ms 10 /classes/SpecificPrice.php:435
1991
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4942 AND `id_group` = 1 LIMIT 1
0.549 ms 0 /classes/GroupReduction.php:156
2436
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 6189
ORDER BY f.position ASC
0.549 ms 5 Yes /classes/Product.php:6021
4362
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3107) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.549 ms 1 Yes Yes /classes/Product.php:4524
1288
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2643
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.549 ms 0 /classes/SpecificPrice.php:259
3995
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 10070
ORDER BY `position`
0.549 ms 1 Yes /classes/Product.php:3545
4385
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3750) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.549 ms 1 Yes Yes /classes/Product.php:4524
3891
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 8392
ORDER BY `position`
0.548 ms 1 Yes /classes/Product.php:3545
578
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2765
ORDER BY f.position ASC
0.547 ms 5 Yes /classes/Product.php:6021
899
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3177
AND image_shop.`cover` = 1 LIMIT 1
0.547 ms 1 /classes/Product.php:3570
1130
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2624
ORDER BY f.position ASC
0.547 ms 5 Yes /classes/Product.php:6021
1495
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2733
ORDER BY f.position ASC
0.547 ms 5 Yes /classes/Product.php:6021
3951
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 9598
ORDER BY `position`
0.547 ms 1 Yes /classes/Product.php:3545
4396
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3766) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.547 ms 1 Yes Yes /classes/Product.php:4524
4442
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (6179) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.547 ms 1 Yes Yes /classes/Product.php:4524
1724
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3753) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.546 ms 1 /classes/stock/StockAvailable.php:453
4399
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3776) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.546 ms 1 Yes Yes /classes/Product.php:4524
2162
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.546 ms 1 /classes/Product.php:5659
3128
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 10302 AND `id_group` = 1 LIMIT 1
0.546 ms 0 /classes/GroupReduction.php:156
424
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `hgt78_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 38 LIMIT 1
0.545 ms 1 /classes/Category.php:1378
980
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2782
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.545 ms 0 /classes/SpecificPrice.php:259
4156
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 73 AND `id_shop` = 1
0.545 ms 6 /src/Adapter/EntityMapper.php:79
4367
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2733) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.545 ms 1 Yes Yes /classes/Product.php:4524
4383
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3748) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.545 ms 1 Yes Yes /classes/Product.php:4524
4398
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3775) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.545 ms 1 Yes Yes /classes/Product.php:4524
3699
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4574
ORDER BY `position`
0.545 ms 1 Yes /classes/Product.php:3545
1090
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3459
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.544 ms 0 /classes/SpecificPrice.php:259
2530
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 7938
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.544 ms 0 /classes/SpecificPrice.php:259
3453
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2639
ORDER BY `position`
0.544 ms 1 Yes /classes/Product.php:3545
3933
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 9323
ORDER BY `position`
0.544 ms 1 Yes /classes/Product.php:3545
4407
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4574) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.544 ms 1 Yes Yes /classes/Product.php:4524
4369
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2654) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.544 ms 1 Yes Yes /classes/Product.php:4524
4382
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3747) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.544 ms 1 Yes Yes /classes/Product.php:4524
931
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2635
ORDER BY f.position ASC
0.542 ms 5 Yes /classes/Product.php:6021
23
SELECT SQL_NO_CACHE * FROM `hgt78_currency` c ORDER BY `iso_code` ASC
0.541 ms 2 Yes /classes/Currency.php:709
443
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2652) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.541 ms 1 /classes/stock/StockAvailable.php:453
4137
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 44) LIMIT 1
0.541 ms 1 /src/Adapter/EntityMapper.php:71
4403
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3806) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.541 ms 1 Yes Yes /classes/Product.php:4524
844
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2788
AND image_shop.`cover` = 1 LIMIT 1
0.540 ms 1 /classes/Product.php:3570
3918
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 8420
ORDER BY `position`
0.540 ms 1 Yes /classes/Product.php:3545
4433
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (6107) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.540 ms 1 Yes Yes /classes/Product.php:4524
2369
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 6183 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 6183 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.539 ms 0 /classes/Cart.php:1430
2550
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 320 LIMIT 1
0.539 ms 1 /classes/Product.php:5659
3592
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3455
0.539 ms 1 /classes/Product.php:2902
4411
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4935) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.539 ms 1 Yes Yes /classes/Product.php:4524
3648
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3755
ORDER BY `position`
0.539 ms 1 Yes /classes/Product.php:3545
4427
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (5591) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.539 ms 1 Yes Yes /classes/Product.php:4524
4128
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 199 AND `id_shop` = 1
0.538 ms 6 /src/Adapter/EntityMapper.php:79
4381
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3746) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.538 ms 1 Yes Yes /classes/Product.php:4524
2019
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4963 LIMIT 1
0.538 ms 10 /classes/SpecificPrice.php:435
2518
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 6501
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.538 ms 0 /classes/SpecificPrice.php:259
4428
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (5970) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.538 ms 1 Yes Yes /classes/Product.php:4524
420
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2694) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.537 ms 1 /classes/stock/StockAvailable.php:453
1246
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2658)
0.537 ms 1 /classes/Product.php:3860
4238
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 84) LIMIT 1
0.537 ms 1 /src/Adapter/EntityMapper.php:71
4409
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4932) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.537 ms 1 Yes Yes /classes/Product.php:4524
3722
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4963) AND (b.`id_shop` = 1) LIMIT 1
0.536 ms 1 /src/Adapter/EntityMapper.php:71
1450
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3132 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3132 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.536 ms 0 /classes/Cart.php:1430
1506
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2650
ORDER BY f.position ASC
0.536 ms 5 Yes /classes/Product.php:6021
2335
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 6180) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.536 ms 1 /classes/stock/StockAvailable.php:453
3762
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5970
ORDER BY `position`
0.536 ms 1 Yes /classes/Product.php:3545
4437
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (6173) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.536 ms 1 Yes Yes /classes/Product.php:4524
1007
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2637) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.535 ms 1 /classes/stock/StockAvailable.php:453
2061
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 5282
AND image_shop.`cover` = 1 LIMIT 1
0.535 ms 1 /classes/Product.php:3570
2566
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 7942 AND id_shop=1 LIMIT 1
0.535 ms 1 /classes/Product.php:6876
3348
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2738
ORDER BY `position`
0.535 ms 1 Yes /classes/Product.php:3545
3741
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5284
ORDER BY `position`
0.535 ms 2 Yes /classes/Product.php:3545
3782
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 6129) AND (b.`id_shop` = 1) LIMIT 1
0.535 ms 1 /src/Adapter/EntityMapper.php:71
4114
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 46) LIMIT 1
0.535 ms 1 /src/Adapter/EntityMapper.php:71
1918
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4256 LIMIT 1
0.534 ms 10 /classes/SpecificPrice.php:435
2524
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 6501 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 6501 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.534 ms 0 /classes/Cart.php:1430
2871
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 9687
AND image_shop.`cover` = 1 LIMIT 1
0.534 ms 1 /classes/Product.php:3570
2995
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 10067) AND (b.`id_shop` = 1) LIMIT 1
0.534 ms 1 /src/Adapter/EntityMapper.php:71
3041
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 10071
AND image_shop.`cover` = 1 LIMIT 1
0.534 ms 1 /classes/Product.php:3570
3384
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3075
ORDER BY `position`
0.534 ms 1 Yes /classes/Product.php:3545
4363
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3132) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.534 ms 1 Yes Yes /classes/Product.php:4524
1517
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2654
ORDER BY f.position ASC
0.533 ms 5 Yes /classes/Product.php:6021
2111
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 5296 AND id_shop=1 LIMIT 1
0.533 ms 1 /classes/Product.php:6876
3580
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2733
0.533 ms 1 /classes/Product.php:2902
4417
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4965) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.533 ms 1 Yes Yes /classes/Product.php:4524
4196
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 145) LIMIT 1
0.533 ms 1 /src/Adapter/EntityMapper.php:71
268
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 5140
ORDER BY f.position ASC
0.532 ms 5 Yes /classes/Product.php:6021
734
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2799
AND image_shop.`cover` = 1 LIMIT 1
0.532 ms 1 /classes/Product.php:3570
2990
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 9697) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.532 ms 1 /classes/stock/StockAvailable.php:453
3129
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 10302) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.532 ms 1 /classes/stock/StockAvailable.php:453
3618
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3745
ORDER BY `position`
0.532 ms 1 Yes /classes/Product.php:3545
835
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3179 LIMIT 1
0.531 ms 10 /classes/SpecificPrice.php:435
1230
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2649
AND image_shop.`cover` = 1 LIMIT 1
0.531 ms 1 /classes/Product.php:3570
2358
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 6182 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 6182 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.531 ms 0 /classes/Cart.php:1430
4386
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3751) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.531 ms 1 Yes Yes /classes/Product.php:4524
4440
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (6177) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.531 ms 1 Yes Yes /classes/Product.php:4524
231
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 5143 AND id_shop=1 LIMIT 1
0.530 ms 1 /classes/Product.php:6876
1561
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3556
ORDER BY f.position ASC
0.530 ms 5 Yes /classes/Product.php:6021
2104
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 5293
ORDER BY f.position ASC
0.530 ms 5 Yes /classes/Product.php:6021
2396
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 6186
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.530 ms 0 /classes/SpecificPrice.php:259
2562
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 7942 LIMIT 1
0.530 ms 10 /classes/SpecificPrice.php:435
3838
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 6191
0.530 ms 1 /classes/Product.php:2902
124
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 7542
ORDER BY f.position ASC
0.529 ms 5 Yes /classes/Product.php:6021
953
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2632
ORDER BY f.position ASC
0.529 ms 5 Yes /classes/Product.php:6021
1323
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2645)
0.529 ms 1 /classes/Product.php:3860
3178
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.529 ms 1 /classes/Product.php:5659
3965
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 9690
ORDER BY `position`
0.529 ms 1 Yes /classes/Product.php:3545
4100
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 186 AND `id_shop` = 1
0.529 ms 6 /src/Adapter/EntityMapper.php:79
865
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2789
ORDER BY f.position ASC
0.529 ms 5 Yes /classes/Product.php:6021
2954
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 9693)
0.529 ms 1 /classes/Product.php:3860
1019
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2638 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2638 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.528 ms 0 /classes/Cart.php:1430
4400
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3777) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.528 ms 1 Yes Yes /classes/Product.php:4524
1727
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3754
AND image_shop.`cover` = 1 LIMIT 1
0.528 ms 1 /classes/Product.php:3570
4364
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3327) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.528 ms 1 Yes Yes /classes/Product.php:4524
313
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 5135
AND image_shop.`cover` = 1 LIMIT 1
0.527 ms 1 /classes/Product.php:3570
2197
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 5973
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.527 ms 0 /classes/SpecificPrice.php:259
3131
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 10302
ORDER BY f.position ASC
0.527 ms 5 Yes /classes/Product.php:6021
920
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2659
ORDER BY f.position ASC
0.526 ms 5 Yes /classes/Product.php:6021
965
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2634
AND image_shop.`cover` = 1 LIMIT 1
0.526 ms 1 /classes/Product.php:3570
1093
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3459 AND id_shop=1 LIMIT 1
0.526 ms 1 /classes/Product.php:6876
3603
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3584
ORDER BY `position`
0.526 ms 1 Yes /classes/Product.php:3545
3925
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 8976
0.526 ms 1 /classes/Product.php:2902
4013
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 10298
ORDER BY `position`
0.526 ms 1 Yes /classes/Product.php:3545
4169
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 262) LIMIT 1
0.526 ms 1 /src/Adapter/EntityMapper.php:71
4210
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 79) LIMIT 1
0.526 ms 1 /src/Adapter/EntityMapper.php:71
4408
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4575) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.526 ms 1 Yes Yes /classes/Product.php:4524
529
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2774)
0.525 ms 1 /classes/Product.php:3860
2258
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 6172) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.525 ms 1 /classes/stock/StockAvailable.php:453
3306
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2769
ORDER BY `position`
0.525 ms 1 Yes /classes/Product.php:3545
3333
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2690
ORDER BY `position`
0.525 ms 1 Yes /classes/Product.php:3545
4097
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 185) LIMIT 1
0.525 ms 1 /src/Adapter/EntityMapper.php:71
4131
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 200 AND `id_shop` = 1
0.525 ms 6 /src/Adapter/EntityMapper.php:79
4139
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 51) LIMIT 1
0.525 ms 1 /src/Adapter/EntityMapper.php:71
4216
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 36) AND (b.`id_shop` = 1) LIMIT 1
0.525 ms 1 /src/Adapter/EntityMapper.php:71
4410
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4934) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.525 ms 1 Yes Yes /classes/Product.php:4524
854
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2788
ORDER BY f.position ASC
0.524 ms 5 Yes /classes/Product.php:6021
3915
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 8419
ORDER BY `position`
0.524 ms 1 Yes /classes/Product.php:3545
4167
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 261) LIMIT 1
0.524 ms 1 /src/Adapter/EntityMapper.php:71
4412
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4942) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.524 ms 1 Yes Yes /classes/Product.php:4524
3589
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3454
0.523 ms 1 /classes/Product.php:2902
860
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2789)
0.523 ms 1 /classes/Product.php:3860
2635
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 7773) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.523 ms 1 /classes/stock/StockAvailable.php:453
3633
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3750
ORDER BY `position`
0.523 ms 1 Yes /classes/Product.php:3545
1346
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3254)
0.522 ms 1 /classes/Product.php:3860
1309
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2644 LIMIT 1
0.522 ms 10 /classes/SpecificPrice.php:435
1335
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3252)
0.522 ms 1 /classes/Product.php:3860
3166
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `hgt78_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 172 LIMIT 1
0.522 ms 1 /classes/Category.php:1378
3828
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 6187
ORDER BY `position`
0.522 ms 1 Yes /classes/Product.php:3545
3959
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 9688
ORDER BY `position`
0.522 ms 1 Yes /classes/Product.php:3545
4394
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3764) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.522 ms 1 Yes Yes /classes/Product.php:4524
2252
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 6172 LIMIT 1
0.521 ms 10 /classes/SpecificPrice.php:435
2071
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 5282
ORDER BY f.position ASC
0.521 ms 5 Yes /classes/Product.php:6021
3552
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3155
ORDER BY `position`
0.521 ms 1 Yes /classes/Product.php:3545
4130
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 200) LIMIT 1
0.521 ms 1 /src/Adapter/EntityMapper.php:71
838
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3179)
0.520 ms 1 /classes/Product.php:3860
904
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3177)
0.520 ms 1 /classes/Product.php:3860
1041
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2630 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2630 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.520 ms 0 /classes/Cart.php:1430
2050
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4966
AND image_shop.`cover` = 1 LIMIT 1
0.520 ms 1 /classes/Product.php:3570
2704
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 8417
AND image_shop.`cover` = 1 LIMIT 1
0.520 ms 1 /classes/Product.php:3570
3696
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4256
ORDER BY `position`
0.520 ms 1 Yes /classes/Product.php:3545
2626
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 7769
ORDER BY f.position ASC
0.519 ms 5 Yes /classes/Product.php:6021
2927
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 9691
AND image_shop.`cover` = 1 LIMIT 1
0.519 ms 1 /classes/Product.php:3570
3705
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4932
ORDER BY `position`
0.519 ms 1 Yes /classes/Product.php:3545
4404
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3807) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.519 ms 1 Yes Yes /classes/Product.php:4524
3930
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 9321
ORDER BY `position`
0.518 ms 1 Yes /classes/Product.php:3545
4357
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3326) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.518 ms 1 Yes Yes /classes/Product.php:4524
1259
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2647 AND `id_group` = 1 LIMIT 1
0.517 ms 0 /classes/GroupReduction.php:156
1461
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3327 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3327 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.517 ms 0 /classes/Cart.php:1430
2572
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 320 LIMIT 1
0.517 ms 1 /classes/Product.php:5659
3249
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5138
ORDER BY `position`
0.517 ms 1 Yes /classes/Product.php:3545
2374
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 6184
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.516 ms 0 /classes/SpecificPrice.php:259
1374
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3326
AND image_shop.`cover` = 1 LIMIT 1
0.516 ms 2 /classes/Product.php:3570
2618
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 7769 LIMIT 1
0.516 ms 10 /classes/SpecificPrice.php:435
2762
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 8976
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.516 ms 0 /classes/SpecificPrice.php:259
3188
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 11001
AND image_shop.`cover` = 1 LIMIT 1
0.516 ms 3 /classes/Product.php:3570
3470
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3459) AND (b.`id_shop` = 1) LIMIT 1
0.516 ms 1 /src/Adapter/EntityMapper.php:71
676
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2777) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.515 ms 1 /classes/stock/StockAvailable.php:453
3123
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 10302 LIMIT 1
0.515 ms 10 /classes/SpecificPrice.php:435
3211
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 7540
0.515 ms 1 /classes/Product.php:2902
4372
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3484) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.515 ms 1 Yes Yes /classes/Product.php:4524
4420
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (5283) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.515 ms 1 Yes Yes /classes/Product.php:4524
211
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 5145) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.514 ms 1 /classes/stock/StockAvailable.php:453
3612
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3639
ORDER BY `position`
0.514 ms 1 Yes /classes/Product.php:3545
3880
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 7945
0.514 ms 1 /classes/Product.php:2902
3922
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 8975
0.514 ms 1 /classes/Product.php:2902
3264
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5133
ORDER BY `position`
0.514 ms 1 Yes /classes/Product.php:3545
1185
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2641
ORDER BY f.position ASC
0.513 ms 5 Yes /classes/Product.php:6021
2149
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 5590
ORDER BY f.position ASC
0.513 ms 5 Yes /classes/Product.php:6021
3479
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2624) AND (b.`id_shop` = 1) LIMIT 1
0.513 ms 1 /src/Adapter/EntityMapper.php:71
4422
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (5293) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.513 ms 1 Yes Yes /classes/Product.php:4524
2238
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 6108
ORDER BY f.position ASC
0.513 ms 5 Yes /classes/Product.php:6021
4380
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3745) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.513 ms 1 Yes Yes /classes/Product.php:4524
333
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 5134 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 5134 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.512 ms 0 /classes/Cart.php:1430
945
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2632 LIMIT 1
0.512 ms 10 /classes/SpecificPrice.php:435
2523
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 6501) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.512 ms 1 /classes/stock/StockAvailable.php:453
3303
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2768
ORDER BY `position`
0.512 ms 1 Yes /classes/Product.php:3545
3363
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2795
ORDER BY `position`
0.512 ms 1 Yes /classes/Product.php:3545
1527
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3454 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3454 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.512 ms 0 /classes/Cart.php:1430
3240
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5141
ORDER BY `position`
0.512 ms 1 Yes /classes/Product.php:3545
906
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3177 AND `id_group` = 1 LIMIT 1
0.511 ms 0 /classes/GroupReduction.php:156
1137
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2625 AND id_shop=1 LIMIT 1
0.511 ms 1 /classes/Product.php:6876
3558
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2892
ORDER BY `position`
0.511 ms 1 Yes /classes/Product.php:3545
4401
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3804) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.511 ms 1 Yes Yes /classes/Product.php:4524
1373
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3265
ORDER BY f.position ASC
0.511 ms 5 Yes /classes/Product.php:6021
3764
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 5971) AND (b.`id_shop` = 1) LIMIT 1
0.511 ms 1 /src/Adapter/EntityMapper.php:71
4358
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3155) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.511 ms 1 Yes Yes /classes/Product.php:4524
4431
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (5973) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.511 ms 1 Yes Yes /classes/Product.php:4524
1696
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3751 LIMIT 1
0.510 ms 10 /classes/SpecificPrice.php:435
2552
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 7941
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.510 ms 0 /classes/SpecificPrice.php:259
2915
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 9689
ORDER BY f.position ASC
0.510 ms 5 Yes /classes/Product.php:6021
3372
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2799
ORDER BY `position`
0.510 ms 1 Yes /classes/Product.php:3545
74
SELECT SQL_NO_CACHE `id_module` FROM `hgt78_module` WHERE `name` = "colissimo_simplicite" LIMIT 1
0.509 ms 1 /classes/module/Module.php:2664
125
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 7541
AND image_shop.`cover` = 1 LIMIT 1
0.509 ms 1 /classes/Product.php:3570
141
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 7540)
0.509 ms 1 /classes/Product.php:3860
407
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2893 AND id_shop=1 LIMIT 1
0.509 ms 1 /classes/Product.php:6876
2609
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 7946)
0.509 ms 1 /classes/Product.php:3860
3646
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3754
0.509 ms 1 /classes/Product.php:2902
3663
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3765
ORDER BY `position`
0.509 ms 1 Yes /classes/Product.php:3545
3819
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 6184
ORDER BY `position`
0.509 ms 1 Yes /classes/Product.php:3545
50
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 39) AND (b.`id_shop` = 1) LIMIT 1
0.509 ms 1 /src/Adapter/EntityMapper.php:71
2007
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 190 LIMIT 1
0.509 ms 1 /classes/Product.php:5659
2650
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 174 LIMIT 1
0.508 ms 1 /classes/Product.php:5659
3172
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 12552 AND id_shop=1 LIMIT 1
0.508 ms 1 /classes/Product.php:6876
3702
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4575
ORDER BY `position`
0.508 ms 1 Yes /classes/Product.php:3545
3882
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 7946
ORDER BY `position`
0.508 ms 1 Yes /classes/Product.php:3545
2815
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 9324
ORDER BY f.position ASC
0.508 ms 5 Yes /classes/Product.php:6021
90
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `hgt78_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 185 LIMIT 1
0.507 ms 1 /classes/Category.php:1378
1001
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2637 LIMIT 1
0.507 ms 10 /classes/SpecificPrice.php:435
2212
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 6047 AND id_shop=1 LIMIT 1
0.507 ms 1 /classes/Product.php:6876
3279
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3587
ORDER BY `position`
0.507 ms 1 Yes /classes/Product.php:3545
4393
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3763) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.507 ms 1 Yes Yes /classes/Product.php:4524
208
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 5145)
0.507 ms 1 /classes/Product.php:3860
3921
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 8975
ORDER BY `position`
0.507 ms 1 Yes /classes/Product.php:3545
3924
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 8976
ORDER BY `position`
0.507 ms 1 Yes /classes/Product.php:3545
285
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 5138)
0.506 ms 1 /classes/Product.php:3860
4365
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2490) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.506 ms 1 Yes Yes /classes/Product.php:4524
180
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 5148
ORDER BY f.position ASC
0.506 ms 5 Yes /classes/Product.php:6021
2700
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 8401 AND `id_group` = 1 LIMIT 1
0.506 ms 0 /classes/GroupReduction.php:156
2023
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4963 AND id_shop=1 LIMIT 1
0.505 ms 1 /classes/Product.php:6876
1468
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2490)
0.505 ms 1 /classes/Product.php:3860
2152
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 5591 LIMIT 1
0.505 ms 10 /classes/SpecificPrice.php:435
2292
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 6176 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 6176 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.505 ms 0 /classes/Cart.php:1430
4213
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 80 AND `id_shop` = 1
0.505 ms 6 /src/Adapter/EntityMapper.php:79
217
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 5144
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.504 ms 0 /classes/SpecificPrice.php:259
233
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 5143) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.504 ms 1 /classes/stock/StockAvailable.php:453
1030
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2639 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2639 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.504 ms 0 /classes/Cart.php:1430
2488
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 6195 AND `id_group` = 1 LIMIT 1
0.504 ms 0 /classes/GroupReduction.php:156
2634
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 7773 AND `id_group` = 1 LIMIT 1
0.504 ms 0 /classes/GroupReduction.php:156
3342
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2693
ORDER BY `position`
0.504 ms 1 Yes /classes/Product.php:3545
3750
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5093
ORDER BY `position`
0.504 ms 4 Yes /classes/Product.php:3545
3859
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 6501
0.504 ms 1 /classes/Product.php:2902
2549
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 7941
AND image_shop.`cover` = 1 LIMIT 1
0.504 ms 1 /classes/Product.php:3570
378
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3741
ORDER BY f.position ASC
0.503 ms 5 Yes /classes/Product.php:6021
1871
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3804
ORDER BY f.position ASC
0.503 ms 5 Yes /classes/Product.php:6021
2086
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 5284
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.503 ms 0 /classes/SpecificPrice.php:259
3004
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 10067
ORDER BY f.position ASC
0.503 ms 5 Yes /classes/Product.php:6021
1594
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3585
ORDER BY f.position ASC
0.502 ms 5 Yes /classes/Product.php:6021
1181
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2641 AND id_shop=1 LIMIT 1
0.502 ms 1 /classes/Product.php:6876
2171
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 5970
ORDER BY f.position ASC
0.502 ms 5 Yes /classes/Product.php:6021
3327
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2765
ORDER BY `position`
0.502 ms 1 Yes /classes/Product.php:3545
1472
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2490 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2490 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.501 ms 0 /classes/Cart.php:1430
3159
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 10305)
0.501 ms 1 /classes/Product.php:3860
467
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2623
ORDER BY f.position ASC
0.501 ms 5 Yes /classes/Product.php:6021
1583
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3584
ORDER BY f.position ASC
0.501 ms 5 Yes /classes/Product.php:6021
1578
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3584)
0.500 ms 1 /classes/Product.php:3860
175
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 5148)
0.500 ms 1 /classes/Product.php:3860
1893
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3806
ORDER BY f.position ASC
0.500 ms 5 Yes /classes/Product.php:6021
18
SELECT SQL_NO_CACHE name, alias FROM `hgt78_hook_alias`
0.499 ms 88 /classes/Hook.php:342
237
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 309 LIMIT 1
0.499 ms 1 /classes/Product.php:5659
1052
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2629 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2629 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.499 ms 0 /classes/Cart.php:1430
1310
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2644
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.499 ms 0 /classes/SpecificPrice.php:259
1399
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2818 LIMIT 1
0.499 ms 10 /classes/SpecificPrice.php:435
2790
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 9321 AND `id_group` = 1 LIMIT 1
0.499 ms 0 /classes/GroupReduction.php:156
2403
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 6186
ORDER BY f.position ASC
0.499 ms 5 Yes /classes/Product.php:6021
114
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 7542
AND image_shop.`cover` = 1 LIMIT 1
0.498 ms 1 /classes/Product.php:3570
595
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2690)
0.498 ms 1 /classes/Product.php:3860
2025
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4963) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.498 ms 1 /classes/stock/StockAvailable.php:453
4117
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 54) LIMIT 1
0.498 ms 1 /src/Adapter/EntityMapper.php:71
4177
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 266) LIMIT 1
0.498 ms 1 /src/Adapter/EntityMapper.php:71
2603
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 7945
ORDER BY f.position ASC
0.497 ms 5 Yes /classes/Product.php:6021
3261
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5134
ORDER BY `position`
0.497 ms 1 Yes /classes/Product.php:3545
3541
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3254
0.497 ms 1 /classes/Product.php:2902
1605
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3586
ORDER BY f.position ASC
0.497 ms 5 Yes /classes/Product.php:6021
1745
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3755 AND `id_group` = 1 LIMIT 1
0.497 ms 0 /classes/GroupReduction.php:156
2348
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 6181
ORDER BY f.position ASC
0.497 ms 5 Yes /classes/Product.php:6021
3137
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 10303)
0.497 ms 1 /classes/Product.php:3860
3431
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2632) AND (b.`id_shop` = 1) LIMIT 1
0.497 ms 1 /src/Adapter/EntityMapper.php:71
1538
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3455 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3455 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.496 ms 0 /classes/Cart.php:1430
1238
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2649) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.495 ms 1 /classes/stock/StockAvailable.php:453
3151
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 10304) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.495 ms 1 /classes/stock/StockAvailable.php:453
801
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.495 ms 1 /classes/Product.php:5659
2774
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 9055
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.495 ms 0 /classes/SpecificPrice.php:259
2957
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 9693) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.495 ms 1 /classes/stock/StockAvailable.php:453
3547
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3265
0.495 ms 1 /classes/Product.php:2902
456
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2651
ORDER BY f.position ASC
0.494 ms 5 Yes /classes/Product.php:6021
1199
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2648 LIMIT 1
0.494 ms 10 /classes/SpecificPrice.php:435
1379
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3326)
0.494 ms 1 /classes/Product.php:3860
1419
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3099
AND image_shop.`cover` = 1 LIMIT 1
0.494 ms 1 /classes/Product.php:3570
1694
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3751
AND image_shop.`cover` = 1 LIMIT 1
0.494 ms 1 /classes/Product.php:3570
3528
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2655
ORDER BY `position`
0.494 ms 1 Yes /classes/Product.php:3545
321
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 5135) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.493 ms 1 /classes/stock/StockAvailable.php:453
426
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2660 LIMIT 1
0.493 ms 10 /classes/SpecificPrice.php:435
3364
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2795
0.493 ms 1 /classes/Product.php:2902
864
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2789 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2789 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.492 ms 0 /classes/Cart.php:1430
2513
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 6500
ORDER BY f.position ASC
0.492 ms 5 Yes /classes/Product.php:6021
3927
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 9055
ORDER BY `position`
0.492 ms 1 Yes /classes/Product.php:3545
4387
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3752) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.492 ms 1 Yes Yes /classes/Product.php:4524
569
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 182 LIMIT 1
0.491 ms 1 /classes/Product.php:5659
1096
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3459 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3459 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.491 ms 0 /classes/Cart.php:1430
1706
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.491 ms 1 /classes/Product.php:5659
3598
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3556
0.491 ms 1 /classes/Product.php:2902
3243
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5140
ORDER BY `position`
0.490 ms 1 Yes /classes/Product.php:3545
1194
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2656) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.490 ms 1 /classes/stock/StockAvailable.php:453
3118
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 10299) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.490 ms 1 /classes/stock/StockAvailable.php:453
3732
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4966
ORDER BY `position`
0.490 ms 1 Yes /classes/Product.php:3545
3759
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5591
ORDER BY `position`
0.490 ms 2 Yes /classes/Product.php:3545
4002
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 10072
0.490 ms 1 /classes/Product.php:2902
4121
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 70) LIMIT 1
0.490 ms 1 /src/Adapter/EntityMapper.php:71
959
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2633)
0.489 ms 1 /classes/Product.php:3860
152
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 7539)
0.488 ms 1 /classes/Product.php:3860
395
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3587)
0.488 ms 1 /classes/Product.php:3860
1622
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3689)
0.488 ms 1 /classes/Product.php:3860
1627
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3689
ORDER BY f.position ASC
0.488 ms 5 Yes /classes/Product.php:6021
3931
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 9321
0.488 ms 1 /classes/Product.php:2902
4062
SELECT SQL_NO_CACHE `id_module` FROM `hgt78_module` WHERE `name` = "iqitsearch" LIMIT 1
0.488 ms 1 /classes/module/Module.php:2664
2498
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 6499 AND id_shop=1 LIMIT 1
0.488 ms 1 /classes/Product.php:6876
4150
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 37 AND `id_shop` = 1
0.488 ms 6 /src/Adapter/EntityMapper.php:79
667
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2764
ORDER BY f.position ASC
0.487 ms 5 Yes /classes/Product.php:6021
4111
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 45) LIMIT 1
0.487 ms 1 /src/Adapter/EntityMapper.php:71
1473
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2490
ORDER BY f.position ASC
0.487 ms 5 Yes /classes/Product.php:6021
3758
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 5591) AND (b.`id_shop` = 1) LIMIT 1
0.487 ms 1 /src/Adapter/EntityMapper.php:71
4192
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 82) LIMIT 1
0.487 ms 1 /src/Adapter/EntityMapper.php:71
1243
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2658 LIMIT 1
0.486 ms 10 /classes/SpecificPrice.php:435
3513
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2658
ORDER BY `position`
0.486 ms 1 Yes /classes/Product.php:3545
4079
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 165) LIMIT 1
0.486 ms 1 /src/Adapter/EntityMapper.php:71
799
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2794
ORDER BY f.position ASC
0.486 ms 5 Yes /classes/Product.php:6021
1114
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3458)
0.486 ms 1 /classes/Product.php:3860
1669
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3748) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.486 ms 1 /classes/stock/StockAvailable.php:453
2174
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 5971 LIMIT 1
0.486 ms 10 /classes/SpecificPrice.php:435
3461
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2628) AND (b.`id_shop` = 1) LIMIT 1
0.486 ms 1 /src/Adapter/EntityMapper.php:71
4240
SELECT SQL_NO_CACHE `width`, `height`
FROM hgt78_image_type
WHERE `name` = 'home_default' LIMIT 1
0.485 ms 1 /classes/Image.php:563
2489
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 6195) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.485 ms 1 /classes/stock/StockAvailable.php:453
3246
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5139
ORDER BY `position`
0.485 ms 1 Yes /classes/Product.php:3545
3464
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3477) AND (b.`id_shop` = 1) LIMIT 1
0.485 ms 1 /src/Adapter/EntityMapper.php:71
3629
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3749) AND (b.`id_shop` = 1) LIMIT 1
0.485 ms 1 /src/Adapter/EntityMapper.php:71
4392
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3757) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.485 ms 1 Yes Yes /classes/Product.php:4524
871
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2790)
0.484 ms 1 /classes/Product.php:3860
3837
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 6191
ORDER BY `position`
0.484 ms 1 Yes /classes/Product.php:3545
4241
SELECT SQL_NO_CACHE *
FROM `hgt78_currency` c
INNER JOIN hgt78_currency_shop currency_shop
ON (currency_shop.id_currency = c.id_currency AND currency_shop.id_shop = 1)
WHERE c.`deleted` = 0 AND c.`active` = 1 ORDER BY `iso_code` ASC
0.484 ms 2 Yes /classes/Currency.php:694
518
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2773)
0.483 ms 1 /classes/Product.php:3860
1187
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.483 ms 1 /classes/Product.php:5659
2508
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 6500)
0.483 ms 1 /classes/Product.php:3860
340
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 5133)
0.483 ms 1 /classes/Product.php:3860
805
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2793)
0.483 ms 1 /classes/Product.php:3860
2312
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 6178 AND `id_group` = 1 LIMIT 1
0.483 ms 0 /classes/GroupReduction.php:156
157
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 7539
ORDER BY f.position ASC
0.482 ms 5 Yes /classes/Product.php:6021
490
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2768
ORDER BY f.position ASC
0.482 ms 5 Yes /classes/Product.php:6021
3447
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2637
ORDER BY `position`
0.482 ms 1 Yes /classes/Product.php:3545
3621
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3746
ORDER BY `position`
0.482 ms 1 Yes /classes/Product.php:3545
611
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2691
ORDER BY f.position ASC
0.482 ms 5 Yes /classes/Product.php:6021
1151
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2626 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2626 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.481 ms 0 /classes/Cart.php:1430
3210
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 7540
ORDER BY `position`
0.481 ms 1 Yes /classes/Product.php:3545
4103
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 334) LIMIT 1
0.481 ms 1 /src/Adapter/EntityMapper.php:71
1042
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2630
ORDER BY f.position ASC
0.481 ms 5 Yes /classes/Product.php:6021
2178
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 5971 AND id_shop=1 LIMIT 1
0.481 ms 1 /classes/Product.php:6876
2984
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 9697 LIMIT 1
0.481 ms 11 /classes/SpecificPrice.php:435
3252
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5137
ORDER BY `position`
0.481 ms 1 Yes /classes/Product.php:3545
1173
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2640 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2640 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.480 ms 0 /classes/Cart.php:1430
1986
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4942 LIMIT 1
0.480 ms 10 /classes/SpecificPrice.php:435
1368
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3265)
0.480 ms 1 /classes/Product.php:3860
3213
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 7539
ORDER BY `position`
0.480 ms 1 Yes /classes/Product.php:3545
1013
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2638
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.479 ms 0 /classes/SpecificPrice.php:259
753
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2800) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.479 ms 1 /classes/stock/StockAvailable.php:453
534
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2774
ORDER BY f.position ASC
0.478 ms 5 Yes /classes/Product.php:6021
1791
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3764) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.478 ms 1 /classes/stock/StockAvailable.php:453
2126
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 5093
ORDER BY f.position ASC
0.478 ms 5 Yes /classes/Product.php:6021
2340
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 6181 LIMIT 1
0.478 ms 10 /classes/SpecificPrice.php:435
3708
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4934
ORDER BY `position`
0.478 ms 1 Yes /classes/Product.php:3545
4140
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 51 AND `id_shop` = 1
0.478 ms 6 /src/Adapter/EntityMapper.php:79
1032
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2630
AND image_shop.`cover` = 1 LIMIT 1
0.477 ms 1 /classes/Product.php:3570
1303
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2655 AND `id_group` = 1 LIMIT 1
0.477 ms 0 /classes/GroupReduction.php:156
3467
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2620) AND (b.`id_shop` = 1) LIMIT 1
0.476 ms 1 /src/Adapter/EntityMapper.php:71
764
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3178) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.476 ms 1 /classes/stock/StockAvailable.php:453
1837
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3775
ORDER BY f.position ASC
0.476 ms 5 Yes /classes/Product.php:6021
3865
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 7940
0.476 ms 1 /classes/Product.php:2902
4014
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 10298
0.476 ms 1 /classes/Product.php:2902
4391
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3756) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.476 ms 1 Yes Yes /classes/Product.php:4524
545
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2775
ORDER BY f.position ASC
0.475 ms 5 Yes /classes/Product.php:6021
1611
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3639)
0.475 ms 1 /classes/Product.php:3860
3391
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2794
0.475 ms 1 /classes/Product.php:2902
4134
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 35 AND `id_shop` = 1
0.475 ms 6 /src/Adapter/EntityMapper.php:79
1098
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2622
AND image_shop.`cover` = 1 LIMIT 1
0.474 ms 1 /classes/Product.php:3570
1340
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3252
ORDER BY f.position ASC
0.474 ms 5 Yes /classes/Product.php:6021
3207
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 7541
ORDER BY `position`
0.474 ms 1 Yes /classes/Product.php:3545
622
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2692
ORDER BY f.position ASC
0.473 ms 5 Yes /classes/Product.php:6021
692
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2779 LIMIT 1
0.473 ms 10 /classes/SpecificPrice.php:435
1652
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3747 LIMIT 1
0.473 ms 10 /classes/SpecificPrice.php:435
2783
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `hgt78_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 173 LIMIT 1
0.473 ms 1 /classes/Category.php:1378
3382
SELECT SQL_NO_CACHE `name`, `alias` FROM `hgt78_hook_alias`
0.473 ms 88 /classes/Hook.php:290
3770
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 5973) AND (b.`id_shop` = 1) LIMIT 1
0.473 ms 1 /src/Adapter/EntityMapper.php:71
4544
INSERT INTO `hgt78_connections_source` (`id_connections`, `http_referer`, `request_uri`, `keywords`, `date_add`) VALUES ('105512', '', 'www.encens.fr/2-accueil?productListView=grid&q=Cat%C3%A9gories-Luminaires%2FDisponibilit%C3%A9-En+stock&resultsPerPage=99999', '', '2025-05-01 16:19:15')
0.473 ms 1 /classes/ObjectModel.php:622
644
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2771
ORDER BY f.position ASC
0.472 ms 5 Yes /classes/Product.php:6021
1088
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.472 ms 1 /classes/Product.php:5659
1202
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2648)
0.472 ms 1 /classes/Product.php:3860
3776
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 6107) AND (b.`id_shop` = 1) LIMIT 1
0.472 ms 1 /src/Adapter/EntityMapper.php:71
3969
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 9691
0.472 ms 1 /classes/Product.php:2902
556
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2776
ORDER BY f.position ASC
0.471 ms 5 Yes /classes/Product.php:6021
3258
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5135
ORDER BY `position`
0.471 ms 1 Yes /classes/Product.php:3545
3535
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2645
0.471 ms 1 /classes/Product.php:2902
843
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3179
ORDER BY f.position ASC
0.471 ms 5 Yes /classes/Product.php:6021
1993
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4942 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4942 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.471 ms 0 /classes/Cart.php:1430
3783
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 6129
ORDER BY `position`
0.470 ms 1 Yes /classes/Product.php:3545
4044
SELECT SQL_NO_CACHE c.id_elementor FROM hgt78_iqit_elementor_category c WHERE c.id_category = 2 LIMIT 1
0.470 ms 1 /modules/iqitelementor/src/IqitElementorCategory.php:87
935
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2631
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.470 ms 0 /classes/SpecificPrice.php:259
1297
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.470 ms 1 /classes/Product.php:5659
4085
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 38) LIMIT 1
0.470 ms 1 /src/Adapter/EntityMapper.php:71
3324
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2766
ORDER BY `position`
0.469 ms 1 Yes /classes/Product.php:3545
828
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2781 AND id_shop=1 LIMIT 1
0.469 ms 1 /classes/Product.php:6876
1229
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3456
ORDER BY f.position ASC
0.469 ms 5 Yes /classes/Product.php:6021
1567
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3558)
0.469 ms 1 /classes/Product.php:3860
3095
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 10297 AND `id_group` = 1 LIMIT 1
0.469 ms 0 /classes/GroupReduction.php:156
3111
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.469 ms 1 /classes/Product.php:5659
2026
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4963 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4963 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.468 ms 0 /classes/Cart.php:1430
3459
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2629
ORDER BY `position`
0.468 ms 1 Yes /classes/Product.php:3545
3486
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2626
ORDER BY `position`
0.468 ms 1 Yes /classes/Product.php:3545
1688
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3750)
0.468 ms 1 /classes/Product.php:3860
3726
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4964
ORDER BY `position`
0.467 ms 1 Yes /classes/Product.php:3545
841
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3179) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.466 ms 1 /classes/stock/StockAvailable.php:453
3204
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 7542
ORDER BY `position`
0.466 ms 1 Yes /classes/Product.php:3545
3369
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2798
ORDER BY `position`
0.466 ms 1 Yes /classes/Product.php:3545
4543
SELECT SQL_NO_CACHE `id_guest`
FROM `hgt78_connections`
WHERE `id_guest` = 194740
AND `date_add` > '2025-05-01 15:49:00'
AND id_shop IN (1) 
ORDER BY `date_add` DESC LIMIT 1
0.466 ms 1 Yes /classes/Connection.php:168
1363
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3265
AND image_shop.`cover` = 1 LIMIT 1
0.465 ms 1 /classes/Product.php:3570
3765
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5971
ORDER BY `position`
0.464 ms 1 Yes /classes/Product.php:3545
3755
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 5590) AND (b.`id_shop` = 1) LIMIT 1
0.464 ms 1 /src/Adapter/EntityMapper.php:71
2028
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4964
AND image_shop.`cover` = 1 LIMIT 1
0.463 ms 1 /classes/Product.php:3570
3438
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2634
ORDER BY `position`
0.463 ms 1 Yes /classes/Product.php:3545
230
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 5143)
0.462 ms 1 /classes/Product.php:3860
1677
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3749)
0.462 ms 1 /classes/Product.php:3860
2155
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 5591)
0.462 ms 1 /classes/Product.php:3860
2561
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 320 LIMIT 1
0.462 ms 1 /classes/Product.php:5659
2649
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 8393
AND image_shop.`cover` = 1 LIMIT 1
0.462 ms 1 /classes/Product.php:3570
3779
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 6108) AND (b.`id_shop` = 1) LIMIT 1
0.462 ms 1 /src/Adapter/EntityMapper.php:71
1641
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3746 LIMIT 1
0.461 ms 10 /classes/SpecificPrice.php:435
1111
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3458 LIMIT 1
0.460 ms 10 /classes/SpecificPrice.php:435
2078
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 5283 AND id_shop=1 LIMIT 1
0.460 ms 1 /classes/Product.php:6876
3222
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5147
ORDER BY `position`
0.460 ms 1 Yes /classes/Product.php:3545
227
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 5143 LIMIT 1
0.460 ms 10 /classes/SpecificPrice.php:435
990
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2636 LIMIT 1
0.460 ms 10 /classes/SpecificPrice.php:435
1351
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3254
ORDER BY f.position ASC
0.460 ms 5 Yes /classes/Product.php:6021
3481
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2624
0.460 ms 1 /classes/Product.php:2902
1550
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3484
ORDER BY f.position ASC
0.459 ms 5 Yes /classes/Product.php:6021
73
SELECT SQL_NO_CACHE `name`
FROM `hgt78_hook`
WHERE `id_hook` = 746 LIMIT 1
0.459 ms 1 /classes/Hook.php:247
1277
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2642
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.459 ms 0 /classes/SpecificPrice.php:259
2303
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 6177 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 6177 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.459 ms 0 /classes/Cart.php:1430
4157
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 74) LIMIT 1
0.459 ms 1 /src/Adapter/EntityMapper.php:71
252
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 5141)
0.458 ms 1 /classes/Product.php:3860
1081
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2620)
0.458 ms 1 /classes/Product.php:3860
3711
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4935
ORDER BY `position`
0.458 ms 1 Yes /classes/Product.php:3545
4089
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 62) LIMIT 1
0.458 ms 1 /src/Adapter/EntityMapper.php:71
656
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2738
ORDER BY f.position ASC
0.457 ms 5 Yes /classes/Product.php:6021
689
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2778
ORDER BY f.position ASC
0.457 ms 5 Yes /classes/Product.php:6021
2537
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 7938
ORDER BY f.position ASC
0.457 ms 5 Yes /classes/Product.php:6021
1501
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2650)
0.457 ms 1 /classes/Product.php:3860
3825
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 6186
ORDER BY `position`
0.457 ms 1 Yes /classes/Product.php:3545
704
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2795
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.456 ms 0 /classes/SpecificPrice.php:259
2554
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 7941)
0.456 ms 1 /classes/Product.php:3860
3562
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3099
0.456 ms 1 /classes/Product.php:2902
3852
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 6499
ORDER BY `position`
0.456 ms 2 Yes /classes/Product.php:3545
2976
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 9695)
0.455 ms 1 /classes/Product.php:3860
3082
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 10111)
0.455 ms 1 /classes/Product.php:3860
4168
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 261 AND `id_shop` = 1
0.455 ms 6 /src/Adapter/EntityMapper.php:79
3226
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 5146
0.454 ms 1 /classes/Product.php:2902
866
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2790
AND image_shop.`cover` = 1 LIMIT 1
0.454 ms 1 /classes/Product.php:3570
3714
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4942
ORDER BY `position`
0.454 ms 1 Yes /classes/Product.php:3545
1431
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.453 ms 1 /classes/Product.php:5659
130
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 7541)
0.452 ms 1 /classes/Product.php:3860
1328
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2645
ORDER BY f.position ASC
0.452 ms 5 Yes /classes/Product.php:6021
3228
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5145
ORDER BY `position`
0.452 ms 1 Yes /classes/Product.php:3545
3789
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 6173
ORDER BY `position`
0.452 ms 1 Yes /classes/Product.php:3545
4056
SELECT SQL_NO_CACHE `id_module` FROM `hgt78_module` WHERE `name` = "ps_currencyselector" LIMIT 1
0.452 ms 1 /classes/module/Module.php:2664
714
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2797 LIMIT 1
0.451 ms 10 /classes/SpecificPrice.php:435
2053
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4966
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.451 ms 0 /classes/SpecificPrice.php:259
3735
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5282
ORDER BY `position`
0.451 ms 1 Yes /classes/Product.php:3545
3747
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5296
ORDER BY `position`
0.451 ms 2 Yes /classes/Product.php:3545
3753
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5589
ORDER BY `position`
0.451 ms 2 Yes /classes/Product.php:3545
2368
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 6183) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.451 ms 1 /classes/stock/StockAvailable.php:453
2379
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 6184) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.451 ms 1 /classes/stock/StockAvailable.php:453
2382
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 6185
AND image_shop.`cover` = 1 LIMIT 1
0.451 ms 1 /classes/Product.php:3570
3419
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3177) AND (b.`id_shop` = 1) LIMIT 1
0.451 ms 1 /src/Adapter/EntityMapper.php:71
729
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2798 AND id_shop=1 LIMIT 1
0.450 ms 1 /classes/Product.php:6876
2169
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 5970) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.450 ms 1 /classes/stock/StockAvailable.php:453
2361
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 182 LIMIT 1
0.450 ms 1 /classes/Product.php:5659
4075
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 55) LIMIT 1
0.450 ms 1 /src/Adapter/EntityMapper.php:71
1275
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.449 ms 1 /classes/Product.php:5659
4155
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 73) LIMIT 1
0.449 ms 1 /src/Adapter/EntityMapper.php:71
1254
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2647 LIMIT 1
0.449 ms 10 /classes/SpecificPrice.php:435
97
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE `to` BETWEEN '2025-05-01 00:00:00' AND '2025-05-01 23:59:59' LIMIT 1
0.448 ms 1 /classes/SpecificPrice.php:381
1451
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3132
ORDER BY f.position ASC
0.448 ms 5 Yes /classes/Product.php:6021
3810
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 6181
ORDER BY `position`
0.448 ms 1 Yes /classes/Product.php:3545
1443
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3132 LIMIT 1
0.447 ms 10 /classes/SpecificPrice.php:435
2356
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 6182 AND `id_group` = 1 LIMIT 1
0.447 ms 0 /classes/GroupReduction.php:156
3018
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 184 LIMIT 1
0.447 ms 1 /classes/Product.php:5659
3219
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5148
ORDER BY `position`
0.447 ms 1 Yes /classes/Product.php:3545
3270
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3743
ORDER BY `position`
0.447 ms 1 Yes /classes/Product.php:3545
3274
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3741
0.447 ms 1 /classes/Product.php:2902
4054
SELECT SQL_NO_CACHE `id_module` FROM `hgt78_module` WHERE `name` = "ps_languageselector" LIMIT 1
0.447 ms 1 /classes/module/Module.php:2664
1418
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2892
ORDER BY f.position ASC
0.445 ms 5 Yes /classes/Product.php:6021
1789
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3764 AND id_shop=1 LIMIT 1
0.445 ms 1 /classes/Product.php:6876
3792
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 6174
ORDER BY `position`
0.445 ms 1 Yes /classes/Product.php:3545
368
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3741
AND image_shop.`cover` = 1 LIMIT 1
0.443 ms 1 /classes/Product.php:3570
2587
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 7944)
0.443 ms 1 /classes/Product.php:3860
849
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2788)
0.442 ms 1 /classes/Product.php:3860
2723
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 8418) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.442 ms 1 /classes/stock/StockAvailable.php:453
3216
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 6727
ORDER BY `position`
0.442 ms 1 Yes /classes/Product.php:3545
33
SELECT SQL_NO_CACHE *
FROM `hgt78_currency_lang`
WHERE `id_currency` = 1
0.441 ms 6 /src/Adapter/EntityMapper.php:79
2760
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 190 LIMIT 1
0.441 ms 1 /classes/Product.php:5659
800
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2793
AND image_shop.`cover` = 1 LIMIT 1
0.440 ms 1 /classes/Product.php:3570
2409
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 6187)
0.440 ms 1 /classes/Product.php:3860
1252
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2647
AND image_shop.`cover` = 1 LIMIT 1
0.440 ms 1 /classes/Product.php:3570
362
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3743)
0.439 ms 1 /classes/Product.php:3860
893
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2792)
0.439 ms 1 /classes/Product.php:3860
1293
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2643) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.439 ms 1 /classes/stock/StockAvailable.php:453
136
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 7540
AND image_shop.`cover` = 1 LIMIT 1
0.438 ms 1 /classes/Product.php:3570
1292
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2643 AND `id_group` = 1 LIMIT 1
0.438 ms 0 /classes/GroupReduction.php:156
3265
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 5133
0.438 ms 1 /classes/Product.php:2902
3489
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2627
ORDER BY `position`
0.438 ms 1 Yes /classes/Product.php:3545
3630
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3749
ORDER BY `position`
0.438 ms 1 Yes /classes/Product.php:3545
4076
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 55 AND `id_shop` = 1
0.438 ms 6 /src/Adapter/EntityMapper.php:79
315
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 5135 LIMIT 1
0.437 ms 10 /classes/SpecificPrice.php:435
406
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2893)
0.437 ms 1 /classes/Product.php:3860
932
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2631
AND image_shop.`cover` = 1 LIMIT 1
0.437 ms 1 /classes/Product.php:3570
2199
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 5973)
0.437 ms 1 /classes/Product.php:3860
3144
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 184 LIMIT 1
0.437 ms 1 /classes/Product.php:5659
3619
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3745
0.437 ms 1 /classes/Product.php:2902
3919
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 8420
0.437 ms 1 /classes/Product.php:2902
4527
SELECT SQL_NO_CACHE c.*, cl.*  FROM `hgt78_category` c
LEFT JOIN `hgt78_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`nleft` <= 2 AND c.`nright` >= 577 AND c.`nleft` >= 1 AND c.`nright` <= 590 ORDER BY `nleft` DESC
0.437 ms 2 /classes/Category.php:1600
543
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2775) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.436 ms 1 /classes/stock/StockAvailable.php:453
3225
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5146
ORDER BY `position`
0.436 ms 1 Yes /classes/Product.php:3545
3729
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4965
ORDER BY `position`
0.436 ms 1 Yes /classes/Product.php:3545
3946
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 9596
0.436 ms 1 /classes/Product.php:2902
4228
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 217) LIMIT 1
0.436 ms 1 /src/Adapter/EntityMapper.php:71
1196
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2656
ORDER BY f.position ASC
0.436 ms 5 Yes /classes/Product.php:6021
2102
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 5293) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.436 ms 1 /classes/stock/StockAvailable.php:453
633
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2693
ORDER BY f.position ASC
0.435 ms 5 Yes /classes/Product.php:6021
833
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3179
AND image_shop.`cover` = 1 LIMIT 1
0.435 ms 1 /classes/Product.php:3570
302
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 5136
AND image_shop.`cover` = 1 LIMIT 1
0.434 ms 1 /classes/Product.php:3570
329
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 5134)
0.434 ms 1 /classes/Product.php:3860
365
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3743) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.434 ms 1 /classes/stock/StockAvailable.php:453
3795
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 6176
ORDER BY `position`
0.434 ms 1 Yes /classes/Product.php:3545
214
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 5144
AND image_shop.`cover` = 1 LIMIT 1
0.434 ms 1 /classes/Product.php:3570
3444
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2636
ORDER BY `position`
0.434 ms 1 Yes /classes/Product.php:3545
2511
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 6500) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.433 ms 1 /classes/stock/StockAvailable.php:453
440
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2652)
0.433 ms 1 /classes/Product.php:3860
982
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2782)
0.433 ms 1 /classes/Product.php:3860
1186
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2656
AND image_shop.`cover` = 1 LIMIT 1
0.433 ms 1 /classes/Product.php:3570
2660
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 8395
AND image_shop.`cover` = 1 LIMIT 1
0.433 ms 1 /classes/Product.php:3570
1695
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.432 ms 1 /classes/Product.php:5659
3473
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2622) AND (b.`id_shop` = 1) LIMIT 1
0.432 ms 1 /src/Adapter/EntityMapper.php:71
559
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2766 LIMIT 1
0.431 ms 10 /classes/SpecificPrice.php:435
3355
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2777
0.431 ms 1 /classes/Product.php:2902
3411
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2790
ORDER BY `position`
0.431 ms 1 Yes /classes/Product.php:3545
3717
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4943
ORDER BY `position`
0.431 ms 1 Yes /classes/Product.php:3545
3934
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 9323
0.431 ms 1 /classes/Product.php:2902
105
SELECT SQL_NO_CACHE *
FROM `hgt78_tax` a
WHERE (a.`id_tax` = 1) LIMIT 1
0.430 ms 1 /src/Adapter/EntityMapper.php:71
200
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 5146) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.430 ms 1 /classes/stock/StockAvailable.php:453
3361
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2779
0.430 ms 1 /classes/Product.php:2902
3477
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3458
ORDER BY `position`
0.430 ms 1 Yes /classes/Product.php:3545
2044
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4965)
0.430 ms 1 /classes/Product.php:3860
3045
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 10071
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.430 ms 1 /classes/SpecificPrice.php:259
485
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2768)
0.429 ms 1 /classes/Product.php:3860
1441
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3132
AND image_shop.`cover` = 1 LIMIT 1
0.429 ms 1 /classes/Product.php:3570
2589
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 7944 AND `id_group` = 1 LIMIT 1
0.429 ms 0 /classes/GroupReduction.php:156
2718
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 8418
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.429 ms 0 /classes/SpecificPrice.php:259
4058
SELECT SQL_NO_CACHE *
FROM `hgt78_currency` c
INNER JOIN hgt78_currency_shop currency_shop
ON (currency_shop.id_currency = c.id_currency AND currency_shop.id_shop = 1)
WHERE c.`deleted` = 0 AND c.`active` = 1 ORDER BY `iso_code` ASC
0.429 ms 2 Yes /classes/Currency.php:694
1407
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2818
ORDER BY f.position ASC
0.428 ms 5 Yes /classes/Product.php:6021
1341
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3254
AND image_shop.`cover` = 1 LIMIT 1
0.428 ms 1 /classes/Product.php:3570
1656
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3747 AND id_shop=1 LIMIT 1
0.428 ms 1 /classes/Product.php:6876
3771
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5973
ORDER BY `position`
0.428 ms 1 Yes /classes/Product.php:3545
404
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2893
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.427 ms 0 /classes/SpecificPrice.php:259
813
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2780 LIMIT 1
0.427 ms 10 /classes/SpecificPrice.php:435
1408
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2892
AND image_shop.`cover` = 1 LIMIT 1
0.427 ms 1 /classes/Product.php:3570
1573
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3584
AND image_shop.`cover` = 1 LIMIT 1
0.427 ms 1 /classes/Product.php:3570
3425
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2635) AND (b.`id_shop` = 1) LIMIT 1
0.427 ms 1 /src/Adapter/EntityMapper.php:71
3777
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 6107
ORDER BY `position`
0.427 ms 1 Yes /classes/Product.php:3545
1793
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3764
ORDER BY f.position ASC
0.426 ms 5 Yes /classes/Product.php:6021
2106
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 95 LIMIT 1
0.426 ms 1 /classes/Product.php:5659
2722
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 8418 AND `id_group` = 1 LIMIT 1
0.426 ms 0 /classes/GroupReduction.php:156
3504
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2657
ORDER BY `position`
0.426 ms 1 Yes /classes/Product.php:3545
726
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2798
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.426 ms 0 /classes/SpecificPrice.php:259
3139
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 10303 AND `id_group` = 1 LIMIT 1
0.425 ms 0 /classes/GroupReduction.php:156
3435
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2633
ORDER BY `position`
0.425 ms 1 Yes /classes/Product.php:3545
956
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2633 LIMIT 1
0.425 ms 10 /classes/SpecificPrice.php:435
3501
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2648
ORDER BY `position`
0.425 ms 1 Yes /classes/Product.php:3545
93
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 0 LIMIT 1
0.424 ms 1 /classes/SpecificPrice.php:426
812
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 182 LIMIT 1
0.424 ms 1 /classes/Product.php:5659
589
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2661
ORDER BY f.position ASC
0.424 ms 5 Yes /classes/Product.php:6021
3768
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5972
ORDER BY `position`
0.423 ms 1 Yes /classes/Product.php:3545
756
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3178
AND image_shop.`cover` = 1 LIMIT 1
0.423 ms 1 /classes/Product.php:3570
4071
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 40) AND (b.`id_shop` = 1) LIMIT 1
0.423 ms 1 /src/Adapter/EntityMapper.php:71
197
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 5146)
0.422 ms 1 /classes/Product.php:3860
1523
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3454)
0.422 ms 1 /classes/Product.php:3860
507
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2770)
0.421 ms 1 /classes/Product.php:3860
709
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2795) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.421 ms 1 /classes/stock/StockAvailable.php:453
1164
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2640
AND image_shop.`cover` = 1 LIMIT 1
0.421 ms 1 /classes/Product.php:3570
4181
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 35) AND (b.`id_shop` = 1) LIMIT 1
0.421 ms 1 /src/Adapter/EntityMapper.php:71
944
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.421 ms 1 /classes/Product.php:5659
1142
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2626
AND image_shop.`cover` = 1 LIMIT 1
0.420 ms 1 /classes/Product.php:3570
1446
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3132)
0.420 ms 1 /classes/Product.php:3860
219
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 5144)
0.419 ms 1 /classes/Product.php:3860
2088
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 5284)
0.419 ms 1 /classes/Product.php:3860
1180
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2641)
0.419 ms 1 /classes/Product.php:3860
2938
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 9692
AND image_shop.`cover` = 1 LIMIT 1
0.419 ms 1 /classes/Product.php:3570
778
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3176
AND image_shop.`cover` = 1 LIMIT 1
0.418 ms 1 /classes/Product.php:3570
2590
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 7944) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.418 ms 1 /classes/stock/StockAvailable.php:453
3429
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2631
ORDER BY `position`
0.417 ms 1 Yes /classes/Product.php:3545
2983
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 334 LIMIT 1
0.416 ms 1 /classes/Product.php:5659
3448
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2637
0.416 ms 1 /classes/Product.php:2902
3829
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 6187
0.416 ms 1 /classes/Product.php:2902
2079
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 5283 AND `id_group` = 1 LIMIT 1
0.415 ms 0 /classes/GroupReduction.php:156
2611
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 7946 AND `id_group` = 1 LIMIT 1
0.415 ms 0 /classes/GroupReduction.php:156
2327
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 6180
AND image_shop.`cover` = 1 LIMIT 1
0.415 ms 1 /classes/Product.php:3570
2863
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 9598
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.414 ms 0 /classes/SpecificPrice.php:259
739
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2799)
0.413 ms 1 /classes/Product.php:3860
763
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3178 AND `id_group` = 1 LIMIT 1
0.413 ms 0 /classes/GroupReduction.php:156
1211
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2657
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.413 ms 0 /classes/SpecificPrice.php:259
1507
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2654
AND image_shop.`cover` = 1 LIMIT 1
0.413 ms 1 /classes/Product.php:3570
1600
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3586)
0.413 ms 1 /classes/Product.php:3860
2417
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 6188 LIMIT 1
0.413 ms 10 /classes/SpecificPrice.php:435
2812
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 9324 AND `id_group` = 1 LIMIT 1
0.413 ms 0 /classes/GroupReduction.php:156
247
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 5141
AND image_shop.`cover` = 1 LIMIT 1
0.412 ms 1 /classes/Product.php:3570
3035
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 10070)
0.412 ms 1 /classes/Product.php:3860
3417
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2792
ORDER BY `position`
0.412 ms 1 Yes /classes/Product.php:3545
3532
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2644
0.411 ms 1 /classes/Product.php:2902
1436
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3107 AND id_shop=1 LIMIT 1
0.411 ms 1 /classes/Product.php:6876
2879
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 9687 AND `id_group` = 1 LIMIT 1
0.410 ms 0 /classes/GroupReduction.php:156
2821
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 9325)
0.410 ms 1 /classes/Product.php:3860
2057
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4966 AND `id_group` = 1 LIMIT 1
0.409 ms 0 /classes/GroupReduction.php:156
4063
SELECT SQL_NO_CACHE `id_module` FROM `hgt78_module_shop` WHERE `id_module` = 95 AND `id_shop` = 1 LIMIT 1
0.409 ms 1 /classes/module/Module.php:2137
2657
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 8393) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.409 ms 1 /classes/stock/StockAvailable.php:453
3756
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5590
ORDER BY `position`
0.409 ms 2 Yes /classes/Product.php:3545
496
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2769)
0.408 ms 1 /classes/Product.php:3860
535
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2775
AND image_shop.`cover` = 1 LIMIT 1
0.408 ms 1 /classes/Product.php:3570
2107
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 5296 LIMIT 1
0.408 ms 10 /classes/SpecificPrice.php:435
457
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2623
AND image_shop.`cover` = 1 LIMIT 1
0.407 ms 1 /classes/Product.php:3570
2493
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 95 LIMIT 1
0.407 ms 1 /classes/Product.php:5659
274
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 5139)
0.407 ms 1 /classes/Product.php:3860
551
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2776)
0.407 ms 1 /classes/Product.php:3860
562
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2766)
0.407 ms 1 /classes/Product.php:3860
1410
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2892 LIMIT 1
0.407 ms 10 /classes/SpecificPrice.php:435
3154
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 10305
AND image_shop.`cover` = 1 LIMIT 1
0.407 ms 1 /classes/Product.php:3570
3682
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3804
0.407 ms 1 /classes/Product.php:2902
3849
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 6195
ORDER BY `position`
0.407 ms 1 Yes /classes/Product.php:3545
135
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 7541
ORDER BY f.position ASC
0.406 ms 5 Yes /classes/Product.php:6021
573
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2765)
0.406 ms 1 /classes/Product.php:3860
634
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2771
AND image_shop.`cover` = 1 LIMIT 1
0.406 ms 2 /classes/Product.php:3570
1485
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2733
AND image_shop.`cover` = 1 LIMIT 1
0.406 ms 1 /classes/Product.php:3570
1452
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3327
AND image_shop.`cover` = 1 LIMIT 1
0.406 ms 2 /classes/Product.php:3570
106
SELECT SQL_NO_CACHE *
FROM `hgt78_tax_lang`
WHERE `id_tax` = 1
0.405 ms 6 /src/Adapter/EntityMapper.php:79
1241
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2658
AND image_shop.`cover` = 1 LIMIT 1
0.405 ms 1 /classes/Product.php:3570
2819
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 9325
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.405 ms 0 /classes/SpecificPrice.php:259
1854
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3777)
0.405 ms 1 /classes/Product.php:3860
1633
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3745)
0.404 ms 1 /classes/Product.php:3860
2689
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 8397 AND `id_group` = 1 LIMIT 1
0.404 ms 0 /classes/GroupReduction.php:156
1821
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3771)
0.403 ms 1 /classes/Product.php:3860
3441
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2782
ORDER BY `position`
0.403 ms 1 Yes /classes/Product.php:3545
172
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 5148 LIMIT 1
0.403 ms 10 /classes/SpecificPrice.php:435
889
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.403 ms 1 /classes/Product.php:5659
1425
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3099 AND id_shop=1 LIMIT 1
0.403 ms 1 /classes/Product.php:6876
3723
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4963
ORDER BY `position`
0.403 ms 1 Yes /classes/Product.php:3545
51
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 40) AND (b.`id_shop` = 1) LIMIT 1
0.402 ms 1 /src/Adapter/EntityMapper.php:71
1029
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2639) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.402 ms 1 /classes/stock/StockAvailable.php:453
1490
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2733)
0.402 ms 1 /classes/Product.php:3860
1651
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.402 ms 1 /classes/Product.php:5659
3986
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 10067
ORDER BY `position`
0.402 ms 1 Yes /classes/Product.php:3545
1833
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3775 AND id_shop=1 LIMIT 1
0.401 ms 1 /classes/Product.php:6876
1843
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3776)
0.401 ms 1 /classes/Product.php:3860
2732
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 8419 AND id_shop=1 LIMIT 1
0.401 ms 1 /classes/Product.php:6876
3484
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2625
0.401 ms 1 /classes/Product.php:2902
4095
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 175) LIMIT 1
0.401 ms 1 /src/Adapter/EntityMapper.php:71
148
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 185 LIMIT 1
0.400 ms 1 /classes/Product.php:5659
2755
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 8975 AND `id_group` = 1 LIMIT 1
0.400 ms 0 /classes/GroupReduction.php:156
2992
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 9697
ORDER BY f.position ASC
0.400 ms 5 Yes /classes/Product.php:6021
3916
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 8419
0.400 ms 1 /classes/Product.php:2902
2639
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 174 LIMIT 1
0.399 ms 1 /classes/Product.php:5659
310
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 5136) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.399 ms 1 /classes/stock/StockAvailable.php:453
915
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2659)
0.398 ms 1 /classes/Product.php:3860
524
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2774
AND image_shop.`cover` = 1 LIMIT 1
0.398 ms 1 /classes/Product.php:3570
1771
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3763
AND image_shop.`cover` = 1 LIMIT 1
0.398 ms 1 /classes/Product.php:3570
1026
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2639)
0.397 ms 1 /classes/Product.php:3860
2431
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 6189)
0.397 ms 1 /classes/Product.php:3860
3052
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 10071
ORDER BY f.position ASC
0.397 ms 5 Yes /classes/Product.php:6021
4105
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 34) AND (b.`id_shop` = 1) LIMIT 1
0.397 ms 1 /src/Adapter/EntityMapper.php:71
30
SELECT SQL_NO_CACHE *
FROM `hgt78_currency` a
LEFT JOIN `hgt78_currency_lang` `b` ON a.`id_currency` = b.`id_currency` AND b.`id_lang` = 1
LEFT JOIN `hgt78_currency_shop` `c` ON a.`id_currency` = c.`id_currency` AND c.`id_shop` = 1
WHERE (a.`id_currency` = 2) LIMIT 1
0.396 ms 1 /src/Adapter/EntityMapper.php:71
1832
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3775)
0.396 ms 1 /classes/Product.php:3860
2139
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 5590
AND image_shop.`cover` = 1 LIMIT 1
0.396 ms 2 /classes/Product.php:3570
2239
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 6129
AND image_shop.`cover` = 1 LIMIT 1
0.396 ms 1 /classes/Product.php:3570
474
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2767)
0.395 ms 1 /classes/Product.php:3860
662
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2764)
0.395 ms 1 /classes/Product.php:3860
1235
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2649)
0.395 ms 1 /classes/Product.php:3860
2918
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 9690 LIMIT 1
0.395 ms 11 /classes/SpecificPrice.php:435
1286
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.395 ms 1 /classes/Product.php:5659
95
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE `id_product` != 0 LIMIT 1
0.394 ms 22288 /classes/SpecificPrice.php:297
1941
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4575
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.394 ms 0 /classes/SpecificPrice.php:259
2510
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 6500 AND `id_group` = 1 LIMIT 1
0.394 ms 0 /classes/GroupReduction.php:156
1639
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3746
AND image_shop.`cover` = 1 LIMIT 1
0.392 ms 1 /classes/Product.php:3570
2206
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `hgt78_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 178 LIMIT 1
0.392 ms 1 /classes/Category.php:1378
43
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 35) AND (b.`id_shop` = 1) LIMIT 1
0.391 ms 1 /src/Adapter/EntityMapper.php:71
2056
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4966 AND id_shop=1 LIMIT 1
0.391 ms 1 /classes/Product.php:6876
3720
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4944
ORDER BY `position`
0.390 ms 1 Yes /classes/Product.php:3545
4059
SELECT SQL_NO_CACHE *
FROM `hgt78_currency` a
LEFT JOIN `hgt78_currency_shop` `c` ON a.`id_currency` = c.`id_currency` AND c.`id_shop` = 1
WHERE (a.`id_currency` = 2) LIMIT 1
0.390 ms 1 /src/Adapter/EntityMapper.php:71
4098
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 185 AND `id_shop` = 1
0.390 ms 6 /src/Adapter/EntityMapper.php:79
2163
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 5970 LIMIT 1
0.390 ms 10 /classes/SpecificPrice.php:435
2437
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 6191
AND image_shop.`cover` = 1 LIMIT 1
0.389 ms 1 /classes/Product.php:3570
3804
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 6179
ORDER BY `position`
0.389 ms 1 Yes /classes/Product.php:3545
1282
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2642) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.389 ms 1 /classes/stock/StockAvailable.php:453
446
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2651
AND image_shop.`cover` = 1 LIMIT 1
0.388 ms 1 /classes/Product.php:3570
2772
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 176 LIMIT 1
0.388 ms 1 /classes/Product.php:5659
3011
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 10068)
0.388 ms 1 /classes/Product.php:3860
513
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2773
AND image_shop.`cover` = 1 LIMIT 1
0.387 ms 1 /classes/Product.php:3570
540
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2775)
0.387 ms 1 /classes/Product.php:3860
623
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2693
AND image_shop.`cover` = 1 LIMIT 1
0.387 ms 1 /classes/Product.php:3570
1040
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2630) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.387 ms 1 /classes/stock/StockAvailable.php:453
1371
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3265) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.387 ms 1 /classes/stock/StockAvailable.php:453
2913
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 9689) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.387 ms 1 /classes/stock/StockAvailable.php:453
2941
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 9692
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.387 ms 0 /classes/SpecificPrice.php:259
169
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 5148
AND image_shop.`cover` = 1 LIMIT 1
0.386 ms 1 /classes/Product.php:3570
226
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 309 LIMIT 1
0.386 ms 1 /classes/Product.php:5659
584
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2661)
0.386 ms 1 /classes/Product.php:3860
750
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2800)
0.386 ms 1 /classes/Product.php:3860
918
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2659) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.386 ms 1 /classes/stock/StockAvailable.php:453
3465
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3477
ORDER BY `position`
0.386 ms 1 Yes /classes/Product.php:3545
4066
SELECT SQL_NO_CACHE `id_module` FROM `hgt78_module` WHERE `name` = "iqitmegamenu" LIMIT 1
0.386 ms 1 /classes/module/Module.php:2664
58
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 19) AND (b.`id_shop` = 1) LIMIT 1
0.385 ms 1 /src/Adapter/EntityMapper.php:71
532
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2774) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.385 ms 1 /classes/stock/StockAvailable.php:453
827
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2781)
0.385 ms 1 /classes/Product.php:3860
772
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3075)
0.384 ms 1 /classes/Product.php:3860
2448
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 6192
AND image_shop.`cover` = 1 LIMIT 1
0.384 ms 1 /classes/Product.php:3570
698
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2779) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.384 ms 1 /classes/stock/StockAvailable.php:453
976
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2782
AND image_shop.`cover` = 1 LIMIT 1
0.384 ms 1 /classes/Product.php:3570
819
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2780) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.383 ms 1 /classes/stock/StockAvailable.php:453
2930
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 9691
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.383 ms 0 /classes/SpecificPrice.php:259
742
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2799) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.382 ms 1 /classes/stock/StockAvailable.php:453
1465
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2490 LIMIT 1
0.382 ms 10 /classes/SpecificPrice.php:435
254
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 5141 AND `id_group` = 1 LIMIT 1
0.382 ms 0 /classes/GroupReduction.php:156
462
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2623)
0.382 ms 1 /classes/Product.php:3860
681
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2778 LIMIT 1
0.382 ms 10 /classes/SpecificPrice.php:435
3556
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2818
0.382 ms 1 /classes/Product.php:2902
4070
SELECT SQL_NO_CACHE c.id_cms, cl.link_rewrite, cl.meta_title
FROM hgt78_cms c
LEFT JOIN hgt78_cms_lang cl ON (c.id_cms = cl.id_cms AND cl.id_lang = 1 AND cl.id_shop = 1)
INNER JOIN hgt78_cms_shop cms_shop
ON (cms_shop.id_cms = c.id_cms AND cms_shop.id_shop = 1)
WHERE 1
AND c.id_cms IN (17) AND c.`active` = 1 GROUP BY c.id_cms
ORDER BY c.`position`
0.382 ms 1 Yes /classes/CMS.php:151
4195
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 96 AND `id_shop` = 1
0.382 ms 6 /src/Adapter/EntityMapper.php:79
263
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 5140)
0.381 ms 1 /classes/Product.php:3860
1539
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3455
ORDER BY f.position ASC
0.381 ms 5 Yes /classes/Product.php:6021
2055
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4966)
0.381 ms 1 /classes/Product.php:3860
2466
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 6193 AND `id_group` = 1 LIMIT 1
0.381 ms 0 /classes/GroupReduction.php:156
2728
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 8419 LIMIT 1
0.380 ms 10 /classes/SpecificPrice.php:435
2685
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 8397
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.379 ms 0 /classes/SpecificPrice.php:259
3184
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 12551 AND `id_group` = 1 LIMIT 1
0.379 ms 0 /classes/GroupReduction.php:156
888
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2792
AND image_shop.`cover` = 1 LIMIT 1
0.379 ms 1 /classes/Product.php:3570
1616
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3639
ORDER BY f.position ASC
0.378 ms 5 Yes /classes/Product.php:6021
2785
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 9321 LIMIT 1
0.378 ms 10 /classes/SpecificPrice.php:435
352
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4902 AND id_shop=1 LIMIT 1
0.377 ms 1 /classes/Product.php:6876
794
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2794)
0.377 ms 1 /classes/Product.php:3860
1405
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2818) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.377 ms 1 /classes/stock/StockAvailable.php:453
1799
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3765)
0.377 ms 1 /classes/Product.php:3860
1010
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2638
AND image_shop.`cover` = 1 LIMIT 1
0.376 ms 1 /classes/Product.php:3570
2069
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 5282) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.376 ms 1 /classes/stock/StockAvailable.php:453
2083
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 5284
AND image_shop.`cover` = 1 LIMIT 1
0.376 ms 2 /classes/Product.php:3570
4146
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 195 AND `id_shop` = 1
0.376 ms 6 /src/Adapter/EntityMapper.php:79
4538
SELECT SQL_NO_CACHE *
FROM `hgt78_cms` a
LEFT JOIN `hgt78_cms_lang` `b` ON a.`id_cms` = b.`id_cms` AND b.`id_lang` = 1
LEFT JOIN `hgt78_cms_shop` `c` ON a.`id_cms` = c.`id_cms` AND c.`id_shop` = 1
WHERE (a.`id_cms` = 2) AND (b.`id_shop` = 1) LIMIT 1
0.376 ms 1 /src/Adapter/EntityMapper.php:71
0
SELECT SQL_NO_CACHE s.id_shop, CONCAT(su.physical_uri, su.virtual_uri) AS uri, su.domain, su.main
FROM hgt78_shop_url su
LEFT JOIN hgt78_shop s ON (s.id_shop = su.id_shop)
WHERE (su.domain = 'www.encens.fr' OR su.domain_ssl = 'www.encens.fr')
AND s.active = 1
AND s.deleted = 0
ORDER BY LENGTH(CONCAT(su.physical_uri, su.virtual_uri)) DESC
0.375 ms 1 Yes /classes/shop/Shop.php:1364
1402
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2818)
0.375 ms 1 /classes/Product.php:3860
2701
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 8401) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.375 ms 1 /classes/stock/StockAvailable.php:453
2771
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `hgt78_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 176 LIMIT 1
0.375 ms 1 /classes/Category.php:1378
3987
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 10067
0.375 ms 1 /classes/Product.php:2902
61
SELECT SQL_NO_CACHE `id_module` FROM `hgt78_module` WHERE `name` = "ps_legalcompliance" LIMIT 1
0.374 ms 0 /classes/module/Module.php:2664
2388
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 6185 AND id_shop=1 LIMIT 1
0.374 ms 1 /classes/Product.php:6876
2538
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 7940
AND image_shop.`cover` = 1 LIMIT 1
0.374 ms 1 /classes/Product.php:3570
3038
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 10070) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.374 ms 1 /classes/stock/StockAvailable.php:453
863
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2789) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.374 ms 1 /classes/stock/StockAvailable.php:453
2840
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 9596 LIMIT 1
0.374 ms 10 /classes/SpecificPrice.php:435
557
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2766
AND image_shop.`cover` = 1 LIMIT 1
0.373 ms 1 /classes/Product.php:3570
3157
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 10305
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.373 ms 1 /classes/SpecificPrice.php:259
78
SELECT SQL_NO_CACHE * FROM hgt78_carrier_group WHERE id_carrier = 282 LIMIT 1
0.373 ms 8 /modules/colissimo_simplicite/colissimo_simplicite.php:1388
673
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2777)
0.373 ms 1 /classes/Product.php:3860
3432
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2632
ORDER BY `position`
0.373 ms 1 Yes /classes/Product.php:3545
1883
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3806
AND image_shop.`cover` = 1 LIMIT 1
0.372 ms 1 /classes/Product.php:3570
4232
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 39) AND (b.`id_shop` = 1) LIMIT 1
0.371 ms 1 /src/Adapter/EntityMapper.php:71
290
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 5138
ORDER BY f.position ASC
0.371 ms 5 Yes /classes/Product.php:6021
451
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2651)
0.371 ms 1 /classes/Product.php:3860
546
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2776
AND image_shop.`cover` = 1 LIMIT 1
0.371 ms 1 /classes/Product.php:3570
684
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2778)
0.371 ms 1 /classes/Product.php:3860
950
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2632 AND `id_group` = 1 LIMIT 1
0.370 ms 0 /classes/GroupReduction.php:156
1274
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2642
AND image_shop.`cover` = 1 LIMIT 1
0.370 ms 1 /classes/Product.php:3570
1496
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2650
AND image_shop.`cover` = 1 LIMIT 1
0.370 ms 1 /classes/Product.php:3570
2615
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 7769
AND image_shop.`cover` = 1 LIMIT 1
0.370 ms 1 /classes/Product.php:3570
3352
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2764
0.370 ms 1 /classes/Product.php:2902
1572
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3558
ORDER BY f.position ASC
0.368 ms 5 Yes /classes/Product.php:6021
2999
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 10067)
0.368 ms 1 /classes/Product.php:3860
3176
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 12552
ORDER BY f.position ASC
0.368 ms 5 Yes /classes/Product.php:6021
606
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2691)
0.368 ms 1 /classes/Product.php:3860
390
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3587
AND image_shop.`cover` = 1 LIMIT 1
0.367 ms 1 /classes/Product.php:3570
1777
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3763)
0.367 ms 1 /classes/Product.php:3860
3148
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 10304)
0.367 ms 1 /classes/Product.php:3860
131
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 7541 AND id_shop=1 LIMIT 1
0.367 ms 1 /classes/Product.php:6876
717
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2797)
0.367 ms 1 /classes/Product.php:3860
2875
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 9687
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.367 ms 0 /classes/SpecificPrice.php:259
3379
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3178
0.366 ms 1 /classes/Product.php:2902
4064
SELECT SQL_NO_CACHE SUM(`quantity`)
FROM `hgt78_cart_product`
WHERE `id_cart` = 0 LIMIT 1
0.366 ms 1 /classes/Cart.php:1303
1000
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.365 ms 1 /classes/Product.php:5659
1447
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3132 AND id_shop=1 LIMIT 1
0.365 ms 1 /classes/Product.php:6876
2540
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 7940 LIMIT 1
0.365 ms 10 /classes/SpecificPrice.php:435
3026
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 10069) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.365 ms 1 /classes/stock/StockAvailable.php:453
4094
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 172 AND `id_shop` = 1
0.365 ms 6 /src/Adapter/EntityMapper.php:79
4096
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 175 AND `id_shop` = 1
0.365 ms 6 /src/Adapter/EntityMapper.php:79
4542
SELECT SQL_NO_CACHE psgdprl.message FROM `hgt78_psgdpr_consent` psgdpr
LEFT JOIN hgt78_psgdpr_consent_lang psgdprl ON (psgdpr.id_gdpr_consent = psgdprl.id_gdpr_consent)
WHERE psgdpr.id_module = 22 AND psgdprl.id_lang =1 LIMIT 1
0.365 ms 12 /modules/psgdpr/classes/GDPRConsent.php:111
435
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2652
AND image_shop.`cover` = 1 LIMIT 1
0.364 ms 1 /classes/Product.php:3570
1219
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3456
AND image_shop.`cover` = 1 LIMIT 1
0.364 ms 1 /classes/Product.php:3570
2705
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 184 LIMIT 1
0.364 ms 1 /classes/Product.php:5659
3126
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 10302)
0.364 ms 1 /classes/Product.php:3860
3334
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2690
0.364 ms 1 /classes/Product.php:2902
601
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2691
AND image_shop.`cover` = 1 LIMIT 1
0.364 ms 1 /classes/Product.php:3570
1117
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3458) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.363 ms 1 /classes/stock/StockAvailable.php:453
3487
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2626
0.363 ms 1 /classes/Product.php:2902
4178
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 266 AND `id_shop` = 1
0.363 ms 6 /src/Adapter/EntityMapper.php:79
617
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2692)
0.363 ms 1 /classes/Product.php:3860
3786
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 6172
ORDER BY `position`
0.362 ms 1 Yes /classes/Product.php:3545
1075
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3477
ORDER BY f.position ASC
0.362 ms 5 Yes /classes/Product.php:6021
1338
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3252) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.362 ms 1 /classes/stock/StockAvailable.php:453
2563
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 7942
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.362 ms 0 /classes/SpecificPrice.php:259
3376
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2800
0.362 ms 1 /classes/Product.php:2902
35
SELECT SQL_NO_CACHE *
FROM `hgt78_group` a
LEFT JOIN `hgt78_group_shop` `c` ON a.`id_group` = c.`id_group` AND c.`id_shop` = 1
WHERE (a.`id_group` = 1) LIMIT 1
0.361 ms 1 /src/Adapter/EntityMapper.php:71
2141
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 5590 LIMIT 1
0.361 ms 10 /classes/SpecificPrice.php:435
301
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 5137
ORDER BY f.position ASC
0.361 ms 5 Yes /classes/Product.php:6021
379
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3740
AND image_shop.`cover` = 1 LIMIT 1
0.361 ms 1 /classes/Product.php:3570
480
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2768
AND image_shop.`cover` = 1 LIMIT 1
0.361 ms 1 /classes/Product.php:3570
912
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2659 LIMIT 1
0.361 ms 10 /classes/SpecificPrice.php:435
2600
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 7945 AND `id_group` = 1 LIMIT 1
0.361 ms 0 /classes/GroupReduction.php:156
4219
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 36 AND `id_shop` = 1
0.361 ms 6 /src/Adapter/EntityMapper.php:79
502
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2770
AND image_shop.`cover` = 1 LIMIT 1
0.360 ms 1 /classes/Product.php:3570
1165
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.360 ms 1 /classes/Product.php:5659
1463
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2490
AND image_shop.`cover` = 1 LIMIT 1
0.360 ms 1 /classes/Product.php:3570
1827
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3775
AND image_shop.`cover` = 1 LIMIT 1
0.360 ms 2 /classes/Product.php:3570
3774
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 6047
ORDER BY `position`
0.360 ms 1 Yes /classes/Product.php:3545
249
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 5141 LIMIT 1
0.359 ms 10 /classes/SpecificPrice.php:435
554
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2776) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.359 ms 1 /classes/stock/StockAvailable.php:453
1232
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2649 LIMIT 1
0.359 ms 10 /classes/SpecificPrice.php:435
2183
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 5972
AND image_shop.`cover` = 1 LIMIT 1
0.359 ms 1 /classes/Product.php:3570
2662
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 8395 LIMIT 1
0.359 ms 10 /classes/SpecificPrice.php:435
628
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2693)
0.359 ms 1 /classes/Product.php:3860
846
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2788 LIMIT 1
0.358 ms 10 /classes/SpecificPrice.php:435
2557
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 7941) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.358 ms 1 /classes/stock/StockAvailable.php:453
4221
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 42 AND `id_shop` = 1
0.358 ms 6 /src/Adapter/EntityMapper.php:79
334
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 5134
ORDER BY f.position ASC
0.358 ms 5 Yes /classes/Product.php:6021
510
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2770) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.358 ms 1 /classes/stock/StockAvailable.php:453
761
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3178)
0.357 ms 1 /classes/Product.php:3860
3624
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3747
ORDER BY `position`
0.357 ms 1 Yes /classes/Product.php:3545
3780
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 6108
ORDER BY `position`
0.357 ms 1 Yes /classes/Product.php:3545
995
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2636 AND `id_group` = 1 LIMIT 1
0.357 ms 0 /classes/GroupReduction.php:156
1866
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3804)
0.357 ms 1 /classes/Product.php:3860
2894
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 9688
AND image_shop.`cover` = 1 LIMIT 1
0.356 ms 1 /classes/Product.php:3570
565
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2766) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.356 ms 1 /classes/stock/StockAvailable.php:453
702
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.356 ms 1 /classes/Product.php:5659
3450
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2638
ORDER BY `position`
0.356 ms 1 Yes /classes/Product.php:3545
1152
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2626
ORDER BY f.position ASC
0.355 ms 5 Yes /classes/Product.php:6021
1231
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.355 ms 1 /classes/Product.php:5659
1385
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3155
AND image_shop.`cover` = 1 LIMIT 1
0.355 ms 1 /classes/Product.php:3570
1518
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3454
AND image_shop.`cover` = 1 LIMIT 1
0.355 ms 1 /classes/Product.php:3570
1595
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3586
AND image_shop.`cover` = 1 LIMIT 1
0.355 ms 1 /classes/Product.php:3570
3514
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2658
0.355 ms 1 /classes/Product.php:2902
468
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2767
AND image_shop.`cover` = 1 LIMIT 1
0.354 ms 1 /classes/Product.php:3570
1343
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3254 LIMIT 1
0.354 ms 10 /classes/SpecificPrice.php:435
4093
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 172) LIMIT 1
0.354 ms 1 /src/Adapter/EntityMapper.php:71
4201
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 197 AND `id_shop` = 1
0.354 ms 6 /src/Adapter/EntityMapper.php:79
884
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2791 AND `id_group` = 1 LIMIT 1
0.353 ms 0 /classes/GroupReduction.php:156
1749
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3756
AND image_shop.`cover` = 1 LIMIT 1
0.353 ms 1 /classes/Product.php:3570
2514
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 6501
AND image_shop.`cover` = 1 LIMIT 1
0.353 ms 1 /classes/Product.php:3570
1584
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3585
AND image_shop.`cover` = 1 LIMIT 1
0.352 ms 1 /classes/Product.php:3570
657
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2764
AND image_shop.`cover` = 1 LIMIT 1
0.352 ms 1 /classes/Product.php:3570
723
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2798
AND image_shop.`cover` = 1 LIMIT 1
0.352 ms 1 /classes/Product.php:3570
1393
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3155) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.352 ms 1 /classes/stock/StockAvailable.php:453
2671
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 8396
AND image_shop.`cover` = 1 LIMIT 1
0.351 ms 1 /classes/Product.php:3570
71
SELECT SQL_NO_CACHE *
FROM `hgt78_shop_url` a0
0.351 ms 1 /classes/PrestaShopCollection.php:383
579
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2661
AND image_shop.`cover` = 1 LIMIT 1
0.351 ms 1 /classes/Product.php:3570
706
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2795)
0.351 ms 1 /classes/Product.php:3860
1357
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3264)
0.351 ms 1 /classes/Product.php:3860
1413
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2892)
0.351 ms 1 /classes/Product.php:3860
1638
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3745
ORDER BY f.position ASC
0.351 ms 5 Yes /classes/Product.php:6021
3679
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3777
0.351 ms 1 /classes/Product.php:2902
4218
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 36) LIMIT 1
0.351 ms 1 /src/Adapter/EntityMapper.php:71
651
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2738)
0.350 ms 1 /classes/Product.php:3860
811
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2780
AND image_shop.`cover` = 1 LIMIT 1
0.350 ms 1 /classes/Product.php:3570
2084
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 95 LIMIT 1
0.350 ms 1 /classes/Product.php:5659
3474
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2622
ORDER BY `position`
0.350 ms 1 Yes /classes/Product.php:3545
4172
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 263 AND `id_shop` = 1
0.350 ms 6 /src/Adapter/EntityMapper.php:79
639
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2771)
0.349 ms 1 /classes/Product.php:3860
745
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2800
AND image_shop.`cover` = 1 LIMIT 1
0.349 ms 1 /classes/Product.php:3570
934
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2631 LIMIT 1
0.349 ms 10 /classes/SpecificPrice.php:435
1416
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2892) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.348 ms 1 /classes/stock/StockAvailable.php:453
1437
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3107 AND `id_group` = 1 LIMIT 1
0.348 ms 0 /classes/GroupReduction.php:156
2039
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4965
AND image_shop.`cover` = 1 LIMIT 1
0.348 ms 1 /classes/Product.php:3570
4183
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 49 AND `id_shop` = 1
0.348 ms 6 /src/Adapter/EntityMapper.php:79
1528
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3454
ORDER BY f.position ASC
0.348 ms 5 Yes /classes/Product.php:6021
2607
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 7946
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.348 ms 1 /classes/SpecificPrice.php:259
3420
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3177
ORDER BY `position`
0.348 ms 1 Yes /classes/Product.php:3545
3526
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2643
0.347 ms 1 /classes/Product.php:2902
341
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 5133 AND id_shop=1 LIMIT 1
0.347 ms 1 /classes/Product.php:6876
736
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2799 LIMIT 1
0.347 ms 10 /classes/SpecificPrice.php:435
1540
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3484
AND image_shop.`cover` = 1 LIMIT 1
0.347 ms 1 /classes/Product.php:3570
2250
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 6172
AND image_shop.`cover` = 1 LIMIT 1
0.347 ms 1 /classes/Product.php:3570
4061
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 2) AND (b.`id_shop` = 1) LIMIT 1
0.347 ms 1 /src/Adapter/EntityMapper.php:71
12
SELECT SQL_NO_CACHE COUNT(DISTINCT l.id_lang) FROM `hgt78_lang` l
JOIN hgt78_lang_shop lang_shop ON (lang_shop.id_lang = l.id_lang AND lang_shop.id_shop = 1)
WHERE l.`active` = 1 LIMIT 1
0.346 ms 6 /classes/Language.php:1216
335
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 5133
AND image_shop.`cover` = 1 LIMIT 1
0.346 ms 1 /classes/Product.php:3570
781
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3176
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.346 ms 0 /classes/SpecificPrice.php:259
789
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2794
AND image_shop.`cover` = 1 LIMIT 1
0.346 ms 1 /classes/Product.php:3570
1360
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3264) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.346 ms 1 /classes/stock/StockAvailable.php:453
3423
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2659
ORDER BY `position`
0.346 ms 1 Yes /classes/Product.php:3545
220
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 5144 AND id_shop=1 LIMIT 1
0.345 ms 1 /classes/Product.php:6876
255
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 5141) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.345 ms 1 /classes/stock/StockAvailable.php:453
867
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 182 LIMIT 1
0.345 ms 1 /classes/Product.php:5659
1333
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3252
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.345 ms 0 /classes/SpecificPrice.php:259
1512
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2654)
0.345 ms 1 /classes/Product.php:3860
3468
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2620
ORDER BY `position`
0.345 ms 1 Yes /classes/Product.php:3545
120
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 7542 AND id_shop=1 LIMIT 1
0.344 ms 1 /classes/Product.php:6876
357
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3743
AND image_shop.`cover` = 1 LIMIT 1
0.344 ms 1 /classes/Product.php:3570
767
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3075
AND image_shop.`cover` = 1 LIMIT 1
0.344 ms 1 /classes/Product.php:3570
3033
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 10070
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.344 ms 1 /classes/SpecificPrice.php:259
291
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 5137
AND image_shop.`cover` = 1 LIMIT 1
0.344 ms 1 /classes/Product.php:3570
1100
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2622 LIMIT 1
0.344 ms 10 /classes/SpecificPrice.php:435
1927
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4574
AND image_shop.`cover` = 1 LIMIT 1
0.343 ms 1 /classes/Product.php:3570
3426
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2635
ORDER BY `position`
0.343 ms 1 Yes /classes/Product.php:3545
1849
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3777
AND image_shop.`cover` = 1 LIMIT 1
0.342 ms 2 /classes/Product.php:3570
2744
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 8420 AND `id_group` = 1 LIMIT 1
0.342 ms 0 /classes/GroupReduction.php:156
2952
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 9693
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.342 ms 0 /classes/SpecificPrice.php:259
3601
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3558
0.342 ms 1 /classes/Product.php:2902
1916
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4256
AND image_shop.`cover` = 1 LIMIT 1
0.342 ms 1 /classes/Product.php:3570
2833
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 9535 AND id_shop=1 LIMIT 1
0.342 ms 1 /classes/Product.php:6876
1353
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.341 ms 1 /classes/Product.php:5659
1606
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3639
AND image_shop.`cover` = 1 LIMIT 1
0.341 ms 1 /classes/Product.php:3570
4162
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 162 AND `id_shop` = 1
0.341 ms 6 /src/Adapter/EntityMapper.php:79
138
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 7540 LIMIT 1
0.341 ms 10 /classes/SpecificPrice.php:435
376
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3741) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.341 ms 1 /classes/stock/StockAvailable.php:453
2782
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 9321
AND image_shop.`cover` = 1 LIMIT 1
0.341 ms 1 /classes/Product.php:3570
68
SELECT SQL_NO_CACHE id_required_field, object_name, field_name
FROM hgt78_required_field
0.340 ms 2 /classes/ObjectModel.php:1592
590
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2690
AND image_shop.`cover` = 1 LIMIT 1
0.340 ms 1 /classes/Product.php:3570
883
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2791 AND id_shop=1 LIMIT 1
0.340 ms 1 /classes/Product.php:6876
1729
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3754 LIMIT 1
0.340 ms 10 /classes/SpecificPrice.php:435
4142
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 56 AND `id_shop` = 1
0.340 ms 6 /src/Adapter/EntityMapper.php:79
4182
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 49) LIMIT 1
0.340 ms 1 /src/Adapter/EntityMapper.php:71
202
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 5146
ORDER BY f.position ASC
0.339 ms 5 Yes /classes/Product.php:6021
1227
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3456) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.339 ms 1 /classes/stock/StockAvailable.php:453
3032
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 10070 LIMIT 1
0.339 ms 10 /classes/SpecificPrice.php:435
4214
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 191) LIMIT 1
0.339 ms 1 /src/Adapter/EntityMapper.php:71
712
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2797
AND image_shop.`cover` = 1 LIMIT 1
0.338 ms 1 /classes/Product.php:3570
807
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2793 AND `id_group` = 1 LIMIT 1
0.338 ms 0 /classes/GroupReduction.php:156
1403
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2818 AND id_shop=1 LIMIT 1
0.338 ms 1 /classes/Product.php:6876
2119
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 5093
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.338 ms 0 /classes/SpecificPrice.php:259
1718
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3753 LIMIT 1
0.337 ms 10 /classes/SpecificPrice.php:435
81
SELECT SQL_NO_CACHE `id_category`
FROM `hgt78_category_shop`
WHERE `id_category` = 2
AND `id_shop` = 1 LIMIT 1
0.337 ms 1 /classes/Category.php:2450
4081
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 169) LIMIT 1
0.337 ms 1 /src/Adapter/EntityMapper.php:71
398
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3587) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.336 ms 1 /classes/stock/StockAvailable.php:453
2315
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 6178
ORDER BY f.position ASC
0.336 ms 5 Yes /classes/Product.php:6021
72
SELECT SQL_NO_CACHE *
FROM `hgt78_shop_url` a0
0.335 ms 1 /classes/PrestaShopCollection.php:383
159
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 185 LIMIT 1
0.335 ms 1 /classes/Product.php:5659
222
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 5144) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.335 ms 1 /classes/stock/StockAvailable.php:453
491
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2769
AND image_shop.`cover` = 1 LIMIT 1
0.335 ms 1 /classes/Product.php:3570
3471
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3459
ORDER BY `position`
0.335 ms 1 Yes /classes/Product.php:3545
4104
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 334 AND `id_shop` = 1
0.335 ms 6 /src/Adapter/EntityMapper.php:79
122
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 7542) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.334 ms 1 /classes/stock/StockAvailable.php:453
1092
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3459)
0.334 ms 1 /classes/Product.php:3860
4207
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 61 AND `id_shop` = 1
0.334 ms 6 /src/Adapter/EntityMapper.php:79
806
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2793 AND id_shop=1 LIMIT 1
0.333 ms 1 /classes/Product.php:6876
1188
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2656 LIMIT 1
0.333 ms 10 /classes/SpecificPrice.php:435
668
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2777
AND image_shop.`cover` = 1 LIMIT 1
0.333 ms 1 /classes/Product.php:3570
2982
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 9697
AND image_shop.`cover` = 1 LIMIT 1
0.333 ms 1 /classes/Product.php:3570
397
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3587 AND `id_group` = 1 LIMIT 1
0.332 ms 0 /classes/GroupReduction.php:156
3972
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 9692
0.332 ms 1 /classes/Product.php:2902
670
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2777 LIMIT 1
0.332 ms 10 /classes/SpecificPrice.php:435
1349
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3254) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.332 ms 1 /classes/stock/StockAvailable.php:453
2544
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 7940 AND id_shop=1 LIMIT 1
0.332 ms 1 /classes/Product.php:6876
2688
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 8397 AND id_shop=1 LIMIT 1
0.332 ms 1 /classes/Product.php:6876
4188
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 65) LIMIT 1
0.332 ms 1 /src/Adapter/EntityMapper.php:71
4230
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 221) LIMIT 1
0.332 ms 1 /src/Adapter/EntityMapper.php:71
679
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2778
AND image_shop.`cover` = 1 LIMIT 1
0.331 ms 1 /classes/Product.php:3570
1189
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2656
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.331 ms 1 /classes/SpecificPrice.php:259
1255
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2647
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.331 ms 0 /classes/SpecificPrice.php:259
1304
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2655) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.331 ms 1 /classes/stock/StockAvailable.php:453
1325
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2645 AND `id_group` = 1 LIMIT 1
0.331 ms 0 /classes/GroupReduction.php:156
1877
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3805)
0.331 ms 1 /classes/Product.php:3860
4163
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 163) LIMIT 1
0.331 ms 1 /src/Adapter/EntityMapper.php:71
4200
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 197) LIMIT 1
0.331 ms 1 /src/Adapter/EntityMapper.php:71
442
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2652 AND `id_group` = 1 LIMIT 1
0.330 ms 0 /classes/GroupReduction.php:156
1265
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2646 LIMIT 1
0.330 ms 10 /classes/SpecificPrice.php:435
1382
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3326) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.330 ms 1 /classes/stock/StockAvailable.php:453
3083
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 10111 AND id_shop=1 LIMIT 1
0.330 ms 1 /classes/Product.php:6876
3523
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2642
0.330 ms 1 /classes/Product.php:2902
248
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 309 LIMIT 1
0.329 ms 1 /classes/Product.php:5659
370
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3741 LIMIT 1
0.329 ms 10 /classes/SpecificPrice.php:435
2426
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 6189
AND image_shop.`cover` = 1 LIMIT 1
0.329 ms 1 /classes/Product.php:3570
2596
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 7945
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.329 ms 0 /classes/SpecificPrice.php:259
2627
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 7773
AND image_shop.`cover` = 1 LIMIT 1
0.329 ms 1 /classes/Product.php:3570
3165
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 12552
AND image_shop.`cover` = 1 LIMIT 1
0.329 ms 1 /classes/Product.php:3570
3337
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2691
0.329 ms 1 /classes/Product.php:2902
4175
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 265) LIMIT 1
0.329 ms 1 /src/Adapter/EntityMapper.php:71
418
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2694 AND id_shop=1 LIMIT 1
0.328 ms 1 /classes/Product.php:6876
1313
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2644 AND id_shop=1 LIMIT 1
0.328 ms 1 /classes/Product.php:6876
2801
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 9323 AND `id_group` = 1 LIMIT 1
0.328 ms 0 /classes/GroupReduction.php:156
2933
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 9691 AND id_shop=1 LIMIT 1
0.328 ms 1 /classes/Product.php:6876
3478
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3458
0.328 ms 1 /classes/Product.php:2902
2404
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 6187
AND image_shop.`cover` = 1 LIMIT 1
0.327 ms 1 /classes/Product.php:3570
4197
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 145 AND `id_shop` = 1
0.327 ms 6 /src/Adapter/EntityMapper.php:79
4229
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 217 AND `id_shop` = 1
0.327 ms 6 /src/Adapter/EntityMapper.php:79
4099
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 186) LIMIT 1
0.326 ms 1 /src/Adapter/EntityMapper.php:71
4125
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 78 AND `id_shop` = 1
0.326 ms 6 /src/Adapter/EntityMapper.php:79
4209
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 66 AND `id_shop` = 1
0.326 ms 6 /src/Adapter/EntityMapper.php:79
1760
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3757
AND image_shop.`cover` = 1 LIMIT 1
0.326 ms 1 /classes/Product.php:3570
2541
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 7940
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.326 ms 0 /classes/SpecificPrice.php:259
4023
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 10303
0.326 ms 1 /classes/Product.php:2902
4160
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 161 AND `id_shop` = 1
0.326 ms 6 /src/Adapter/EntityMapper.php:79
2997
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 10067
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.325 ms 1 /classes/SpecificPrice.php:259
862
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2789 AND `id_group` = 1 LIMIT 1
0.324 ms 0 /classes/GroupReduction.php:156
1046
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2629
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.324 ms 0 /classes/SpecificPrice.php:259
1972
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4935
AND image_shop.`cover` = 1 LIMIT 1
0.324 ms 1 /classes/Product.php:3570
4055
SELECT SQL_NO_CACHE `id_module` FROM `hgt78_module_shop` WHERE `id_module` = 27 AND `id_shop` = 1 LIMIT 1
0.324 ms 1 /classes/module/Module.php:2137
4101
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 190) LIMIT 1
0.324 ms 1 /src/Adapter/EntityMapper.php:71
4198
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 196) LIMIT 1
0.324 ms 1 /src/Adapter/EntityMapper.php:71
1225
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3456 AND id_shop=1 LIMIT 1
0.323 ms 1 /classes/Product.php:6876
1331
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 95 LIMIT 1
0.323 ms 1 /classes/Product.php:5659
2263
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 6173 LIMIT 1
0.323 ms 10 /classes/SpecificPrice.php:435
117
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 7542
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.322 ms 0 /classes/SpecificPrice.php:259
1534
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3455)
0.322 ms 1 /classes/Product.php:3860
2679
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 8396) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.322 ms 1 /classes/stock/StockAvailable.php:453
2765
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 8976 AND id_shop=1 LIMIT 1
0.322 ms 1 /classes/Product.php:6876
62
SELECT SQL_NO_CACHE `id_module` FROM `hgt78_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
0.321 ms 0 /classes/module/Module.php:2137
309
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 5136 AND `id_group` = 1 LIMIT 1
0.321 ms 0 /classes/GroupReduction.php:156
773
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3075 AND id_shop=1 LIMIT 1
0.321 ms 1 /classes/Product.php:6876
4173
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 264) LIMIT 1
0.321 ms 1 /src/Adapter/EntityMapper.php:71
746
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.320 ms 1 /classes/Product.php:5659
808
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2793) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.320 ms 1 /classes/stock/StockAvailable.php:453
4180
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 307 AND `id_shop` = 1
0.320 ms 6 /src/Adapter/EntityMapper.php:79
4190
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 81) LIMIT 1
0.320 ms 1 /src/Adapter/EntityMapper.php:71
360
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3743
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.319 ms 0 /classes/SpecificPrice.php:259
1161
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2627) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.319 ms 1 /classes/stock/StockAvailable.php:453
2520
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 6501)
0.319 ms 1 /classes/Product.php:3860
4073
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 40) LIMIT 1
0.319 ms 1 /src/Adapter/EntityMapper.php:71
4108
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 344) LIMIT 1
0.319 ms 1 /src/Adapter/EntityMapper.php:71
1215
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2657 AND `id_group` = 1 LIMIT 1
0.318 ms 0 /classes/GroupReduction.php:156
1562
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3558
AND image_shop.`cover` = 1 LIMIT 1
0.318 ms 1 /classes/Product.php:3570
4158
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 74 AND `id_shop` = 1
0.318 ms 6 /src/Adapter/EntityMapper.php:79
2247
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 6129) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.318 ms 1 /classes/stock/StockAvailable.php:453
3907
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 8401
0.318 ms 1 /classes/Product.php:2902
3412
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2790
0.317 ms 1 /classes/Product.php:2902
4005
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 10073
0.317 ms 1 /classes/Product.php:2902
4174
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 264 AND `id_shop` = 1
0.317 ms 6 /src/Adapter/EntityMapper.php:79
1690
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3750 AND `id_group` = 1 LIMIT 1
0.316 ms 0 /classes/GroupReduction.php:156
4153
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 53) LIMIT 1
0.316 ms 1 /src/Adapter/EntityMapper.php:71
1614
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3639) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.316 ms 1 /classes/stock/StockAvailable.php:453
1702
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3751) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.316 ms 1 /classes/stock/StockAvailable.php:453
163
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 6727)
0.315 ms 1 /classes/Product.php:3860
4087
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 50) LIMIT 1
0.315 ms 1 /src/Adapter/EntityMapper.php:71
4118
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 54 AND `id_shop` = 1
0.315 ms 6 /src/Adapter/EntityMapper.php:79
4171
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 263) LIMIT 1
0.315 ms 1 /src/Adapter/EntityMapper.php:71
852
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2788) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.314 ms 1 /classes/stock/StockAvailable.php:453
2574
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 7943
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.314 ms 0 /classes/SpecificPrice.php:259
2645
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 8392 AND `id_group` = 1 LIMIT 1
0.314 ms 0 /classes/GroupReduction.php:156
181
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 5147
AND image_shop.`cover` = 1 LIMIT 1
0.313 ms 1 /classes/Product.php:3570
790
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.313 ms 1 /classes/Product.php:5659
1589
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3585)
0.313 ms 1 /classes/Product.php:3860
4086
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 38 AND `id_shop` = 1
0.313 ms 6 /src/Adapter/EntityMapper.php:79
1359
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3264 AND `id_group` = 1 LIMIT 1
0.312 ms 0 /classes/GroupReduction.php:156
4032
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 12552
0.312 ms 1 /classes/Product.php:2902
645
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2738
AND image_shop.`cover` = 1 LIMIT 1
0.312 ms 1 /classes/Product.php:3570
1012
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2638 LIMIT 1
0.312 ms 10 /classes/SpecificPrice.php:435
2504
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 95 LIMIT 1
0.312 ms 1 /classes/Product.php:5659
2535
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 7938) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.312 ms 1 /classes/stock/StockAvailable.php:453
505
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2770
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.311 ms 0 /classes/SpecificPrice.php:259
1034
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2630 LIMIT 1
0.311 ms 10 /classes/SpecificPrice.php:435
1247
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2658 AND id_shop=1 LIMIT 1
0.311 ms 1 /classes/Product.php:6876
1545
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3484)
0.311 ms 1 /classes/Product.php:3860
2652
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 8393
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.311 ms 0 /classes/SpecificPrice.php:259
3000
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 10067 AND id_shop=1 LIMIT 1
0.311 ms 1 /classes/Product.php:6876
3025
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 10069 AND `id_group` = 1 LIMIT 1
0.311 ms 0 /classes/GroupReduction.php:156
3904
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 8397
0.311 ms 1 /classes/Product.php:2902
107
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 7543 AND `id_group` = 1 LIMIT 1
0.311 ms 0 /classes/GroupReduction.php:156
802
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2793 LIMIT 1
0.311 ms 10 /classes/SpecificPrice.php:435
3999
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 10071
0.311 ms 1 /classes/Product.php:2902
4199
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 196 AND `id_shop` = 1
0.311 ms 6 /src/Adapter/EntityMapper.php:79
4215
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 191 AND `id_shop` = 1
0.310 ms 6 /src/Adapter/EntityMapper.php:79
147
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 7539
AND image_shop.`cover` = 1 LIMIT 1
0.310 ms 1 /classes/Product.php:3570
2470
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 6194
AND image_shop.`cover` = 1 LIMIT 1
0.310 ms 1 /classes/Product.php:3570
3877
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 7944
0.310 ms 1 /classes/Product.php:2902
4092
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 72 AND `id_shop` = 1
0.310 ms 6 /src/Adapter/EntityMapper.php:79
158
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 6727
AND image_shop.`cover` = 1 LIMIT 1
0.309 ms 1 /classes/Product.php:3570
2405
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 182 LIMIT 1
0.309 ms 1 /classes/Product.php:5659
4080
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 165 AND `id_shop` = 1
0.309 ms 6 /src/Adapter/EntityMapper.php:79
307
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 5136)
0.308 ms 1 /classes/Product.php:3860
499
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2769) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.308 ms 1 /classes/stock/StockAvailable.php:453
1457
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3327)
0.308 ms 1 /classes/Product.php:3860
2209
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 6047
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.308 ms 0 /classes/SpecificPrice.php:259
178
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 5148) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.307 ms 1 /classes/stock/StockAvailable.php:453
731
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2798) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.307 ms 1 /classes/stock/StockAvailable.php:453
1197
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2648
AND image_shop.`cover` = 1 LIMIT 1
0.307 ms 1 /classes/Product.php:3570
2201
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 5973 AND `id_group` = 1 LIMIT 1
0.307 ms 0 /classes/GroupReduction.php:156
4224
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 76) LIMIT 1
0.307 ms 1 /src/Adapter/EntityMapper.php:71
686
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2778 AND `id_group` = 1 LIMIT 1
0.306 ms 0 /classes/GroupReduction.php:156
4115
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 46 AND `id_shop` = 1
0.306 ms 6 /src/Adapter/EntityMapper.php:79
4227
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 77 AND `id_shop` = 1
0.306 ms 6 /src/Adapter/EntityMapper.php:79
477
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2767) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.306 ms 1 /classes/stock/StockAvailable.php:453
332
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 5134) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.305 ms 1 /classes/stock/StockAvailable.php:453
3811
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 6181
0.305 ms 1 /classes/Product.php:2902
4239
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 84 AND `id_shop` = 1
0.305 ms 6 /src/Adapter/EntityMapper.php:79
4235
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 39 AND `id_shop` = 1
0.305 ms 6 /src/Adapter/EntityMapper.php:79
885
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2791) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.304 ms 1 /classes/stock/StockAvailable.php:453
1147
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2626)
0.304 ms 1 /classes/Product.php:3860
2545
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 7940 AND `id_group` = 1 LIMIT 1
0.304 ms 0 /classes/GroupReduction.php:156
3295
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2651
0.304 ms 1 /classes/Product.php:2902
4041
SELECT SQL_NO_CACHE name, alias FROM `hgt78_hook_alias`
0.304 ms 88 /classes/Hook.php:342
4237
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 83 AND `id_shop` = 1
0.304 ms 6 /src/Adapter/EntityMapper.php:79
244
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 5142) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.303 ms 1 /classes/stock/StockAvailable.php:453
1070
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3477)
0.303 ms 1 /classes/Product.php:3860
1479
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2621)
0.303 ms 1 /classes/Product.php:3860
2401
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 6186) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.303 ms 1 /classes/stock/StockAvailable.php:453
3107
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 10298) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.303 ms 1 /classes/stock/StockAvailable.php:453
4164
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 163 AND `id_shop` = 1
0.303 ms 6 /src/Adapter/EntityMapper.php:79
900
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.303 ms 1 /classes/Product.php:5659
1396
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2818
AND image_shop.`cover` = 1 LIMIT 1
0.303 ms 1 /classes/Product.php:3570
139
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 7540
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.302 ms 0 /classes/SpecificPrice.php:259
297
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 5137 AND id_shop=1 LIMIT 1
0.302 ms 1 /classes/Product.php:6876
855
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2789
AND image_shop.`cover` = 1 LIMIT 1
0.302 ms 1 /classes/Product.php:3570
902
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3177
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.302 ms 0 /classes/SpecificPrice.php:259
4184
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 59) LIMIT 1
0.302 ms 1 /src/Adapter/EntityMapper.php:71
1556
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3556)
0.301 ms 1 /classes/Product.php:3860
4231
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 221 AND `id_shop` = 1
0.301 ms 6 /src/Adapter/EntityMapper.php:79
823
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 182 LIMIT 1
0.300 ms 1 /classes/Product.php:5659
49
SELECT SQL_NO_CACHE * FROM `hgt78_image_type`
0.300 ms 8 /classes/ImageType.php:161
324
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 5134
AND image_shop.`cover` = 1 LIMIT 1
0.300 ms 1 /classes/Product.php:3570
907
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3177) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.300 ms 1 /classes/stock/StockAvailable.php:453
2376
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 6184)
0.300 ms 1 /classes/Product.php:3860
4091
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 72) LIMIT 1
0.300 ms 1 /src/Adapter/EntityMapper.php:71
4166
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 260 AND `id_shop` = 1
0.300 ms 6 /src/Adapter/EntityMapper.php:79
448
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2651 LIMIT 1
0.299 ms 10 /classes/SpecificPrice.php:435
1035
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2630
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.299 ms 0 /classes/SpecificPrice.php:259
1131
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2625
AND image_shop.`cover` = 1 LIMIT 1
0.299 ms 1 /classes/Product.php:3570
1210
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2657 LIMIT 1
0.299 ms 10 /classes/SpecificPrice.php:435
3322
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2776
0.299 ms 1 /classes/Product.php:2902
4138
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 44 AND `id_shop` = 1
0.299 ms 6 /src/Adapter/EntityMapper.php:79
4165
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 260) LIMIT 1
0.299 ms 1 /src/Adapter/EntityMapper.php:71
1015
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2638)
0.298 ms 1 /classes/Product.php:3860
1167
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2640
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.298 ms 0 /classes/SpecificPrice.php:259
1570
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3558) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.298 ms 1 /classes/stock/StockAvailable.php:453
3937
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 9324
0.298 ms 1 /classes/Product.php:2902
408
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2893 AND `id_group` = 1 LIMIT 1
0.297 ms 0 /classes/GroupReduction.php:156
3008
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 10068 LIMIT 1
0.297 ms 10 /classes/SpecificPrice.php:435
3883
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 7946
0.297 ms 1 /classes/Product.php:2902
4077
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 71) LIMIT 1
0.297 ms 1 /src/Adapter/EntityMapper.php:71
612
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2692
AND image_shop.`cover` = 1 LIMIT 1
0.296 ms 1 /classes/Product.php:3570
951
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2632) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.296 ms 1 /classes/stock/StockAvailable.php:453
1818
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3771 LIMIT 1
0.296 ms 10 /classes/SpecificPrice.php:435
32
SELECT SQL_NO_CACHE *
FROM `hgt78_currency` a
LEFT JOIN `hgt78_currency_shop` `c` ON a.`id_currency` = c.`id_currency` AND c.`id_shop` = 1
WHERE (a.`id_currency` = 1) LIMIT 1
0.295 ms 1 /src/Adapter/EntityMapper.php:71
4035
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 12551
0.295 ms 1 /classes/Product.php:2902
296
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 5137)
0.295 ms 1 /classes/Product.php:3860
2699
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 8401 AND id_shop=1 LIMIT 1
0.295 ms 1 /classes/Product.php:6876
3700
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4574
0.295 ms 1 /classes/Product.php:2902
4008
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 10111
0.295 ms 1 /classes/Product.php:2902
2989
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 9697 AND `id_group` = 1 LIMIT 1
0.294 ms 0 /classes/GroupReduction.php:156
1299
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2655
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.294 ms 1 /classes/SpecificPrice.php:259
1504
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2650) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.294 ms 1 /classes/stock/StockAvailable.php:453
1691
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3750) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.294 ms 1 /classes/stock/StockAvailable.php:453
2573
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 7943 LIMIT 1
0.294 ms 10 /classes/SpecificPrice.php:435
3898
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 8395
0.294 ms 1 /classes/Product.php:2902
4050
SELECT SQL_NO_CACHE id_group FROM hgt78_cart_rule_group WHERE id_cart_rule = 0
0.294 ms 1 /classes/CartRule.php:438
4082
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 169 AND `id_shop` = 1
0.294 ms 6 /src/Adapter/EntityMapper.php:79
1329
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3252
AND image_shop.`cover` = 1 LIMIT 1
0.293 ms 1 /classes/Product.php:3570
2123
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 5093 AND `id_group` = 1 LIMIT 1
0.293 ms 0 /classes/GroupReduction.php:156
2299
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 6177)
0.293 ms 1 /classes/Product.php:3860
2672
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 185 LIMIT 1
0.292 ms 1 /classes/Product.php:5659
3325
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2766
0.292 ms 1 /classes/Product.php:2902
3343
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2693
0.292 ms 1 /classes/Product.php:2902
3943
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 9535
0.292 ms 1 /classes/Product.php:2902
1628
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3745
AND image_shop.`cover` = 1 LIMIT 1
0.292 ms 1 /classes/Product.php:3570
186
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 5147)
0.291 ms 1 /classes/Product.php:3860
2656
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 8393 AND `id_group` = 1 LIMIT 1
0.291 ms 0 /classes/GroupReduction.php:156
1037
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2630)
0.291 ms 1 /classes/Product.php:3860
3889
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 7773
0.291 ms 1 /classes/Product.php:2902
890
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2792 LIMIT 1
0.290 ms 10 /classes/SpecificPrice.php:435
63
SELECT SQL_NO_CACHE * FROM `hgt78_image_type` WHERE 1 AND `products` = 1  ORDER BY `width` DESC, `height` DESC, `name`ASC
0.290 ms 8 Yes /classes/ImageType.php:109
3406
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2788
0.290 ms 1 /classes/Product.php:2902
4189
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 65 AND `id_shop` = 1
0.290 ms 6 /src/Adapter/EntityMapper.php:79
3901
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 8396
0.289 ms 1 /classes/Product.php:2902
768
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.289 ms 1 /classes/Product.php:5659
847
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2788
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.289 ms 0 /classes/SpecificPrice.php:259
868
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2790 LIMIT 1
0.289 ms 10 /classes/SpecificPrice.php:435
1355
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3264
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.289 ms 0 /classes/SpecificPrice.php:259
2878
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 9687 AND id_shop=1 LIMIT 1
0.289 ms 1 /classes/Product.php:6876
2956
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 9693 AND `id_group` = 1 LIMIT 1
0.289 ms 0 /classes/GroupReduction.php:156
3304
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2768
0.289 ms 1 /classes/Product.php:2902
203
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 5145
AND image_shop.`cover` = 1 LIMIT 1
0.288 ms 1 /classes/Product.php:3570
2321
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 6179)
0.288 ms 1 /classes/Product.php:3860
2628
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 177 LIMIT 1
0.288 ms 1 /classes/Product.php:5659
4525
SELECT SQL_NO_CACHE c.`nleft`, c.`nright`  FROM `hgt78_category` c
LEFT JOIN `hgt78_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`id_category` = 2 LIMIT 1
0.288 ms 1 /classes/Category.php:1585
894
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2792 AND id_shop=1 LIMIT 1
0.287 ms 1 /classes/Product.php:6876
2972
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 334 LIMIT 1
0.287 ms 1 /classes/Product.php:5659
3403
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3179
0.287 ms 1 /classes/Product.php:2902
3192
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 11001
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.287 ms 1 /classes/SpecificPrice.php:259
142
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 7540 AND id_shop=1 LIMIT 1
0.286 ms 1 /classes/Product.php:6876
272
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 5139
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.286 ms 1 /classes/SpecificPrice.php:259
432
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2660) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.286 ms 1 /classes/stock/StockAvailable.php:453
2796
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 9323 LIMIT 1
0.286 ms 10 /classes/SpecificPrice.php:435
3622
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3746
0.286 ms 1 /classes/Product.php:2902
133
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 7541) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.286 ms 1 /classes/stock/StockAvailable.php:453
409
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2893) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.286 ms 1 /classes/stock/StockAvailable.php:453
1055
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.286 ms 1 /classes/Product.php:5659
2807
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 9324 LIMIT 1
0.286 ms 10 /classes/SpecificPrice.php:435
3307
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2769
0.286 ms 1 /classes/Product.php:2902
126
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 185 LIMIT 1
0.285 ms 1 /classes/Product.php:5659
1454
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3327 LIMIT 1
0.285 ms 10 /classes/SpecificPrice.php:435
2577
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 7943 AND id_shop=1 LIMIT 1
0.285 ms 1 /classes/Product.php:6876
830
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2781) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.285 ms 1 /classes/stock/StockAvailable.php:453
1719
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3753
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.285 ms 0 /classes/SpecificPrice.php:259
4090
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 62 AND `id_shop` = 1
0.285 ms 6 /src/Adapter/EntityMapper.php:79
803
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2793
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.284 ms 0 /classes/SpecificPrice.php:259
1126
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2624 AND id_shop=1 LIMIT 1
0.284 ms 1 /classes/Product.php:6876
1636
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3745) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.284 ms 1 /classes/stock/StockAvailable.php:453
454
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2651) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.284 ms 1 /classes/stock/StockAvailable.php:453
1105
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2622 AND `id_group` = 1 LIMIT 1
0.284 ms 0 /classes/GroupReduction.php:156
1139
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2625) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.284 ms 1 /classes/stock/StockAvailable.php:453
1642
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3746
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.284 ms 0 /classes/SpecificPrice.php:259
403
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2893 LIMIT 1
0.283 ms 11 /classes/SpecificPrice.php:435
3301
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2767
0.283 ms 1 /classes/Product.php:2902
3511
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2649
0.283 ms 1 /classes/Product.php:2902
3823
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 6185
0.283 ms 1 /classes/Product.php:2902
3874
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 7943
0.283 ms 1 /classes/Product.php:2902
3895
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 8393
0.283 ms 1 /classes/Product.php:2902
4143
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 192) LIMIT 1
0.283 ms 1 /src/Adapter/EntityMapper.php:71
4532
SELECT SQL_NO_CACHE `name`
FROM `hgt78_hook`
WHERE `id_hook` = 912 LIMIT 1
0.283 ms 1 /classes/Hook.php:247
1004
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2637)
0.282 ms 1 /classes/Product.php:3860
3313
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2773
0.282 ms 1 /classes/Product.php:2902
3277
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3740
0.282 ms 1 /classes/Product.php:2902
682
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2778
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.281 ms 0 /classes/SpecificPrice.php:259
1169
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2640)
0.281 ms 1 /classes/Product.php:3860
1551
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3556
AND image_shop.`cover` = 1 LIMIT 1
0.281 ms 1 /classes/Product.php:3570
973
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2634) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.281 ms 1 /classes/stock/StockAvailable.php:453
1498
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2650 LIMIT 1
0.281 ms 10 /classes/SpecificPrice.php:435
3595
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3484
0.281 ms 1 /classes/Product.php:2902
775
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3075) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.280 ms 1 /classes/stock/StockAvailable.php:453
4020
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 10302
0.280 ms 1 /classes/Product.php:2902
4038
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 11001
0.280 ms 1 /classes/Product.php:2902
740
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2799 AND id_shop=1 LIMIT 1
0.280 ms 1 /classes/Product.php:6876
1685
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3750 LIMIT 1
0.280 ms 10 /classes/SpecificPrice.php:435
3298
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2623
0.280 ms 1 /classes/Product.php:2902
4151
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 48) LIMIT 1
0.280 ms 1 /src/Adapter/EntityMapper.php:71
1109
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3458
AND image_shop.`cover` = 1 LIMIT 1
0.279 ms 1 /classes/Product.php:3570
1158
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2627)
0.279 ms 1 /classes/Product.php:3860
2683
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 185 LIMIT 1
0.279 ms 1 /classes/Product.php:5659
3616
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3689
0.279 ms 1 /classes/Product.php:2902
1084
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2620) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.279 ms 1 /classes/stock/StockAvailable.php:453
2313
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 6178) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.279 ms 1 /classes/stock/StockAvailable.php:453
2886
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 9686
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.279 ms 0 /classes/SpecificPrice.php:259
482
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2768 LIMIT 1
0.278 ms 10 /classes/SpecificPrice.php:435
3006
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 184 LIMIT 1
0.278 ms 1 /classes/Product.php:5659
3703
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4575
0.278 ms 1 /classes/Product.php:2902
1520
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3454 LIMIT 1
0.277 ms 10 /classes/SpecificPrice.php:435
4060
SELECT SQL_NO_CACHE *
FROM `hgt78_currency_lang`
WHERE `id_currency` = 2
0.277 ms 6 /src/Adapter/EntityMapper.php:79
392
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3587 LIMIT 1
0.277 ms 11 /classes/SpecificPrice.php:435
1320
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2645 LIMIT 1
0.276 ms 10 /classes/SpecificPrice.php:435
1740
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3755 LIMIT 1
0.276 ms 10 /classes/SpecificPrice.php:435
3340
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2692
0.276 ms 1 /classes/Product.php:2902
521
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2773) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.276 ms 1 /classes/stock/StockAvailable.php:453
2063
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 5282 LIMIT 1
0.276 ms 15 /classes/SpecificPrice.php:435
1958
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4932) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.275 ms 1 /classes/stock/StockAvailable.php:453
3745
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 5293
0.275 ms 1 /classes/Product.php:2902
1175
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2641
AND image_shop.`cover` = 1 LIMIT 1
0.275 ms 1 /classes/Product.php:3570
2073
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 95 LIMIT 1
0.275 ms 1 /classes/Product.php:5659
3978
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 9694
0.274 ms 1 /classes/Product.php:2902
4040
SELECT SQL_NO_CACHE * FROM `hgt78_hook_module_exceptions`
WHERE `id_shop` IN (1)
0.274 ms 1 /classes/module/Module.php:2046
1122
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2624 LIMIT 1
0.274 ms 10 /classes/SpecificPrice.php:435
1474
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2621
AND image_shop.`cover` = 1 LIMIT 1
0.274 ms 1 /classes/Product.php:3570
1680
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3749) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.274 ms 1 /classes/stock/StockAvailable.php:453
1751
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3756 LIMIT 1
0.274 ms 10 /classes/SpecificPrice.php:435
2851
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 9597 LIMIT 1
0.274 ms 11 /classes/SpecificPrice.php:435
338
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 5133
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.273 ms 0 /classes/SpecificPrice.php:259
1065
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3477
AND image_shop.`cover` = 1 LIMIT 1
0.273 ms 1 /classes/Product.php:3570
1183
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2641) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.273 ms 1 /classes/stock/StockAvailable.php:453
1807
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3766 LIMIT 1
0.273 ms 10 /classes/SpecificPrice.php:435
3993
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 10069
0.273 ms 1 /classes/Product.php:2902
115
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 185 LIMIT 1
0.272 ms 1 /classes/Product.php:5659
493
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2769 LIMIT 1
0.272 ms 10 /classes/SpecificPrice.php:435
708
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2795 AND `id_group` = 1 LIMIT 1
0.272 ms 0 /classes/GroupReduction.php:156
720
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2797) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.272 ms 1 /classes/stock/StockAvailable.php:453
1192
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2656 AND id_shop=1 LIMIT 1
0.272 ms 1 /classes/Product.php:6876
1415
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2892 AND `id_group` = 1 LIMIT 1
0.272 ms 0 /classes/GroupReduction.php:156
1617
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3689
AND image_shop.`cover` = 1 LIMIT 1
0.272 ms 1 /classes/Product.php:3570
2707
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 8417
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.272 ms 0 /classes/SpecificPrice.php:259
3394
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2793
0.272 ms 1 /classes/Product.php:2902
299
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 5137) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.271 ms 1 /classes/stock/StockAvailable.php:453
1829
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3775 LIMIT 1
0.271 ms 10 /classes/SpecificPrice.php:435
2556
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 7941 AND `id_group` = 1 LIMIT 1
0.271 ms 0 /classes/GroupReduction.php:156
515
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2773 LIMIT 1
0.270 ms 10 /classes/SpecificPrice.php:435
979
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2782 LIMIT 1
0.270 ms 10 /classes/SpecificPrice.php:435
2058
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4966) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.270 ms 1 /classes/stock/StockAvailable.php:453
3150
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 10304 AND `id_group` = 1 LIMIT 1
0.270 ms 0 /classes/GroupReduction.php:156
1404
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2818 AND `id_group` = 1 LIMIT 1
0.270 ms 0 /classes/GroupReduction.php:156
205
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 5145 LIMIT 1
0.269 ms 10 /classes/SpecificPrice.php:435
1891
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3806) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.269 ms 1 /classes/stock/StockAvailable.php:453
3241
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 5141
0.269 ms 1 /classes/Product.php:2902
4533
SELECT SQL_NO_CACHE content FROM hgt78_lgcookieslaw_lang WHERE id_lang = 1 LIMIT 1
0.269 ms 1 /modules/lgcookieslaw/lgcookieslaw.php:161
2588
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 7944 AND id_shop=1 LIMIT 1
0.269 ms 1 /classes/Product.php:6876
1021
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2639
AND image_shop.`cover` = 1 LIMIT 1
0.268 ms 1 /classes/Product.php:3570
4029
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 10305
0.268 ms 1 /classes/Product.php:2902
4051
SELECT SQL_NO_CACHE `id_module` FROM `hgt78_module` WHERE `name` = "iqithtmlandbanners" LIMIT 1
0.268 ms 1 /classes/module/Module.php:2664
4521
SELECT SQL_NO_CACHE `id_module` FROM `hgt78_module` WHERE `name` = "ps_categorytree" LIMIT 1
0.268 ms 1 /classes/module/Module.php:2664
2617
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 180 LIMIT 1
0.267 ms 1 /classes/Product.php:5659
2818
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 9325 LIMIT 1
0.267 ms 10 /classes/SpecificPrice.php:435
2951
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 9693 LIMIT 1
0.267 ms 11 /classes/SpecificPrice.php:435
2994
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 184 LIMIT 1
0.267 ms 1 /classes/Product.php:5659
3214
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 7539
0.267 ms 1 /classes/Product.php:2902
3247
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 5139
0.267 ms 1 /classes/Product.php:2902
3346
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2771
0.267 ms 1 /classes/Product.php:2902
260
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 5140 LIMIT 1
0.266 ms 10 /classes/SpecificPrice.php:435
1153
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2627
AND image_shop.`cover` = 1 LIMIT 1
0.266 ms 1 /classes/Product.php:3570
1896
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3807 LIMIT 1
0.266 ms 10 /classes/SpecificPrice.php:435
825
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2781
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.266 ms 0 /classes/SpecificPrice.php:259
2721
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 8418 AND id_shop=1 LIMIT 1
0.266 ms 1 /classes/Product.php:6876
3189
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `hgt78_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 62 LIMIT 1
0.265 ms 1 /classes/Category.php:1378
3613
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3639
0.265 ms 1 /classes/Product.php:2902
414
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2694 LIMIT 1
0.265 ms 10 /classes/SpecificPrice.php:435
685
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2778 AND id_shop=1 LIMIT 1
0.265 ms 1 /classes/Product.php:6876
1529
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3455
AND image_shop.`cover` = 1 LIMIT 1
0.265 ms 1 /classes/Product.php:3570
4528
SELECT SQL_NO_CACHE `id_module` FROM `hgt78_module` WHERE `name` = "iqitlinksmanager" LIMIT 1
0.265 ms 1 /classes/module/Module.php:2664
3328
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2765
0.264 ms 1 /classes/Product.php:2902
127
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 7541 LIMIT 1
0.264 ms 10 /classes/SpecificPrice.php:435
3892
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 8392
0.264 ms 1 /classes/Product.php:2902
1907
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3808 LIMIT 1
0.263 ms 10 /classes/SpecificPrice.php:435
2118
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 5093 LIMIT 1
0.263 ms 9 /classes/SpecificPrice.php:435
363
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3743 AND id_shop=1 LIMIT 1
0.262 ms 1 /classes/Product.php:6876
911
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.262 ms 1 /classes/Product.php:5659
1104
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2622 AND id_shop=1 LIMIT 1
0.262 ms 1 /classes/Product.php:6876
922
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.261 ms 1 /classes/Product.php:5659
1537
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3455) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.261 ms 1 /classes/stock/StockAvailable.php:453
2684
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 8397 LIMIT 1
0.261 ms 10 /classes/SpecificPrice.php:435
3217
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 6727
0.261 ms 1 /classes/Product.php:2902
3451
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2638
0.261 ms 1 /classes/Product.php:2902
4102
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 190 AND `id_shop` = 1
0.261 ms 6 /src/Adapter/EntityMapper.php:79
504
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2770 LIMIT 1
0.260 ms 10 /classes/SpecificPrice.php:435
1420
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.260 ms 1 /classes/Product.php:5659
1579
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3584 AND id_shop=1 LIMIT 1
0.260 ms 1 /classes/Product.php:6876
3185
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 12551) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.260 ms 1 /classes/stock/StockAvailable.php:453
3862
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 7938
0.260 ms 1 /classes/Product.php:2902
4530
SELECT SQL_NO_CACHE `id_module` FROM `hgt78_module` WHERE `name` = "iqitcontactpage" LIMIT 1
0.260 ms 1 /classes/module/Module.php:2664
774
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3075 AND `id_group` = 1 LIMIT 1
0.260 ms 0 /classes/GroupReduction.php:156
2074
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 5283 LIMIT 1
0.260 ms 8 /classes/SpecificPrice.php:435
144
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 7540) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.259 ms 1 /classes/stock/StockAvailable.php:453
3373
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2799
0.259 ms 1 /classes/Product.php:2902
3712
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4935
0.259 ms 1 /classes/Product.php:2902
387
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3740) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.259 ms 1 /classes/stock/StockAvailable.php:453
938
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2631 AND id_shop=1 LIMIT 1
0.259 ms 1 /classes/Product.php:6876
1073
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3477) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.259 ms 1 /classes/stock/StockAvailable.php:453
2487
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 6195 AND id_shop=1 LIMIT 1
0.259 ms 1 /classes/Product.php:6876
3439
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2634
0.259 ms 1 /classes/Product.php:2902
1913
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3808) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.258 ms 1 /classes/stock/StockAvailable.php:453
488
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2768) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.258 ms 1 /classes/stock/StockAvailable.php:453
576
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2765) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.258 ms 1 /classes/stock/StockAvailable.php:453
824
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2781 LIMIT 1
0.258 ms 10 /classes/SpecificPrice.php:435
1087
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3459
AND image_shop.`cover` = 1 LIMIT 1
0.258 ms 1 /classes/Product.php:3570
1607
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.258 ms 1 /classes/Product.php:5659
2202
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 5973) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.258 ms 1 /classes/stock/StockAvailable.php:453
2696
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 8401
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.258 ms 0 /classes/SpecificPrice.php:259
47
SELECT SQL_NO_CACHE state FROM hgt78_feature_flag WHERE name = 'multiple_image_format' LIMIT 1
0.257 ms 1 /classes/FeatureFlag.php:105
537
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2775 LIMIT 1
0.257 ms 10 /classes/SpecificPrice.php:435
791
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2794 LIMIT 1
0.257 ms 10 /classes/SpecificPrice.php:435
2599
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 7945 AND id_shop=1 LIMIT 1
0.257 ms 1 /classes/Product.php:6876
2779
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 9055) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.257 ms 1 /classes/stock/StockAvailable.php:453
2873
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 334 LIMIT 1
0.257 ms 1 /classes/Product.php:5659
3229
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 5145
0.257 ms 1 /classes/Product.php:2902
3709
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4934
0.257 ms 1 /classes/Product.php:2902
1509
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2654 LIMIT 1
0.256 ms 10 /classes/SpecificPrice.php:435
1935
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4574) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.256 ms 1 /classes/stock/StockAvailable.php:453
2017
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4963
AND image_shop.`cover` = 1 LIMIT 1
0.256 ms 1 /classes/Product.php:3570
2624
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 7769) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.256 ms 1 /classes/stock/StockAvailable.php:453
3370
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2798
0.256 ms 1 /classes/Product.php:2902
471
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2767 LIMIT 1
0.256 ms 10 /classes/SpecificPrice.php:435
2578
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 7943 AND `id_group` = 1 LIMIT 1
0.256 ms 0 /classes/GroupReduction.php:156
183
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 5147 LIMIT 1
0.255 ms 10 /classes/SpecificPrice.php:435
331
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 5134 AND `id_group` = 1 LIMIT 1
0.255 ms 0 /classes/GroupReduction.php:156
703
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2795 LIMIT 1
0.255 ms 10 /classes/SpecificPrice.php:435
1497
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 185 LIMIT 1
0.255 ms 1 /classes/Product.php:5659
1701
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3751 AND `id_group` = 1 LIMIT 1
0.255 ms 0 /classes/GroupReduction.php:156
3331
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2661
0.255 ms 1 /classes/Product.php:2902
4067
SELECT SQL_NO_CACHE `id_module` FROM `hgt78_module_shop` WHERE `id_module` = 90 AND `id_shop` = 1 LIMIT 1
0.255 ms 1 /classes/module/Module.php:2137
1054
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2628
AND image_shop.`cover` = 1 LIMIT 1
0.255 ms 1 /classes/Product.php:3570
1193
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2656 AND `id_group` = 1 LIMIT 1
0.255 ms 0 /classes/GroupReduction.php:156
1924
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4256) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.255 ms 1 /classes/stock/StockAvailable.php:453
3805
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 6179
0.254 ms 1 /classes/Product.php:2902
725
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2798 LIMIT 1
0.254 ms 10 /classes/SpecificPrice.php:435
2338
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 6181
AND image_shop.`cover` = 1 LIMIT 1
0.254 ms 1 /classes/Product.php:3570
2754
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 8975 AND id_shop=1 LIMIT 1
0.254 ms 1 /classes/Product.php:6876
277
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 5139) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.253 ms 1 /classes/stock/StockAvailable.php:453
795
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2794 AND id_shop=1 LIMIT 1
0.253 ms 1 /classes/Product.php:6876
1302
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2655 AND id_shop=1 LIMIT 1
0.253 ms 1 /classes/Product.php:6876
2583
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 320 LIMIT 1
0.253 ms 1 /classes/Product.php:5659
3173
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 12552 AND `id_group` = 1 LIMIT 1
0.253 ms 0 /classes/GroupReduction.php:156
2434
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 6189) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.252 ms 1 /classes/stock/StockAvailable.php:453
2661
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 174 LIMIT 1
0.252 ms 1 /classes/Product.php:5659
3550
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3326
0.252 ms 1 /classes/Product.php:2902
971
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2634 AND id_shop=1 LIMIT 1
0.252 ms 1 /classes/Product.php:6876
530
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2774 AND id_shop=1 LIMIT 1
0.251 ms 1 /classes/Product.php:6876
581
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2661 LIMIT 1
0.251 ms 10 /classes/SpecificPrice.php:435
4541
SELECT SQL_NO_CACHE psgdpr.active FROM `hgt78_psgdpr_consent` psgdpr
WHERE psgdpr.id_module = 22 LIMIT 1
0.251 ms 12 /modules/psgdpr/classes/GDPRConsent.php:132
3409
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2789
0.251 ms 1 /classes/Product.php:2902
431
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2660 AND `id_group` = 1 LIMIT 1
0.250 ms 0 /classes/GroupReduction.php:156
1608
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3639 LIMIT 1
0.250 ms 10 /classes/SpecificPrice.php:435
2236
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 6108) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.250 ms 1 /classes/stock/StockAvailable.php:453
2606
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 7946 LIMIT 1
0.250 ms 10 /classes/SpecificPrice.php:435
2973
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 9695 LIMIT 1
0.250 ms 11 /classes/SpecificPrice.php:435
665
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2764) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.249 ms 1 /classes/stock/StockAvailable.php:453
1613
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3639 AND `id_group` = 1 LIMIT 1
0.249 ms 0 /classes/GroupReduction.php:156
1962
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 185 LIMIT 1
0.249 ms 1 /classes/Product.php:5659
2526
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 7938
AND image_shop.`cover` = 1 LIMIT 1
0.249 ms 1 /classes/Product.php:3570
3062
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 10072) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.249 ms 1 /classes/stock/StockAvailable.php:453
3817
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 6183
0.249 ms 1 /classes/Product.php:2902
3847
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 6194
0.249 ms 1 /classes/Product.php:2902
526
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2774 LIMIT 1
0.249 ms 10 /classes/SpecificPrice.php:435
2262
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 182 LIMIT 1
0.249 ms 1 /classes/Product.php:5659
3949
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 9597
0.249 ms 1 /classes/Product.php:2902
3954
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 9687
0.249 ms 1 /classes/Product.php:2902
1209
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.248 ms 1 /classes/Product.php:5659
1603
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3586) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.248 ms 1 /classes/stock/StockAvailable.php:453
580
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.248 ms 1 /classes/Product.php:5659
669
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 182 LIMIT 1
0.248 ms 1 /classes/Product.php:5659
752
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2800 AND `id_group` = 1 LIMIT 1
0.248 ms 0 /classes/GroupReduction.php:156
769
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3075 LIMIT 1
0.248 ms 10 /classes/SpecificPrice.php:435
1177
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2641 LIMIT 1
0.248 ms 10 /classes/SpecificPrice.php:435
1902
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3807) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.248 ms 1 /classes/stock/StockAvailable.php:453
2694
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 185 LIMIT 1
0.248 ms 1 /classes/Product.php:5659
2777
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 9055 AND id_shop=1 LIMIT 1
0.248 ms 1 /classes/Product.php:6876
3886
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 7769
0.248 ms 1 /classes/Product.php:2902
5
SELECT SQL_NO_CACHE su.physical_uri, su.virtual_uri, su.domain, su.domain_ssl
FROM hgt78_shop s
LEFT JOIN hgt78_shop_url su ON (s.id_shop = su.id_shop)
WHERE s.id_shop = 1
AND s.active = 1 AND s.deleted = 0 AND su.main = 1 LIMIT 1
0.247 ms 1 /classes/shop/Shop.php:218
271
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 5139 LIMIT 1
0.247 ms 10 /classes/SpecificPrice.php:435
3001
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 10067 AND `id_group` = 1 LIMIT 1
0.247 ms 0 /classes/GroupReduction.php:156
3766
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 5971
0.247 ms 1 /classes/Product.php:2902
3910
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 8417
0.247 ms 1 /classes/Product.php:2902
3960
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 9688
0.247 ms 1 /classes/Product.php:2902
4057
SELECT SQL_NO_CACHE `id_module` FROM `hgt78_module_shop` WHERE `id_module` = 17 AND `id_shop` = 1 LIMIT 1
0.247 ms 1 /classes/module/Module.php:2137
380
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 185 LIMIT 1
0.246 ms 1 /classes/Product.php:5659
1499
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2650
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.246 ms 0 /classes/SpecificPrice.php:259
1869
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3804) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.246 ms 1 /classes/stock/StockAvailable.php:453
193
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 309 LIMIT 1
0.246 ms 1 /classes/Product.php:5659
1739
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.246 ms 1 /classes/Product.php:5659
3250
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 5138
0.246 ms 1 /classes/Product.php:2902
465
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2623) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.245 ms 1 /classes/stock/StockAvailable.php:453
780
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3176 LIMIT 1
0.245 ms 10 /classes/SpecificPrice.php:435
3190
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 62 LIMIT 1
0.245 ms 1 /classes/Product.php:5659
3502
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2648
0.245 ms 1 /classes/Product.php:2902
3652
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3756
0.245 ms 1 /classes/Product.php:2902
1291
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2643 AND id_shop=1 LIMIT 1
0.245 ms 1 /classes/Product.php:6876
2421
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 6188 AND id_shop=1 LIMIT 1
0.245 ms 1 /classes/Product.php:6876
3124
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 10302
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.245 ms 1 /classes/SpecificPrice.php:259
22
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 2) AND (b.`id_shop` = 1) LIMIT 1
0.244 ms 1 /src/Adapter/EntityMapper.php:71
1521
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3454
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.244 ms 0 /classes/SpecificPrice.php:259
437
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2652 LIMIT 1
0.244 ms 10 /classes/SpecificPrice.php:435
570
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2765 LIMIT 1
0.244 ms 10 /classes/SpecificPrice.php:435
758
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3178 LIMIT 1
0.244 ms 10 /classes/SpecificPrice.php:435
1612
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3639 AND id_shop=1 LIMIT 1
0.244 ms 1 /classes/Product.php:6876
2509
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 6500 AND id_shop=1 LIMIT 1
0.244 ms 1 /classes/Product.php:6876
2539
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 320 LIMIT 1
0.244 ms 1 /classes/Product.php:5659
1995
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4943
AND image_shop.`cover` = 1 LIMIT 1
0.243 ms 1 /classes/Product.php:3570
3316
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2774
0.243 ms 1 /classes/Product.php:2902
642
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2771) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.243 ms 1 /classes/stock/StockAvailable.php:453
687
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2778) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.243 ms 1 /classes/stock/StockAvailable.php:453
962
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2633) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.243 ms 1 /classes/stock/StockAvailable.php:453
1258
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2647 AND id_shop=1 LIMIT 1
0.243 ms 1 /classes/Product.php:6876
1449
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3132) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.243 ms 1 /classes/stock/StockAvailable.php:453
1575
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3584 LIMIT 1
0.243 ms 10 /classes/SpecificPrice.php:435
3571
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3327
0.243 ms 1 /classes/Product.php:2902
3733
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4966
0.243 ms 1 /classes/Product.php:2902
3850
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 6195
0.243 ms 1 /classes/Product.php:2902
393
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3587
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.242 ms 1 /classes/SpecificPrice.php:259
896
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2792) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.242 ms 1 /classes/stock/StockAvailable.php:453
1548
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3484) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.242 ms 1 /classes/stock/StockAvailable.php:453
2318
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 6179 LIMIT 1
0.242 ms 10 /classes/SpecificPrice.php:435
2896
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 9688 LIMIT 1
0.242 ms 11 /classes/SpecificPrice.php:435
3913
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 8418
0.242 ms 1 /classes/Product.php:2902
288
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 5138) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.241 ms 1 /classes/stock/StockAvailable.php:453
967
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2634 LIMIT 1
0.241 ms 10 /classes/SpecificPrice.php:435
1143
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.241 ms 1 /classes/Product.php:5659
2006
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4944
AND image_shop.`cover` = 1 LIMIT 1
0.241 ms 1 /classes/Product.php:3570
2482
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 182 LIMIT 1
0.241 ms 1 /classes/Product.php:5659
2817
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 173 LIMIT 1
0.241 ms 1 /classes/Product.php:5659
2907
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 9689 LIMIT 1
0.241 ms 11 /classes/SpecificPrice.php:435
3253
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 5137
0.241 ms 1 /classes/Product.php:2902
3436
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2633
0.241 ms 1 /classes/Product.php:2902
441
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2652 AND id_shop=1 LIMIT 1
0.241 ms 1 /classes/Product.php:6876
525
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 182 LIMIT 1
0.241 ms 1 /classes/Product.php:5659
1144
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2626 LIMIT 1
0.240 ms 10 /classes/SpecificPrice.php:435
2908
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 9689
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.240 ms 0 /classes/SpecificPrice.php:259
3844
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 6193
0.240 ms 1 /classes/Product.php:2902
2795
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 173 LIMIT 1
0.240 ms 1 /classes/Product.php:5659
209
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 5145 AND id_shop=1 LIMIT 1
0.239 ms 1 /classes/Product.php:6876
413
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 185 LIMIT 1
0.239 ms 1 /classes/Product.php:5659
459
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2623 LIMIT 1
0.239 ms 10 /classes/SpecificPrice.php:435
797
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2794) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.239 ms 1 /classes/stock/StockAvailable.php:453
1198
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.239 ms 1 /classes/Product.php:5659
1800
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3765 AND id_shop=1 LIMIT 1
0.239 ms 1 /classes/Product.php:6876
3655
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3757
0.239 ms 1 /classes/Product.php:2902
1326
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2645) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.238 ms 1 /classes/stock/StockAvailable.php:453
371
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3741
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.238 ms 0 /classes/SpecificPrice.php:259
1780
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3763) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.238 ms 1 /classes/stock/StockAvailable.php:453
2406
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 6187 LIMIT 1
0.238 ms 10 /classes/SpecificPrice.php:435
2412
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 6187) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.238 ms 1 /classes/stock/StockAvailable.php:453
2977
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 9695 AND id_shop=1 LIMIT 1
0.238 ms 1 /classes/Product.php:6876
3259
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 5135
0.238 ms 1 /classes/Product.php:2902
3634
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3750
0.238 ms 1 /classes/Product.php:2902
3975
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 9693
0.238 ms 1 /classes/Product.php:2902
4043
SELECT SQL_NO_CACHE ctg.`id_group`
FROM hgt78_category_group ctg
WHERE ctg.`id_category` = 2 AND ctg.`id_group` = 1 LIMIT 1
0.238 ms 1 /classes/Category.php:1754
1376
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3326 LIMIT 1
0.237 ms 10 /classes/SpecificPrice.php:435
1487
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2733 LIMIT 1
0.237 ms 10 /classes/SpecificPrice.php:435
1974
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4935 LIMIT 1
0.237 ms 10 /classes/SpecificPrice.php:435
3101
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 10298 LIMIT 1
0.237 ms 10 /classes/SpecificPrice.php:435
3607
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3585
0.237 ms 1 /classes/Product.php:2902
636
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2771 LIMIT 1
0.236 ms 10 /classes/SpecificPrice.php:435
1580
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3584 AND `id_group` = 1 LIMIT 1
0.236 ms 0 /classes/GroupReduction.php:156
2428
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 6189 LIMIT 1
0.236 ms 10 /classes/SpecificPrice.php:435
2867
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 9598 AND `id_group` = 1 LIMIT 1
0.236 ms 0 /classes/GroupReduction.php:156
4052
SELECT SQL_NO_CACHE `id_module` FROM `hgt78_module_shop` WHERE `id_module` = 79 AND `id_shop` = 1 LIMIT 1
0.236 ms 1 /classes/module/Module.php:2137
741
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2799 AND `id_group` = 1 LIMIT 1
0.236 ms 0 /classes/GroupReduction.php:156
10
SELECT SQL_NO_CACHE id_shop
FROM `hgt78_lang_shop`
WHERE `id_lang` = 1
AND id_shop = 1 LIMIT 1
0.235 ms 1 /classes/ObjectModel.php:1729
548
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2776 LIMIT 1
0.235 ms 10 /classes/SpecificPrice.php:435
770
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3075
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.235 ms 0 /classes/SpecificPrice.php:259
1513
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2654 AND id_shop=1 LIMIT 1
0.235 ms 1 /classes/Product.php:6876
1592
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3585) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.235 ms 1 /classes/stock/StockAvailable.php:453
3268
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4902
0.235 ms 1 /classes/Product.php:2902
3042
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 184 LIMIT 1
0.234 ms 1 /classes/Product.php:5659
4042
SELECT SQL_NO_CACHE id_shop
FROM `hgt78_group_shop`
WHERE `id_group` = 1
AND id_shop = 1 LIMIT 1
0.234 ms 1 /classes/ObjectModel.php:1729
786
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3176) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.234 ms 1 /classes/stock/StockAvailable.php:453
2895
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 334 LIMIT 1
0.234 ms 1 /classes/Product.php:5659
3751
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 5093
0.234 ms 1 /classes/Product.php:2902
503
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 182 LIMIT 1
0.233 ms 1 /classes/Product.php:5659
1482
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2621) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.233 ms 1 /classes/stock/StockAvailable.php:453
2208
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 6047 LIMIT 1
0.233 ms 10 /classes/SpecificPrice.php:435
2180
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 5971) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.233 ms 1 /classes/stock/StockAvailable.php:453
497
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2769 AND id_shop=1 LIMIT 1
0.232 ms 1 /classes/Product.php:6876
587
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2661) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.232 ms 1 /classes/stock/StockAvailable.php:453
747
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2800 LIMIT 1
0.232 ms 10 /classes/SpecificPrice.php:435
1365
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3265 LIMIT 1
0.232 ms 10 /classes/SpecificPrice.php:435
1493
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2733) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.232 ms 1 /classes/stock/StockAvailable.php:453
4065
SELECT SQL_NO_CACHE `name`
FROM `hgt78_hook`
WHERE `id_hook` = 910 LIMIT 1
0.232 ms 1 /classes/Hook.php:247
1067
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3477 LIMIT 1
0.231 ms 10 /classes/SpecificPrice.php:435
1422
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3099
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.231 ms 0 /classes/SpecificPrice.php:259
1453
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.231 ms 1 /classes/Product.php:5659
1586
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3585 LIMIT 1
0.231 ms 10 /classes/SpecificPrice.php:435
3244
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 5140
0.231 ms 1 /classes/Product.php:2902
3832
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 6188
0.231 ms 1 /classes/Product.php:2902
3966
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 9690
0.231 ms 1 /classes/Product.php:2902
264
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 5140 AND id_shop=1 LIMIT 1
0.230 ms 1 /classes/Product.php:6876
713
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.230 ms 1 /classes/Product.php:5659
1332
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3252 LIMIT 1
0.230 ms 10 /classes/SpecificPrice.php:435
1502
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2650 AND id_shop=1 LIMIT 1
0.230 ms 1 /classes/Product.php:6876
2616
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `hgt78_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 180 LIMIT 1
0.230 ms 1 /classes/Category.php:1378
2844
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 9596 AND id_shop=1 LIMIT 1
0.230 ms 1 /classes/Product.php:6876
3499
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2656
0.230 ms 1 /classes/Product.php:2902
3826
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 6186
0.230 ms 1 /classes/Product.php:2902
905
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3177 AND id_shop=1 LIMIT 1
0.230 ms 1 /classes/Product.php:6876
1861
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `hgt78_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 184 LIMIT 1
0.230 ms 1 /classes/Category.php:1378
1864
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3804
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.230 ms 0 /classes/SpecificPrice.php:259
2328
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 182 LIMIT 1
0.230 ms 1 /classes/Product.php:5659
966
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.229 ms 1 /classes/Product.php:5659
31
SELECT SQL_NO_CACHE `id_lang` FROM `hgt78_lang`
WHERE `locale` = 'fr-fr'
OR `language_code` = 'fr-fr' LIMIT 1
0.229 ms 6 /classes/Language.php:883
874
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2790) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.229 ms 1 /classes/stock/StockAvailable.php:453
1889
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3806 AND id_shop=1 LIMIT 1
0.229 ms 1 /classes/Product.php:6876
3283
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2893
0.229 ms 1 /classes/Product.php:2902
3694
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3808
0.229 ms 1 /classes/Product.php:2902
1510
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2654
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.228 ms 0 /classes/SpecificPrice.php:259
2439
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 6191 LIMIT 1
0.228 ms 10 /classes/SpecificPrice.php:435
1182
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2641 AND `id_group` = 1 LIMIT 1
0.228 ms 0 /classes/GroupReduction.php:156
2974
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 9695
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.228 ms 0 /classes/SpecificPrice.php:259
3195
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 11001 AND id_shop=1 LIMIT 1
0.227 ms 1 /classes/Product.php:6876
1115
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3458 AND id_shop=1 LIMIT 1
0.227 ms 1 /classes/Product.php:6876
1387
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3155 LIMIT 1
0.227 ms 10 /classes/SpecificPrice.php:435
2451
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 6192
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.227 ms 1 /classes/SpecificPrice.php:259
3460
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2629
0.227 ms 1 /classes/Product.php:2902
609
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2691) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.226 ms 1 /classes/stock/StockAvailable.php:453
680
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 182 LIMIT 1
0.226 ms 1 /classes/Product.php:5659
1609
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3639
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.226 ms 0 /classes/SpecificPrice.php:259
1647
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3746) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.226 ms 1 /classes/stock/StockAvailable.php:453
375
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3741 AND `id_group` = 1 LIMIT 1
0.225 ms 0 /classes/GroupReduction.php:156
483
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2768
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.225 ms 0 /classes/SpecificPrice.php:259
978
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 183 LIMIT 1
0.225 ms 1 /classes/Product.php:5659
2440
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 6191
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.225 ms 1 /classes/SpecificPrice.php:259
2872
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `hgt78_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 334 LIMIT 1
0.225 ms 1 /classes/Category.php:1378
2911
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 9689 AND id_shop=1 LIMIT 1
0.225 ms 1 /classes/Product.php:6876
3180
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 12551
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.225 ms 1 /classes/SpecificPrice.php:259
3232
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 5144
0.225 ms 1 /classes/Product.php:2902
3493
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2640
0.225 ms 1 /classes/Product.php:2902
266
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 5140) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.225 ms 1 /classes/stock/StockAvailable.php:453
631
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2693) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.225 ms 1 /classes/stock/StockAvailable.php:453
927
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2635 AND id_shop=1 LIMIT 1
0.225 ms 1 /classes/Product.php:6876
949
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2632 AND id_shop=1 LIMIT 1
0.225 ms 1 /classes/Product.php:6876
1928
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.224 ms 1 /classes/Product.php:5659
3208
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 7541
0.224 ms 1 /classes/Product.php:2902
4522
SELECT SQL_NO_CACHE `id_module` FROM `hgt78_module_shop` WHERE `id_module` = 13 AND `id_shop` = 1 LIMIT 1
0.224 ms 1 /classes/module/Module.php:2137
4529
SELECT SQL_NO_CACHE `id_module` FROM `hgt78_module_shop` WHERE `id_module` = 89 AND `id_shop` = 1 LIMIT 1
0.224 ms 1 /classes/module/Module.php:2137
26
SELECT SQL_NO_CACHE *
FROM `hgt78_currency` a
LEFT JOIN `hgt78_currency_lang` `b` ON a.`id_currency` = b.`id_currency` AND b.`id_lang` = 1
LEFT JOIN `hgt78_currency_shop` `c` ON a.`id_currency` = c.`id_currency` AND c.`id_shop` = 1
WHERE (a.`id_currency` = 1) LIMIT 1
0.224 ms 1 /src/Adapter/EntityMapper.php:71
364
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3743 AND `id_group` = 1 LIMIT 1
0.224 ms 0 /classes/GroupReduction.php:156
1469
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2490 AND id_shop=1 LIMIT 1
0.224 ms 1 /classes/Product.php:6876
552
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2776 AND id_shop=1 LIMIT 1
0.223 ms 1 /classes/Product.php:6876
3742
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 5284
0.223 ms 1 /classes/Product.php:2902
1033
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.223 ms 1 /classes/Product.php:5659
1148
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2626 AND id_shop=1 LIMIT 1
0.223 ms 1 /classes/Product.php:6876
1386
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 181 LIMIT 1
0.223 ms 1 /classes/Product.php:5659
1811
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3766 AND id_shop=1 LIMIT 1
0.223 ms 1 /classes/Product.php:6876
2064
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 5282
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.223 ms 0 /classes/SpecificPrice.php:259
2394
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 182 LIMIT 1
0.223 ms 1 /classes/Product.php:5659
3940
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 9325
0.223 ms 1 /classes/Product.php:2902
2605
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 320 LIMIT 1
0.222 ms 1 /classes/Product.php:5659
3981
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 9695
0.222 ms 1 /classes/Product.php:2902
154
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 7539 AND `id_group` = 1 LIMIT 1
0.222 ms 0 /classes/GroupReduction.php:156
1464
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.222 ms 1 /classes/Product.php:5659
1524
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3454 AND id_shop=1 LIMIT 1
0.222 ms 1 /classes/Product.php:6876
558
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 182 LIMIT 1
0.221 ms 1 /classes/Product.php:5659
1354
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3264 LIMIT 1
0.221 ms 10 /classes/SpecificPrice.php:435
1519
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 185 LIMIT 1
0.221 ms 1 /classes/Product.php:5659
1546
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3484 AND id_shop=1 LIMIT 1
0.221 ms 1 /classes/Product.php:6876
2278
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 6174 AND id_shop=1 LIMIT 1
0.221 ms 1 /classes/Product.php:6876
2410
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 6187 AND id_shop=1 LIMIT 1
0.221 ms 1 /classes/Product.php:6876
3463
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2628
0.221 ms 1 /classes/Product.php:2902
3730
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4965
0.221 ms 1 /classes/Product.php:2902
620
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2692) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.220 ms 1 /classes/stock/StockAvailable.php:453
757
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.220 ms 1 /classes/Product.php:5659
1414
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2892 AND id_shop=1 LIMIT 1
0.220 ms 1 /classes/Product.php:6876
1867
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3804 AND id_shop=1 LIMIT 1
0.220 ms 1 /classes/Product.php:6876
1884
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 184 LIMIT 1
0.220 ms 1 /classes/Product.php:5659
3262
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 5134
0.220 ms 1 /classes/Product.php:2902
282
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 5138 LIMIT 1
0.220 ms 10 /classes/SpecificPrice.php:435
1675
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3749
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.220 ms 0 /classes/SpecificPrice.php:259
149
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 7539 LIMIT 1
0.219 ms 10 /classes/SpecificPrice.php:435
933
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.219 ms 1 /classes/Product.php:5659
1121
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 182 LIMIT 1
0.219 ms 1 /classes/Product.php:5659
1364
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.219 ms 1 /classes/Product.php:5659
2900
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 9688 AND id_shop=1 LIMIT 1
0.219 ms 1 /classes/Product.php:6876
2963
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 9694
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.219 ms 0 /classes/SpecificPrice.php:259
3080
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 10111
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.219 ms 1 /classes/SpecificPrice.php:259
1023
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2639 LIMIT 1
0.219 ms 10 /classes/SpecificPrice.php:435
3604
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3584
0.218 ms 1 /classes/Product.php:2902
164
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 6727 AND id_shop=1 LIMIT 1
0.218 ms 1 /classes/Product.php:6876
541
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2775 AND id_shop=1 LIMIT 1
0.218 ms 1 /classes/Product.php:6876
1503
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2650 AND `id_group` = 1 LIMIT 1
0.218 ms 0 /classes/GroupReduction.php:156
1531
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3455 LIMIT 1
0.218 ms 10 /classes/SpecificPrice.php:435
1733
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3754 AND id_shop=1 LIMIT 1
0.218 ms 1 /classes/Product.php:6876
2668
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 8395) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.218 ms 1 /classes/stock/StockAvailable.php:453
3048
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 10071 AND id_shop=1 LIMIT 1
0.218 ms 1 /classes/Product.php:6876
2667
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 8395 AND `id_group` = 1 LIMIT 1
0.217 ms 0 /classes/GroupReduction.php:156
2710
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 8417 AND id_shop=1 LIMIT 1
0.217 ms 1 /classes/Product.php:6876
3054
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 184 LIMIT 1
0.217 ms 1 /classes/Product.php:5659
386
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3740 AND `id_group` = 1 LIMIT 1
0.216 ms 0 /classes/GroupReduction.php:156
1786
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3764
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.216 ms 0 /classes/SpecificPrice.php:259
4539
SELECT SQL_NO_CACHE `id_module` FROM `hgt78_module` WHERE `name` = "ps_emailsubscription" LIMIT 1
0.216 ms 1 /classes/module/Module.php:2664
261
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 5140
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.216 ms 0 /classes/SpecificPrice.php:259
654
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2738) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.215 ms 1 /classes/stock/StockAvailable.php:453
1569
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3558 AND `id_group` = 1 LIMIT 1
0.215 ms 0 /classes/GroupReduction.php:156
2175
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 5971
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.215 ms 0 /classes/SpecificPrice.php:259
3724
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4963
0.215 ms 1 /classes/Product.php:2902
3808
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 6180
0.215 ms 1 /classes/Product.php:2902
508
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2770 AND id_shop=1 LIMIT 1
0.214 ms 1 /classes/Product.php:6876
1515
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2654) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.214 ms 1 /classes/stock/StockAvailable.php:453
1875
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3805
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.214 ms 0 /classes/SpecificPrice.php:259
2100
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 5293 AND id_shop=1 LIMIT 1
0.214 ms 1 /classes/Product.php:6876
2240
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.214 ms 1 /classes/Product.php:5659
549
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2776
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.214 ms 0 /classes/SpecificPrice.php:259
563
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2766 AND id_shop=1 LIMIT 1
0.214 ms 1 /classes/Product.php:6876
1526
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3454) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.214 ms 1 /classes/stock/StockAvailable.php:453
1839
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.214 ms 1 /classes/Product.php:5659
1950
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `hgt78_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 177 LIMIT 1
0.214 ms 1 /classes/Category.php:1378
3505
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2657
0.214 ms 1 /classes/Product.php:2902
3835
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 6189
0.214 ms 1 /classes/Product.php:2902
472
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2767
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.213 ms 0 /classes/SpecificPrice.php:259
1752
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3756
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.213 ms 0 /classes/SpecificPrice.php:259
2112
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 5296 AND `id_group` = 1 LIMIT 1
0.213 ms 0 /classes/GroupReduction.php:156
3802
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 6178
0.213 ms 1 /classes/Product.php:2902
977
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `hgt78_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 183 LIMIT 1
0.213 ms 1 /classes/Category.php:1378
1581
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3584) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.213 ms 1 /classes/stock/StockAvailable.php:453
1734
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3754 AND `id_group` = 1 LIMIT 1
0.213 ms 0 /classes/GroupReduction.php:156
3928
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 9055
0.213 ms 1 /classes/Product.php:2902
2399
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 6186 AND id_shop=1 LIMIT 1
0.212 ms 1 /classes/Product.php:6876
2422
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 6188 AND `id_group` = 1 LIMIT 1
0.212 ms 0 /classes/GroupReduction.php:156
27
SELECT SQL_NO_CACHE `id_lang` FROM `hgt78_lang`
WHERE `locale` = 'fr-fr'
OR `language_code` = 'fr-fr' LIMIT 1
0.212 ms 6 /classes/Language.php:883
382
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3740
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.212 ms 0 /classes/SpecificPrice.php:259
873
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2790 AND `id_group` = 1 LIMIT 1
0.212 ms 0 /classes/GroupReduction.php:156
1011
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.212 ms 1 /classes/Product.php:5659
2085
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 5284 LIMIT 1
0.212 ms 9 /classes/SpecificPrice.php:435
2135
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 5589 AND `id_group` = 1 LIMIT 1
0.212 ms 0 /classes/GroupReduction.php:156
3205
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 7542
0.212 ms 1 /classes/Product.php:2902
3367
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2797
0.212 ms 1 /classes/Product.php:2902
3640
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3752
0.212 ms 1 /classes/Product.php:2902
3763
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 5970
0.212 ms 1 /classes/Product.php:2902
598
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2690) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.211 ms 1 /classes/stock/StockAvailable.php:453
603
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2691 LIMIT 1
0.211 ms 10 /classes/SpecificPrice.php:435
674
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2777 AND id_shop=1 LIMIT 1
0.211 ms 1 /classes/Product.php:6876
724
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.211 ms 1 /classes/Product.php:5659
1466
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2490
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.211 ms 0 /classes/SpecificPrice.php:259
1486
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.211 ms 1 /classes/Product.php:5659
1784
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 174 LIMIT 1
0.211 ms 1 /classes/Product.php:5659
3256
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 5136
0.211 ms 1 /classes/Product.php:2902
3643
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3753
0.211 ms 1 /classes/Product.php:2902
3736
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 5282
0.211 ms 1 /classes/Product.php:2902
4531
SELECT SQL_NO_CACHE `id_module` FROM `hgt78_module_shop` WHERE `id_module` = 81 AND `id_shop` = 1 LIMIT 1
0.211 ms 1 /classes/module/Module.php:2137
155
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 7539) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.210 ms 1 /classes/stock/StockAvailable.php:453
536
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 182 LIMIT 1
0.210 ms 1 /classes/Product.php:5659
1078
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2620 LIMIT 1
0.210 ms 10 /classes/SpecificPrice.php:435
1377
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3326
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.210 ms 0 /classes/SpecificPrice.php:259
1741
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3755
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.210 ms 0 /classes/SpecificPrice.php:259
1828
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.210 ms 1 /classes/Product.php:5659
2035
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4964 AND `id_group` = 1 LIMIT 1
0.210 ms 0 /classes/GroupReduction.php:156
2443
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 6191 AND id_shop=1 LIMIT 1
0.210 ms 1 /classes/Product.php:6876
3457
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2630
0.210 ms 1 /classes/Product.php:2902
3697
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4256
0.210 ms 1 /classes/Product.php:2902
2533
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 7938 AND id_shop=1 LIMIT 1
0.210 ms 1 /classes/Product.php:6876
128
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 7541
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.209 ms 0 /classes/SpecificPrice.php:259
762
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3178 AND id_shop=1 LIMIT 1
0.209 ms 1 /classes/Product.php:6876
869
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2790
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.209 ms 0 /classes/SpecificPrice.php:259
1159
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2627 AND id_shop=1 LIMIT 1
0.209 ms 1 /classes/Product.php:6876
2362
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 6183 LIMIT 1
0.209 ms 10 /classes/SpecificPrice.php:435
2460
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 182 LIMIT 1
0.209 ms 1 /classes/Product.php:5659
2477
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 6194 AND `id_group` = 1 LIMIT 1
0.209 ms 0 /classes/GroupReduction.php:156
132
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 7541 AND `id_group` = 1 LIMIT 1
0.209 ms 0 /classes/GroupReduction.php:156
715
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2797
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.209 ms 0 /classes/SpecificPrice.php:259
1491
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2733 AND id_shop=1 LIMIT 1
0.209 ms 1 /classes/Product.php:6876
1862
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 184 LIMIT 1
0.209 ms 1 /classes/Product.php:5659
2411
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 6187 AND `id_group` = 1 LIMIT 1
0.209 ms 0 /classes/GroupReduction.php:156
3661
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3764
0.209 ms 1 /classes/Product.php:2902
3721
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4944
0.209 ms 1 /classes/Product.php:2902
983
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2782 AND id_shop=1 LIMIT 1
0.208 ms 1 /classes/Product.php:6876
1056
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2628 LIMIT 1
0.208 ms 10 /classes/SpecificPrice.php:435
1442
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.208 ms 1 /classes/Product.php:5659
1508
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 185 LIMIT 1
0.208 ms 1 /classes/Product.php:5659
2889
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 9686 AND id_shop=1 LIMIT 1
0.208 ms 1 /classes/Product.php:6876
3155
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 184 LIMIT 1
0.208 ms 1 /classes/Product.php:5659
3754
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 5589
0.208 ms 1 /classes/Product.php:2902
625
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2693 LIMIT 1
0.207 ms 10 /classes/SpecificPrice.php:435
1342
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.207 ms 1 /classes/Product.php:5659
1541
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.207 ms 1 /classes/Product.php:5659
1967
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4934 AND id_shop=1 LIMIT 1
0.207 ms 1 /classes/Product.php:6876
3760
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 5591
0.207 ms 1 /classes/Product.php:2902
259
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 309 LIMIT 1
0.207 ms 1 /classes/Product.php:5659
519
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2773 AND id_shop=1 LIMIT 1
0.207 ms 1 /classes/Product.php:6876
596
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2690 AND id_shop=1 LIMIT 1
0.207 ms 1 /classes/Product.php:6876
648
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2738 LIMIT 1
0.207 ms 11 /classes/SpecificPrice.php:435
1203
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2648 AND id_shop=1 LIMIT 1
0.207 ms 1 /classes/Product.php:6876
1601
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3586 AND id_shop=1 LIMIT 1
0.207 ms 1 /classes/Product.php:6876
2738
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 184 LIMIT 1
0.206 ms 1 /classes/Product.php:5659
216
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 5144 LIMIT 1
0.206 ms 10 /classes/SpecificPrice.php:435
560
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2766
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.206 ms 0 /classes/SpecificPrice.php:259
737
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2799
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.206 ms 1 /classes/SpecificPrice.php:259
1166
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2640 LIMIT 1
0.206 ms 10 /classes/SpecificPrice.php:435
3637
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3751
0.206 ms 1 /classes/Product.php:2902
3856
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 6500
0.206 ms 1 /classes/Product.php:2902
153
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 7539 AND id_shop=1 LIMIT 1
0.205 ms 1 /classes/Product.php:6876
314
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 309 LIMIT 1
0.205 ms 1 /classes/Product.php:5659
447
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 185 LIMIT 1
0.205 ms 1 /classes/Product.php:5659
614
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2692 LIMIT 1
0.205 ms 10 /classes/SpecificPrice.php:435
1559
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3556) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.205 ms 1 /classes/stock/StockAvailable.php:453
1873
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 184 LIMIT 1
0.205 ms 1 /classes/Product.php:5659
1900
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3807 AND id_shop=1 LIMIT 1
0.205 ms 1 /classes/Product.php:6876
2845
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 9596 AND `id_group` = 1 LIMIT 1
0.205 ms 0 /classes/GroupReduction.php:156
3445
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2636
0.205 ms 1 /classes/Product.php:2902
4536
SELECT SQL_NO_CACHE button1 FROM hgt78_lgcookieslaw_lang WHERE id_lang = 1 LIMIT 1
0.205 ms 1 /modules/lgcookieslaw/lgcookieslaw.php:161
514
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 182 LIMIT 1
0.205 ms 1 /classes/Product.php:5659
946
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2632
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.205 ms 0 /classes/SpecificPrice.php:259
1178
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2641
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.205 ms 0 /classes/SpecificPrice.php:259
1744
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3755 AND id_shop=1 LIMIT 1
0.205 ms 1 /classes/Product.php:6876
469
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `hgt78_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 182 LIMIT 1
0.204 ms 1 /classes/Category.php:1378
1444
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3132
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.204 ms 0 /classes/SpecificPrice.php:259
1568
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3558 AND id_shop=1 LIMIT 1
0.204 ms 1 /classes/Product.php:6876
3658
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3763
0.204 ms 1 /classes/Product.php:2902
3739
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 5283
0.204 ms 1 /classes/Product.php:2902
4537
SELECT SQL_NO_CACHE button2 FROM hgt78_lgcookieslaw_lang WHERE id_lang = 1 LIMIT 1
0.204 ms 1 /modules/lgcookieslaw/lgcookieslaw.php:161
1222
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3456
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.204 ms 0 /classes/SpecificPrice.php:259
1375
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.204 ms 1 /classes/Product.php:5659
2852
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 9597
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.204 ms 0 /classes/SpecificPrice.php:259
3841
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 6192
0.204 ms 1 /classes/Product.php:2902
316
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 5135
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.203 ms 0 /classes/SpecificPrice.php:259
3415
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2791
0.203 ms 1 /classes/Product.php:2902
452
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2651 AND id_shop=1 LIMIT 1
0.203 ms 1 /classes/Product.php:6876
718
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2797 AND id_shop=1 LIMIT 1
0.203 ms 1 /classes/Product.php:6876
817
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2780 AND id_shop=1 LIMIT 1
0.203 ms 1 /classes/Product.php:6876
839
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3179 AND id_shop=1 LIMIT 1
0.203 ms 1 /classes/Product.php:6876
3649
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3755
0.203 ms 1 /classes/Product.php:2902
1625
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3689) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.202 ms 1 /classes/stock/StockAvailable.php:453
3421
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3177
0.202 ms 1 /classes/Product.php:2902
592
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2690 LIMIT 1
0.202 ms 10 /classes/SpecificPrice.php:435
640
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2771 AND id_shop=1 LIMIT 1
0.202 ms 1 /classes/Product.php:6876
1244
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2658
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.202 ms 0 /classes/SpecificPrice.php:259
1460
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3327) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.202 ms 1 /classes/stock/StockAvailable.php:453
1471
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2490) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.202 ms 1 /classes/stock/StockAvailable.php:453
1906
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 184 LIMIT 1
0.202 ms 1 /classes/Product.php:5659
1992
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4942) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.202 ms 1 /classes/stock/StockAvailable.php:453
2012
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4944 AND id_shop=1 LIMIT 1
0.202 ms 1 /classes/Product.php:6876
2245
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 6129 AND id_shop=1 LIMIT 1
0.202 ms 1 /classes/Product.php:6876
2663
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 8395
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.202 ms 0 /classes/SpecificPrice.php:259
3280
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3587
0.202 ms 1 /classes/Product.php:2902
481
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 182 LIMIT 1
0.201 ms 1 /classes/Product.php:5659
3957
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 9686
0.201 ms 1 /classes/Product.php:2902
486
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2768 AND id_shop=1 LIMIT 1
0.201 ms 1 /classes/Product.php:6876
1757
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3756) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.201 ms 1 /classes/stock/StockAvailable.php:453
2373
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 6184 LIMIT 1
0.201 ms 10 /classes/SpecificPrice.php:435
2784
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 173 LIMIT 1
0.201 ms 1 /classes/Product.php:5659
3220
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 5148
0.201 ms 1 /classes/Product.php:2902
4540
SELECT SQL_NO_CACHE `id_module` FROM `hgt78_module_shop` WHERE `id_module` = 22 AND `id_shop` = 1 LIMIT 1
0.201 ms 1 /classes/module/Module.php:2137
1817
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.200 ms 1 /classes/Product.php:5659
1953
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4932
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.200 ms 0 /classes/SpecificPrice.php:259
2145
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 5590 AND id_shop=1 LIMIT 1
0.200 ms 1 /classes/Product.php:6876
2517
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 6501 LIMIT 1
0.200 ms 10 /classes/SpecificPrice.php:435
3772
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 5973
0.200 ms 1 /classes/Product.php:2902
4526
SELECT SQL_NO_CACHE c.`nleft`, c.`nright` FROM `hgt78_category` c
WHERE c.`id_category` = 1 LIMIT 1
0.200 ms 1 /classes/Category.php:1591
659
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2764 LIMIT 1
0.200 ms 10 /classes/SpecificPrice.php:435
1336
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3252 AND id_shop=1 LIMIT 1
0.200 ms 1 /classes/Product.php:6876
460
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2623
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.199 ms 0 /classes/SpecificPrice.php:259
1149
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2626 AND `id_group` = 1 LIMIT 1
0.199 ms 0 /classes/GroupReduction.php:156
1150
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2626) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.199 ms 1 /classes/stock/StockAvailable.php:453
1879
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3805 AND `id_group` = 1 LIMIT 1
0.199 ms 0 /classes/GroupReduction.php:156
1852
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3777
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.199 ms 0 /classes/SpecificPrice.php:259
3167
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 172 LIMIT 1
0.199 ms 1 /classes/Product.php:5659
3796
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 6176
0.199 ms 1 /classes/Product.php:2902
748
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2800
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.198 ms 0 /classes/SpecificPrice.php:259
1631
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3745
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.198 ms 0 /classes/SpecificPrice.php:259
1722
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3753 AND id_shop=1 LIMIT 1
0.198 ms 1 /classes/Product.php:6876
4534
SELECT SQL_NO_CACHE required FROM hgt78_lgcookieslaw_lang WHERE id_lang = 1 LIMIT 1
0.198 ms 1 /modules/lgcookieslaw/lgcookieslaw.php:161
29
SELECT SQL_NO_CACHE c.id_currency
FROM `hgt78_currency` c
WHERE (iso_code = 'GBP') LIMIT 1
0.198 ms 1 /classes/Currency.php:893
458
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 185 LIMIT 1
0.198 ms 1 /classes/Product.php:5659
1348
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3254 AND `id_group` = 1 LIMIT 1
0.198 ms 0 /classes/GroupReduction.php:156
1919
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4256
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.198 ms 0 /classes/SpecificPrice.php:259
2242
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 6129
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.198 ms 0 /classes/SpecificPrice.php:259
575
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2765 AND `id_group` = 1 LIMIT 1
0.197 ms 0 /classes/GroupReduction.php:156
2472
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 6194 LIMIT 1
0.197 ms 10 /classes/SpecificPrice.php:435
960
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2633 AND id_shop=1 LIMIT 1
0.197 ms 1 /classes/Product.php:6876
1236
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2649 AND id_shop=1 LIMIT 1
0.197 ms 1 /classes/Product.php:6876
1476
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2621 LIMIT 1
0.197 ms 11 /classes/SpecificPrice.php:435
1542
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3484 LIMIT 1
0.197 ms 10 /classes/SpecificPrice.php:435
1563
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.197 ms 1 /classes/Product.php:5659
1812
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3766 AND `id_group` = 1 LIMIT 1
0.197 ms 0 /classes/GroupReduction.php:156
1830
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3775
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.197 ms 0 /classes/SpecificPrice.php:259
602
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.196 ms 1 /classes/Product.php:5659
166
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 6727) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.196 ms 1 /classes/stock/StockAvailable.php:453
547
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 182 LIMIT 1
0.196 ms 1 /classes/Product.php:5659
2385
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 6185
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.196 ms 0 /classes/SpecificPrice.php:259
3664
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3765
0.196 ms 1 /classes/Product.php:2902
3748
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 5296
0.196 ms 1 /classes/Product.php:2902
1358
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3264 AND id_shop=1 LIMIT 1
0.195 ms 1 /classes/Product.php:6876
1564
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3558 LIMIT 1
0.195 ms 10 /classes/SpecificPrice.php:435
1574
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.195 ms 1 /classes/Product.php:5659
1822
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3771 AND id_shop=1 LIMIT 1
0.195 ms 1 /classes/Product.php:6876
1911
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3808 AND id_shop=1 LIMIT 1
0.195 ms 1 /classes/Product.php:6876
1978
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4935 AND id_shop=1 LIMIT 1
0.195 ms 1 /classes/Product.php:6876
2823
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 9325 AND `id_group` = 1 LIMIT 1
0.195 ms 0 /classes/GroupReduction.php:156
3466
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3477
0.195 ms 1 /classes/Product.php:2902
4535
SELECT SQL_NO_CACHE additional FROM hgt78_lgcookieslaw_lang WHERE id_lang = 1 LIMIT 1
0.195 ms 1 /modules/lgcookieslaw/lgcookieslaw.php:161
1845
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3776 AND `id_group` = 1 LIMIT 1
0.195 ms 0 /classes/GroupReduction.php:156
1930
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4574
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.195 ms 0 /classes/SpecificPrice.php:259
182
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 309 LIMIT 1
0.194 ms 1 /classes/Product.php:5659
1922
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4256 AND id_shop=1 LIMIT 1
0.194 ms 1 /classes/Product.php:6876
2267
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 6173 AND id_shop=1 LIMIT 1
0.194 ms 1 /classes/Product.php:6876
2306
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 182 LIMIT 1
0.194 ms 1 /classes/Product.php:5659
2400
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 6186 AND `id_group` = 1 LIMIT 1
0.194 ms 0 /classes/GroupReduction.php:156
215
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 309 LIMIT 1
0.194 ms 1 /classes/Product.php:5659
475
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2767 AND id_shop=1 LIMIT 1
0.194 ms 1 /classes/Product.php:6876
2186
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 5972
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.194 ms 0 /classes/SpecificPrice.php:259
2220
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 6107
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.194 ms 0 /classes/SpecificPrice.php:259
449
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2651
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.193 ms 0 /classes/SpecificPrice.php:259
553
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2776 AND `id_group` = 1 LIMIT 1
0.193 ms 0 /classes/GroupReduction.php:156
792
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2794
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.193 ms 0 /classes/SpecificPrice.php:259
1841
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3776
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.193 ms 0 /classes/SpecificPrice.php:259
2324
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 6179) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.193 ms 1 /classes/stock/StockAvailable.php:453
492
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 182 LIMIT 1
0.193 ms 1 /classes/Product.php:5659
574
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2765 AND id_shop=1 LIMIT 1
0.193 ms 1 /classes/Product.php:6876
1553
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3556 LIMIT 1
0.193 ms 10 /classes/SpecificPrice.php:435
2284
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 182 LIMIT 1
0.193 ms 1 /classes/Product.php:5659
2438
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 182 LIMIT 1
0.193 ms 1 /classes/Product.php:5659
2623
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 7769 AND `id_group` = 1 LIMIT 1
0.193 ms 0 /classes/GroupReduction.php:156
3433
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2632
0.193 ms 1 /classes/Product.php:2902
3715
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4942
0.193 ms 1 /classes/Product.php:2902
707
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2795 AND id_shop=1 LIMIT 1
0.192 ms 1 /classes/Product.php:6876
1099
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.192 ms 1 /classes/Product.php:5659
2091
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 5284) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.192 ms 1 /classes/stock/StockAvailable.php:453
3469
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2620
0.192 ms 1 /classes/Product.php:2902
194
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 5146 LIMIT 1
0.192 ms 10 /classes/SpecificPrice.php:435
232
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 5143 AND `id_group` = 1 LIMIT 1
0.192 ms 0 /classes/GroupReduction.php:156
2427
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 182 LIMIT 1
0.192 ms 1 /classes/Product.php:5659
2666
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 8395 AND id_shop=1 LIMIT 1
0.192 ms 1 /classes/Product.php:6876
2834
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 9535 AND `id_group` = 1 LIMIT 1
0.192 ms 0 /classes/GroupReduction.php:156
476
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2767 AND `id_group` = 1 LIMIT 1
0.191 ms 0 /classes/GroupReduction.php:156
585
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2661 AND id_shop=1 LIMIT 1
0.191 ms 1 /classes/Product.php:6876
818
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2780 AND `id_group` = 1 LIMIT 1
0.191 ms 0 /classes/GroupReduction.php:156
2041
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4965 LIMIT 1
0.191 ms 10 /classes/SpecificPrice.php:435
2068
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 5282 AND `id_group` = 1 LIMIT 1
0.191 ms 0 /classes/GroupReduction.php:156
3013
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 10068 AND `id_group` = 1 LIMIT 1
0.191 ms 0 /classes/GroupReduction.php:156
3168
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 12552 LIMIT 1
0.191 ms 10 /classes/SpecificPrice.php:435
3442
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2782
0.191 ms 1 /classes/Product.php:2902
3778
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 6107
0.191 ms 1 /classes/Product.php:2902
520
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2773 AND `id_group` = 1 LIMIT 1
0.190 ms 0 /classes/GroupReduction.php:156
1248
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2658 AND `id_group` = 1 LIMIT 1
0.190 ms 0 /classes/GroupReduction.php:156
1397
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.190 ms 1 /classes/Product.php:5659
1585
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.190 ms 1 /classes/Product.php:5659
1634
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3745 AND id_shop=1 LIMIT 1
0.190 ms 1 /classes/Product.php:6876
1895
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 184 LIMIT 1
0.190 ms 1 /classes/Product.php:5659
1945
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4575 AND `id_group` = 1 LIMIT 1
0.190 ms 0 /classes/GroupReduction.php:156
1951
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 177 LIMIT 1
0.190 ms 1 /classes/Product.php:5659
2534
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 7938 AND `id_group` = 1 LIMIT 1
0.190 ms 0 /classes/GroupReduction.php:156
189
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 5147) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.189 ms 1 /classes/stock/StockAvailable.php:453
1850
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.189 ms 1 /classes/Product.php:5659
1878
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3805 AND id_shop=1 LIMIT 1
0.189 ms 1 /classes/Product.php:6876
1912
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3808 AND `id_group` = 1 LIMIT 1
0.189 ms 0 /classes/GroupReduction.php:156
1933
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4574 AND id_shop=1 LIMIT 1
0.189 ms 1 /classes/Product.php:6876
2067
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 5282 AND id_shop=1 LIMIT 1
0.189 ms 1 /classes/Product.php:6876
2095
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 95 LIMIT 1
0.189 ms 1 /classes/Product.php:5659
3160
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 10305 AND id_shop=1 LIMIT 1
0.189 ms 1 /classes/Product.php:6876
3814
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 6182
0.189 ms 1 /classes/Product.php:2902
1253
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.188 ms 1 /classes/Product.php:5659
1640
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.188 ms 1 /classes/Product.php:5659
1768
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3757) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.188 ms 1 /classes/stock/StockAvailable.php:453
1886
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3806
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.188 ms 0 /classes/SpecificPrice.php:259
691
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 182 LIMIT 1
0.188 ms 1 /classes/Product.php:5659
735
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.188 ms 1 /classes/Product.php:5659
814
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2780
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.188 ms 0 /classes/SpecificPrice.php:259
834
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.188 ms 1 /classes/Product.php:5659
1917
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.188 ms 1 /classes/Product.php:5659
751
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2800 AND id_shop=1 LIMIT 1
0.187 ms 1 /classes/Product.php:6876
3784
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 6129
0.187 ms 1 /classes/Product.php:2902
571
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2765
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.187 ms 0 /classes/SpecificPrice.php:259
593
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2690
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.187 ms 0 /classes/SpecificPrice.php:259
1618
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.187 ms 1 /classes/Product.php:5659
1619
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3689 LIMIT 1
0.187 ms 10 /classes/SpecificPrice.php:435
2279
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 6174 AND `id_group` = 1 LIMIT 1
0.187 ms 0 /classes/GroupReduction.php:156
1381
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3326 AND `id_group` = 1 LIMIT 1
0.186 ms 0 /classes/GroupReduction.php:156
1488
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2733
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.186 ms 0 /classes/SpecificPrice.php:259
516
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2773
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.186 ms 0 /classes/SpecificPrice.php:259
1347
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3254 AND id_shop=1 LIMIT 1
0.186 ms 1 /classes/Product.php:6876
1391
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3155 AND id_shop=1 LIMIT 1
0.186 ms 1 /classes/Product.php:6876
1411
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2892
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.186 ms 0 /classes/SpecificPrice.php:259
2291
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 6176) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.186 ms 1 /classes/stock/StockAvailable.php:453
3706
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4932
0.186 ms 1 /classes/Product.php:2902
3790
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 6173
0.186 ms 1 /classes/Product.php:2902
64
SELECT SQL_NO_CACHE format
FROM `hgt78_address_format`
WHERE `id_country` = 8 LIMIT 1
0.185 ms 1 /classes/AddressFormat.php:656
538
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2775
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.185 ms 0 /classes/SpecificPrice.php:259
779
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.185 ms 1 /classes/Product.php:5659
1470
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2490 AND `id_group` = 1 LIMIT 1
0.185 ms 0 /classes/GroupReduction.php:156
1597
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3586 LIMIT 1
0.185 ms 10 /classes/SpecificPrice.php:435
1679
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3749 AND `id_group` = 1 LIMIT 1
0.185 ms 0 /classes/GroupReduction.php:156
1908
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3808
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.185 ms 0 /classes/SpecificPrice.php:259
2350
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 182 LIMIT 1
0.185 ms 1 /classes/Product.php:5659
3149
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 10304 AND id_shop=1 LIMIT 1
0.185 ms 1 /classes/Product.php:6876
3628
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3748
0.185 ms 1 /classes/Product.php:2902
463
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2623 AND id_shop=1 LIMIT 1
0.184 ms 1 /classes/Product.php:6876
586
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2661 AND `id_group` = 1 LIMIT 1
0.184 ms 0 /classes/GroupReduction.php:156
961
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2633 AND `id_group` = 1 LIMIT 1
0.184 ms 0 /classes/GroupReduction.php:156
2372
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 182 LIMIT 1
0.184 ms 1 /classes/Product.php:5659
2484
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 6195
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.184 ms 0 /classes/SpecificPrice.php:259
3769
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 5972
0.184 ms 1 /classes/Product.php:2902
3787
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 6172
0.184 ms 1 /classes/Product.php:2902
1856
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3777 AND `id_group` = 1 LIMIT 1
0.184 ms 0 /classes/GroupReduction.php:156
275
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 5139 AND id_shop=1 LIMIT 1
0.183 ms 1 /classes/Product.php:6876
494
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2769
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.183 ms 0 /classes/SpecificPrice.php:259
509
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2770 AND `id_group` = 1 LIMIT 1
0.183 ms 0 /classes/GroupReduction.php:156
696
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2779 AND id_shop=1 LIMIT 1
0.183 ms 1 /classes/Product.php:6876
784
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3176 AND id_shop=1 LIMIT 1
0.183 ms 1 /classes/Product.php:6876
1750
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.183 ms 1 /classes/Product.php:5659
836
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3179
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.182 ms 0 /classes/SpecificPrice.php:259
1630
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3745 LIMIT 1
0.182 ms 10 /classes/SpecificPrice.php:435
2333
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 6180 AND id_shop=1 LIMIT 1
0.182 ms 1 /classes/Product.php:6876
160
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 6727 LIMIT 1
0.182 ms 10 /classes/SpecificPrice.php:435
693
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2779
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.182 ms 0 /classes/SpecificPrice.php:259
796
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2794 AND `id_group` = 1 LIMIT 1
0.182 ms 0 /classes/GroupReduction.php:156
845
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 182 LIMIT 1
0.182 ms 1 /classes/Product.php:5659
872
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2790 AND id_shop=1 LIMIT 1
0.182 ms 1 /classes/Product.php:6876
1330
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `hgt78_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 95 LIMIT 1
0.182 ms 1 /classes/Category.php:1378
293
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 5137 LIMIT 1
0.181 ms 10 /classes/SpecificPrice.php:435
304
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 5136 LIMIT 1
0.181 ms 10 /classes/SpecificPrice.php:435
759
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3178
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.181 ms 0 /classes/SpecificPrice.php:259
2229
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 178 LIMIT 1
0.181 ms 1 /classes/Product.php:5659
270
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 309 LIMIT 1
0.180 ms 1 /classes/Product.php:5659
527
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2774
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.180 ms 0 /classes/SpecificPrice.php:259
646
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `hgt78_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 181 LIMIT 1
0.180 ms 1 /classes/Category.php:1378
857
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2789 LIMIT 1
0.180 ms 10 /classes/SpecificPrice.php:435
2030
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4964 LIMIT 1
0.180 ms 10 /classes/SpecificPrice.php:435
2234
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 6108 AND id_shop=1 LIMIT 1
0.180 ms 1 /classes/Product.php:6876
308
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 5136 AND id_shop=1 LIMIT 1
0.179 ms 1 /classes/Product.php:6876
1370
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3265 AND `id_group` = 1 LIMIT 1
0.179 ms 0 /classes/GroupReduction.php:156
2089
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 5284 AND id_shop=1 LIMIT 1
0.179 ms 1 /classes/Product.php:6876
3775
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 6047
0.179 ms 1 /classes/Product.php:2902
3625
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3747
0.179 ms 1 /classes/Product.php:2902
663
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2764 AND id_shop=1 LIMIT 1
0.178 ms 1 /classes/Product.php:6876
1380
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3326 AND id_shop=1 LIMIT 1
0.178 ms 1 /classes/Product.php:6876
1623
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3689 AND id_shop=1 LIMIT 1
0.178 ms 1 /classes/Product.php:6876
1797
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3765
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.178 ms 0 /classes/SpecificPrice.php:259
319
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 5135 AND id_shop=1 LIMIT 1
0.178 ms 1 /classes/Product.php:6876
542
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2775 AND `id_group` = 1 LIMIT 1
0.178 ms 0 /classes/GroupReduction.php:156
1344
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3254
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.178 ms 0 /classes/SpecificPrice.php:259
1775
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3763
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.178 ms 0 /classes/SpecificPrice.php:259
1779
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3763 AND `id_group` = 1 LIMIT 1
0.178 ms 0 /classes/GroupReduction.php:156
3430
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2631
0.178 ms 1 /classes/Product.php:2902
582
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2661
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.177 ms 0 /classes/SpecificPrice.php:259
1200
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2648
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.177 ms 0 /classes/SpecificPrice.php:259
1492
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2733 AND `id_group` = 1 LIMIT 1
0.177 ms 0 /classes/GroupReduction.php:156
1890
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3806 AND `id_group` = 1 LIMIT 1
0.177 ms 0 /classes/GroupReduction.php:156
3472
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3459
0.177 ms 1 /classes/Product.php:2902
671
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2777
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.177 ms 0 /classes/SpecificPrice.php:259
2153
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 5591
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.177 ms 0 /classes/SpecificPrice.php:259
1237
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2649 AND `id_group` = 1 LIMIT 1
0.176 ms 0 /classes/GroupReduction.php:156
3718
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4943
0.176 ms 1 /classes/Product.php:2902
281
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 309 LIMIT 1
0.176 ms 1 /classes/Product.php:5659
326
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 5134 LIMIT 1
0.176 ms 10 /classes/SpecificPrice.php:435
1101
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2622
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.176 ms 0 /classes/SpecificPrice.php:259
2008
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4944 LIMIT 1
0.176 ms 10 /classes/SpecificPrice.php:435
265
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 5140 AND `id_group` = 1 LIMIT 1
0.175 ms 0 /classes/GroupReduction.php:156
498
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2769 AND `id_group` = 1 LIMIT 1
0.175 ms 0 /classes/GroupReduction.php:156
624
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.175 ms 1 /classes/Product.php:5659
719
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2797 AND `id_group` = 1 LIMIT 1
0.175 ms 0 /classes/GroupReduction.php:156
1620
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3689
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.175 ms 1 /classes/SpecificPrice.php:259
2042
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4965
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.175 ms 0 /classes/SpecificPrice.php:259
2330
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 6180
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.175 ms 0 /classes/SpecificPrice.php:259
2429
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 6189
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.175 ms 0 /classes/SpecificPrice.php:259
2476
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 6194 AND id_shop=1 LIMIT 1
0.175 ms 1 /classes/Product.php:6876
3196
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 11001 AND `id_group` = 1 LIMIT 1
0.175 ms 0 /classes/GroupReduction.php:156
2090
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 5284 AND `id_group` = 1 LIMIT 1
0.174 ms 0 /classes/GroupReduction.php:156
2097
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 5293
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.174 ms 0 /classes/SpecificPrice.php:259
2934
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 9691 AND `id_group` = 1 LIMIT 1
0.174 ms 0 /classes/GroupReduction.php:156
3727
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4964
0.174 ms 1 /classes/Product.php:2902
3793
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 6174
0.174 ms 1 /classes/Product.php:2902
1834
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3775 AND `id_group` = 1 LIMIT 1
0.174 ms 0 /classes/GroupReduction.php:156
730
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2798 AND `id_group` = 1 LIMIT 1
0.173 ms 0 /classes/GroupReduction.php:156
928
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2635 AND `id_group` = 1 LIMIT 1
0.173 ms 0 /classes/GroupReduction.php:156
1773
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 174 LIMIT 1
0.173 ms 1 /classes/Product.php:5659
613
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.173 ms 1 /classes/Product.php:5659
2296
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 6177 LIMIT 1
0.173 ms 10 /classes/SpecificPrice.php:435
635
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 182 LIMIT 1
0.172 ms 1 /classes/Product.php:5659
664
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2764 AND `id_group` = 1 LIMIT 1
0.172 ms 0 /classes/GroupReduction.php:156
984
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2782 AND `id_group` = 1 LIMIT 1
0.172 ms 0 /classes/GroupReduction.php:156
1475
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.172 ms 1 /classes/Product.php:5659
2433
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 6189 AND `id_group` = 1 LIMIT 1
0.172 ms 0 /classes/GroupReduction.php:156
675
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2777 AND `id_group` = 1 LIMIT 1
0.172 ms 0 /classes/GroupReduction.php:156
1154
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.172 ms 1 /classes/Product.php:5659
658
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 182 LIMIT 1
0.171 ms 1 /classes/Product.php:5659
2449
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 182 LIMIT 1
0.171 ms 1 /classes/Product.php:5659
1319
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.170 ms 1 /classes/Product.php:5659
470
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 182 LIMIT 1
0.170 ms 1 /classes/Product.php:5659
531
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2774 AND `id_group` = 1 LIMIT 1
0.170 ms 0 /classes/GroupReduction.php:156
1761
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.170 ms 1 /classes/Product.php:5659
1968
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4934 AND `id_group` = 1 LIMIT 1
0.170 ms 0 /classes/GroupReduction.php:156
2231
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 6108
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.170 ms 0 /classes/SpecificPrice.php:259
3781
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 6108
0.170 ms 1 /classes/Product.php:2902
487
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2768 AND `id_group` = 1 LIMIT 1
0.169 ms 0 /classes/GroupReduction.php:156
1400
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2818
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.169 ms 0 /classes/SpecificPrice.php:259
1602
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3586 AND `id_group` = 1 LIMIT 1
0.169 ms 0 /classes/GroupReduction.php:156
1923
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4256 AND `id_group` = 1 LIMIT 1
0.169 ms 0 /classes/GroupReduction.php:156
1998
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4943
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.169 ms 0 /classes/SpecificPrice.php:259
3424
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2659
0.169 ms 1 /classes/Product.php:2902
660
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2764
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.168 ms 0 /classes/SpecificPrice.php:259
1755
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3756 AND id_shop=1 LIMIT 1
0.168 ms 1 /classes/Product.php:6876
2274
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 6174 LIMIT 1
0.168 ms 10 /classes/SpecificPrice.php:435
1138
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2625 AND `id_group` = 1 LIMIT 1
0.168 ms 0 /classes/GroupReduction.php:156
1366
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3265
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.167 ms 0 /classes/SpecificPrice.php:259
2046
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4965 AND `id_group` = 1 LIMIT 1
0.167 ms 0 /classes/GroupReduction.php:156
591
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.167 ms 1 /classes/Product.php:5659
1062
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2628) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.167 ms 1 /classes/stock/StockAvailable.php:453
1576
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3584
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.167 ms 0 /classes/SpecificPrice.php:259
1823
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3771 AND `id_group` = 1 LIMIT 1
0.166 ms 0 /classes/GroupReduction.php:156
464
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2623 AND `id_group` = 1 LIMIT 1
0.166 ms 0 /classes/GroupReduction.php:156
1060
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2628 AND id_shop=1 LIMIT 1
0.166 ms 1 /classes/Product.php:6876
1388
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3155
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.166 ms 0 /classes/SpecificPrice.php:259
2224
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 6107 AND `id_group` = 1 LIMIT 1
0.166 ms 0 /classes/GroupReduction.php:156
3418
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2792
0.166 ms 1 /classes/Product.php:2902
320
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 5135 AND `id_group` = 1 LIMIT 1
0.165 ms 0 /classes/GroupReduction.php:156
626
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2693
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.165 ms 0 /classes/SpecificPrice.php:259
637
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2771
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.165 ms 1 /classes/SpecificPrice.php:259
1409
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.165 ms 1 /classes/Product.php:5659
1984
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `hgt78_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 190 LIMIT 1
0.165 ms 1 /classes/Category.php:1378
2300
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 6177 AND id_shop=1 LIMIT 1
0.165 ms 1 /classes/Product.php:6876
2378
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 6184 AND `id_group` = 1 LIMIT 1
0.165 ms 0 /classes/GroupReduction.php:156
3454
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2639
0.165 ms 1 /classes/Product.php:2902
330
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 5134 AND id_shop=1 LIMIT 1
0.164 ms 1 /classes/Product.php:6876
2001
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4943 AND id_shop=1 LIMIT 1
0.164 ms 1 /classes/Product.php:6876
2051
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.164 ms 1 /classes/Product.php:5659
2454
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 6192 AND id_shop=1 LIMIT 1
0.164 ms 1 /classes/Product.php:6876
2455
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 6192 AND `id_group` = 1 LIMIT 1
0.164 ms 0 /classes/GroupReduction.php:156
2619
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 7769
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.164 ms 0 /classes/SpecificPrice.php:259
3757
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 5590
0.164 ms 1 /classes/Product.php:2902
895
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2792 AND `id_group` = 1 LIMIT 1
0.163 ms 0 /classes/GroupReduction.php:156
2923
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 9690 AND `id_group` = 1 LIMIT 1
0.163 ms 0 /classes/GroupReduction.php:156
3427
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2635
0.162 ms 1 /classes/Product.php:2902
176
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 5148 AND id_shop=1 LIMIT 1
0.162 ms 1 /classes/Product.php:6876
840
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3179 AND `id_group` = 1 LIMIT 1
0.162 ms 0 /classes/GroupReduction.php:156
2416
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 182 LIMIT 1
0.162 ms 1 /classes/Product.php:5659
1392
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3155 AND `id_group` = 1 LIMIT 1
0.161 ms 0 /classes/GroupReduction.php:156
1624
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3689 AND `id_group` = 1 LIMIT 1
0.161 ms 0 /classes/GroupReduction.php:156
2268
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 6173 AND `id_group` = 1 LIMIT 1
0.161 ms 0 /classes/GroupReduction.php:156
2289
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 6176 AND id_shop=1 LIMIT 1
0.161 ms 1 /classes/Product.php:6876
2355
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 6182 AND id_shop=1 LIMIT 1
0.161 ms 1 /classes/Product.php:6876
286
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 5138 AND id_shop=1 LIMIT 1
0.161 ms 1 /classes/Product.php:6876
1525
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3454 AND `id_group` = 1 LIMIT 1
0.160 ms 0 /classes/GroupReduction.php:156
65
SELECT SQL_NO_CACHE `need_identification_number`
FROM `hgt78_country`
WHERE `id_country` = 8 LIMIT 1
0.160 ms 1 /classes/Country.php:405
1045
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2629 LIMIT 1
0.160 ms 10 /classes/SpecificPrice.php:435
2157
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 5591 AND `id_group` = 1 LIMIT 1
0.160 ms 0 /classes/GroupReduction.php:156
1072
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3477 AND `id_group` = 1 LIMIT 1
0.159 ms 0 /classes/GroupReduction.php:156
1324
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2645 AND id_shop=1 LIMIT 1
0.159 ms 1 /classes/Product.php:6876
25
SELECT SQL_NO_CACHE c.id_currency
FROM `hgt78_currency` c
WHERE (iso_code = 'EUR') LIMIT 1
0.158 ms 1 /classes/Currency.php:893
1369
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3265 AND id_shop=1 LIMIT 1
0.158 ms 1 /classes/Product.php:6876
697
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2779 AND `id_group` = 1 LIMIT 1
0.158 ms 0 /classes/GroupReduction.php:156
170
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `hgt78_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 309 LIMIT 1
0.157 ms 1 /classes/Category.php:1378
1532
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3455
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.157 ms 1 /classes/SpecificPrice.php:259
1596
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.157 ms 1 /classes/Product.php:5659
1723
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3753 AND `id_group` = 1 LIMIT 1
0.157 ms 0 /classes/GroupReduction.php:156
2146
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 5590 AND `id_group` = 1 LIMIT 1
0.157 ms 0 /classes/GroupReduction.php:156
2418
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 6188
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.157 ms 0 /classes/SpecificPrice.php:259
2529
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 7938 LIMIT 1
0.156 ms 10 /classes/SpecificPrice.php:435
629
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2693 AND id_shop=1 LIMIT 1
0.156 ms 1 /classes/Product.php:6876
1547
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3484 AND `id_group` = 1 LIMIT 1
0.155 ms 0 /classes/GroupReduction.php:156
210
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 5145 AND `id_group` = 1 LIMIT 1
0.155 ms 0 /classes/GroupReduction.php:156
336
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 309 LIMIT 1
0.155 ms 1 /classes/Product.php:5659
652
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2738 AND id_shop=1 LIMIT 1
0.155 ms 1 /classes/Product.php:6876
850
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2788 AND id_shop=1 LIMIT 1
0.155 ms 1 /classes/Product.php:6876
2407
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 6187
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.155 ms 0 /classes/SpecificPrice.php:259
607
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2691 AND id_shop=1 LIMIT 1
0.154 ms 1 /classes/Product.php:6876
1629
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.154 ms 1 /classes/Product.php:5659
1635
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3745 AND `id_group` = 1 LIMIT 1
0.154 ms 0 /classes/GroupReduction.php:156
2002
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4943 AND `id_group` = 1 LIMIT 1
0.154 ms 0 /classes/GroupReduction.php:156
2308
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 6178
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.154 ms 0 /classes/SpecificPrice.php:259
3475
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2622
0.154 ms 1 /classes/Product.php:2902
1066
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.153 ms 1 /classes/Product.php:5659
453
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2651 AND `id_group` = 1 LIMIT 1
0.153 ms 0 /classes/GroupReduction.php:156
292
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 309 LIMIT 1
0.152 ms 1 /classes/Product.php:5659
1321
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2645
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.152 ms 0 /classes/SpecificPrice.php:259
2527
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `hgt78_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 320 LIMIT 1
0.152 ms 1 /classes/Category.php:1378
1094
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3459 AND `id_group` = 1 LIMIT 1
0.152 ms 0 /classes/GroupReduction.php:156
1587
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3585
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.152 ms 0 /classes/SpecificPrice.php:259
2253
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 6172
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.152 ms 0 /classes/SpecificPrice.php:259
303
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 309 LIMIT 1
0.151 ms 1 /classes/Product.php:5659
618
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2692 AND id_shop=1 LIMIT 1
0.151 ms 1 /classes/Product.php:6876
187
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 5147 AND id_shop=1 LIMIT 1
0.151 ms 1 /classes/Product.php:6876
1156
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2627
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.151 ms 0 /classes/SpecificPrice.php:259
1552
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.151 ms 1 /classes/Product.php:5659
2256
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 6172 AND id_shop=1 LIMIT 1
0.151 ms 1 /classes/Product.php:6876
1590
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3585 AND id_shop=1 LIMIT 1
0.150 ms 1 /classes/Product.php:6876
204
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 309 LIMIT 1
0.149 ms 1 /classes/Product.php:5659
604
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2691
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.149 ms 0 /classes/SpecificPrice.php:259
1448
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3132 AND `id_group` = 1 LIMIT 1
0.149 ms 0 /classes/GroupReduction.php:156
1514
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2654 AND `id_group` = 1 LIMIT 1
0.149 ms 0 /classes/GroupReduction.php:156
2295
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 182 LIMIT 1
0.149 ms 1 /classes/Product.php:5659
2311
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 6178 AND id_shop=1 LIMIT 1
0.149 ms 1 /classes/Product.php:6876
1127
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2624 AND `id_group` = 1 LIMIT 1
0.148 ms 0 /classes/GroupReduction.php:156
198
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 5146 AND id_shop=1 LIMIT 1
0.148 ms 1 /classes/Product.php:6876
597
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2690 AND `id_group` = 1 LIMIT 1
0.147 ms 0 /classes/GroupReduction.php:156
1068
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3477
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.147 ms 0 /classes/SpecificPrice.php:259
1477
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2621
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.147 ms 1 /classes/SpecificPrice.php:259
2912
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 9689 AND `id_group` = 1 LIMIT 1
0.147 ms 0 /classes/GroupReduction.php:156
785
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3176 AND `id_group` = 1 LIMIT 1
0.147 ms 0 /classes/GroupReduction.php:156
1455
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3327
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.147 ms 0 /classes/SpecificPrice.php:259
1530
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 185 LIMIT 1
0.146 ms 1 /classes/Product.php:5659
1565
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3558
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.146 ms 0 /classes/SpecificPrice.php:259
2901
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 9688 AND `id_group` = 1 LIMIT 1
0.146 ms 0 /classes/GroupReduction.php:156
325
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 309 LIMIT 1
0.146 ms 1 /classes/Product.php:5659
615
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2692
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.146 ms 0 /classes/SpecificPrice.php:259
1110
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.146 ms 1 /classes/Product.php:5659
2383
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 182 LIMIT 1
0.146 ms 1 /classes/Product.php:5659
1458
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3327 AND id_shop=1 LIMIT 1
0.145 ms 1 /classes/Product.php:6876
1535
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3455 AND id_shop=1 LIMIT 1
0.145 ms 1 /classes/Product.php:6876
1554
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3556
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.145 ms 1 /classes/SpecificPrice.php:259
1557
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3556 AND id_shop=1 LIMIT 1
0.145 ms 1 /classes/Product.php:6876
2246
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 6129 AND `id_group` = 1 LIMIT 1
0.145 ms 0 /classes/GroupReduction.php:156
2352
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 6182
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.145 ms 0 /classes/SpecificPrice.php:259
2389
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 6185 AND `id_group` = 1 LIMIT 1
0.145 ms 0 /classes/GroupReduction.php:156
1480
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2621 AND id_shop=1 LIMIT 1
0.143 ms 1 /classes/Product.php:6876
1763
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3757
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.143 ms 0 /classes/SpecificPrice.php:259
1057
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2628
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.142 ms 0 /classes/SpecificPrice.php:259
1790
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3764 AND `id_group` = 1 LIMIT 1
0.142 ms 0 /classes/GroupReduction.php:156
649
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2738
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.142 ms 0 /classes/SpecificPrice.php:259
939
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2631 AND `id_group` = 1 LIMIT 1
0.142 ms 0 /classes/GroupReduction.php:156
1481
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2621 AND `id_group` = 1 LIMIT 1
0.142 ms 0 /classes/GroupReduction.php:156
2273
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 182 LIMIT 1
0.142 ms 1 /classes/Product.php:5659
653
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2738 AND `id_group` = 1 LIMIT 1
0.141 ms 0 /classes/GroupReduction.php:156
1083
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2620 AND `id_group` = 1 LIMIT 1
0.141 ms 0 /classes/GroupReduction.php:156
1979
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4935 AND `id_group` = 1 LIMIT 1
0.141 ms 0 /classes/GroupReduction.php:156
861
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2789 AND id_shop=1 LIMIT 1
0.140 ms 1 /classes/Product.php:6876
1176
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.140 ms 1 /classes/Product.php:5659
276
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 5139 AND `id_group` = 1 LIMIT 1
0.140 ms 0 /classes/GroupReduction.php:156
283
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 5138
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.140 ms 0 /classes/SpecificPrice.php:259
2344
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 6181 AND id_shop=1 LIMIT 1
0.140 ms 1 /classes/Product.php:6876
1996
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 190 LIMIT 1
0.139 ms 1 /classes/Product.php:5659
1050
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2629 AND `id_group` = 1 LIMIT 1
0.137 ms 0 /classes/GroupReduction.php:156
2521
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 6501 AND id_shop=1 LIMIT 1
0.137 ms 1 /classes/Product.php:6876
305
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 5136
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.137 ms 0 /classes/SpecificPrice.php:259
2024
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4963 AND `id_group` = 1 LIMIT 1
0.137 ms 0 /classes/GroupReduction.php:156
2341
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 6181
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.136 ms 1 /classes/SpecificPrice.php:259
858
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2789
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.136 ms 0 /classes/SpecificPrice.php:259
1016
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2638 AND id_shop=1 LIMIT 1
0.136 ms 1 /classes/Product.php:6876
1337
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3252 AND `id_group` = 1 LIMIT 1
0.136 ms 0 /classes/GroupReduction.php:156
2322
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 6179 AND id_shop=1 LIMIT 1
0.135 ms 1 /classes/Product.php:6876
2366
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 6183 AND id_shop=1 LIMIT 1
0.135 ms 1 /classes/Product.php:6876
2978
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 9695 AND `id_group` = 1 LIMIT 1
0.135 ms 0 /classes/GroupReduction.php:156
294
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 5137
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.134 ms 0 /classes/SpecificPrice.php:259
2319
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 6179
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.134 ms 0 /classes/SpecificPrice.php:259
856
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 182 LIMIT 1
0.133 ms 1 /classes/Product.php:5659
1044
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.133 ms 1 /classes/Product.php:5659
1171
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2640 AND `id_group` = 1 LIMIT 1
0.133 ms 0 /classes/GroupReduction.php:156
184
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 5147
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.133 ms 0 /classes/SpecificPrice.php:259
647
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 181 LIMIT 1
0.132 ms 1 /classes/Product.php:5659
1766
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3757 AND id_shop=1 LIMIT 1
0.132 ms 1 /classes/Product.php:6876
2018
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 38 LIMIT 1
0.132 ms 1 /classes/Product.php:5659
1543
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3484
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.132 ms 0 /classes/SpecificPrice.php:259
630
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2693 AND `id_group` = 1 LIMIT 1
0.131 ms 0 /classes/GroupReduction.php:156
1987
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4942
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.131 ms 0 /classes/SpecificPrice.php:259
608
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2691 AND `id_group` = 1 LIMIT 1
0.130 ms 0 /classes/GroupReduction.php:156
1598
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3586
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.130 ms 0 /classes/SpecificPrice.php:259
2528
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 320 LIMIT 1
0.130 ms 1 /classes/Product.php:5659
2257
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 6172 AND `id_group` = 1 LIMIT 1
0.129 ms 0 /classes/GroupReduction.php:156
150
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 7539
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.128 ms 0 /classes/SpecificPrice.php:259
327
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 5134
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.128 ms 0 /classes/SpecificPrice.php:259
641
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2771 AND `id_group` = 1 LIMIT 1
0.128 ms 0 /classes/GroupReduction.php:156
2334
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 6180 AND `id_group` = 1 LIMIT 1
0.127 ms 0 /classes/GroupReduction.php:156
1028
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2639 AND `id_group` = 1 LIMIT 1
0.126 ms 0 /classes/GroupReduction.php:156
1061
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2628 AND `id_group` = 1 LIMIT 1
0.126 ms 0 /classes/GroupReduction.php:156
298
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 5137 AND `id_group` = 1 LIMIT 1
0.125 ms 0 /classes/GroupReduction.php:156
206
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 5145
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.123 ms 0 /classes/SpecificPrice.php:259
1536
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3455 AND `id_group` = 1 LIMIT 1
0.123 ms 0 /classes/GroupReduction.php:156
173
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 5148
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.122 ms 0 /classes/SpecificPrice.php:259
195
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 5146
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.122 ms 0 /classes/SpecificPrice.php:259
287
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 5138 AND `id_group` = 1 LIMIT 1
0.122 ms 0 /classes/GroupReduction.php:156
1591
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3585 AND `id_group` = 1 LIMIT 1
0.122 ms 0 /classes/GroupReduction.php:156
1558
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3556 AND `id_group` = 1 LIMIT 1
0.121 ms 0 /classes/GroupReduction.php:156
161
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 6727
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.121 ms 0 /classes/SpecificPrice.php:259
619
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2692 AND `id_group` = 1 LIMIT 1
0.121 ms 0 /classes/GroupReduction.php:156
2363
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 6183
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.119 ms 0 /classes/SpecificPrice.php:259
1459
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3327 AND `id_group` = 1 LIMIT 1
0.118 ms 0 /classes/GroupReduction.php:156
2297
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 6177
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.118 ms 0 /classes/SpecificPrice.php:259
2301
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 6177 AND `id_group` = 1 LIMIT 1
0.116 ms 0 /classes/GroupReduction.php:156
1985
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 190 LIMIT 1
0.116 ms 1 /classes/Product.php:5659
851
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2788 AND `id_group` = 1 LIMIT 1
0.113 ms 0 /classes/GroupReduction.php:156
177
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 5148 AND `id_group` = 1 LIMIT 1
0.110 ms 0 /classes/GroupReduction.php:156
2522
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 6501 AND `id_group` = 1 LIMIT 1
0.110 ms 0 /classes/GroupReduction.php:156
1039
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2630 AND `id_group` = 1 LIMIT 1
0.109 ms 0 /classes/GroupReduction.php:156
165
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 6727 AND `id_group` = 1 LIMIT 1
0.109 ms 0 /classes/GroupReduction.php:156
171
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 309 LIMIT 1
0.109 ms 1 /classes/Product.php:5659
2345
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 6181 AND `id_group` = 1 LIMIT 1
0.109 ms 0 /classes/GroupReduction.php:156
1017
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2638 AND `id_group` = 1 LIMIT 1
0.108 ms 0 /classes/GroupReduction.php:156
2323
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 6179 AND `id_group` = 1 LIMIT 1
0.108 ms 0 /classes/GroupReduction.php:156
199
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 5146 AND `id_group` = 1 LIMIT 1
0.107 ms 0 /classes/GroupReduction.php:156
188
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 5147 AND `id_group` = 1 LIMIT 1
0.106 ms 0 /classes/GroupReduction.php:156
2367
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 6183 AND `id_group` = 1 LIMIT 1
0.105 ms 0 /classes/GroupReduction.php:156

Doubles

287 queries
SELECT *
FROM `hgtXX_product` a
LEFT JOIN `hgtXX_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = XX
LEFT JOIN `hgtXX_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = XX
WHERE (a.`id_product` = XX) AND (b.`id_shop` = XX) LIMIT XX
280 queries
SELECT XX FROM `hgtXX_specific_price` WHERE id_product = XX LIMIT XX
279 queries
SELECT image_shop.`id_image`
                    FROM `hgtXX_image` i
                     INNER JOIN hgtXX_image_shop image_shop
        ON (image_shop.id_image = i.id_image AND image_shop.id_shop = XX)
                    WHERE i.`id_product` = XX
                    AND image_shop.`cover` = XX LIMIT XX
279 queries
SELECT name FROM hgtXX_category_lang WHERE id_shop = XX AND id_lang = XX AND id_category = XX LIMIT XX
279 queries
				SELECT `priority`, `id_specific_price_priority`
				FROM `hgtXX_specific_price_priority`
				WHERE `id_product` = XX
				ORDER BY `id_specific_price_priority` DESC LIMIT XX
279 queries
			SELECT *, ( IF (`id_group` = XX, XX, XX) +  IF (`id_country` = XX, XX, XX) +  IF (`id_currency` = XX, XX, XX) +  IF (`id_shop` = XX, XX, XX) +  IF (`id_customer` = XX, XX, XX)) AS `score`
				FROM `hgtXX_specific_price`
				WHERE
                `id_shop` IN (XX, XX) AND
                `id_currency` IN (XX, XX) AND
                `id_country` IN (XX, XX) AND
                `id_group` IN (XX, XX) AND `id_product` = XX AND `id_customer` = XX AND `id_product_attribute` = XX AND `id_cart` = XX  AND (`from` = 'XX-XX-XX XX:XX:XX' OR 'XX-XX-XX XX:XX:XX' >= `from`) AND (`to` = 'XX-XX-XX XX:XX:XX' OR 'XX-XX-XX XX:XX:XX' <= `to`)
				AND IF(`from_quantity` > XX, `from_quantity`, XX) <= XX ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT XX
279 queries
SELECT product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,XX) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgtXX_product` p
INNER JOIN `hgtXX_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = XX)
LEFT JOIN `hgtXX_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = XX)
WHERE (p.`id_product` = XX)
279 queries
                            SELECT `id_tax_rules_group`
                            FROM `hgtXX_product_shop`
                            WHERE `id_product` = XX AND id_shop=XX LIMIT XX
279 queries
			SELECT `reduction`
			FROM `hgtXX_product_group_reduction_cache`
			WHERE `id_product` = XX AND `id_group` = XX LIMIT XX
279 queries
SELECT SUM(quantity)
FROM `hgtXX_stock_available`
WHERE (id_product = XX) AND (id_product_attribute = XX) AND (id_shop = XX) AND (id_shop_group = XX) LIMIT XX
279 queries
SELECT
            COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), XX) as deep_quantity,
            COALESCE(SUM(first_level_quantity), XX) as quantity
          FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, XX as pack_quantity
          FROM `hgtXX_cart_product` cp
            WHERE cp.`id_product_attribute` = XX
            
            AND cp.`id_cart` = XX AND cp.`id_product` = XX UNION SELECT XX as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
          FROM `hgtXX_cart_product` cp JOIN `hgtXX_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgtXX_product` pr ON p.`id_product_pack` = pr.`id_product`
            WHERE cp.`id_product_attribute` = XX
            
            AND cp.`id_cart` = XX AND p.`id_product_item` = XX AND (pr.`pack_stock_type` IN (XX,XX) OR (
            pr.`pack_stock_type` = XX
            AND XX = XX
        ))) as q LIMIT XX
279 queries
                SELECT name, value, pf.id_feature, f.position, fvl.id_feature_value
                FROM hgtXX_feature_product pf
                LEFT JOIN hgtXX_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = XX)
                LEFT JOIN hgtXX_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = XX)
                LEFT JOIN hgtXX_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = XX)
                 INNER JOIN hgtXX_feature_shop feature_shop
        ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = XX)
                WHERE pf.id_product = XX
                ORDER BY f.position ASC
279 queries
            SELECT image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
            FROM `hgtXX_image` i
             INNER JOIN hgtXX_image_shop image_shop
        ON (image_shop.id_image = i.id_image AND image_shop.id_shop = XX)
            LEFT JOIN `hgtXX_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = XX)
            WHERE i.`id_product` = XX
            ORDER BY `position`
279 queries
SELECT pa.`id_product`, a.`color`, pac.`id_product_attribute`, XX qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
            FROM `hgtXX_product_attribute` pa
             INNER JOIN hgtXX_product_attribute_shop product_attribute_shop
        ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = XX)
            JOIN `hgtXX_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
            JOIN `hgtXX_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
            JOIN `hgtXX_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = XX)
            JOIN `hgtXX_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
            WHERE pa.`id_product` IN (XX) AND ag.`is_color_group` = XX
            GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
            
            ORDER BY a.`position` ASC;
278 queries
SELECT `id_product_attribute`
            FROM `hgtXX_product_attribute`
            WHERE `id_product` = XX
71 queries
SELECT *
FROM `hgtXX_category` a
LEFT JOIN `hgtXX_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = XX
WHERE (a.`id_category` = XX) LIMIT XX
71 queries
SELECT *
							FROM `hgtXX_category_lang`
							WHERE `id_category` = XX AND `id_shop` = XX
27 queries
SELECT *
FROM `hgtXX_category` a
LEFT JOIN `hgtXX_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = XX
LEFT JOIN `hgtXX_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = XX
WHERE (a.`id_category` = XX) AND (b.`id_shop` = XX) LIMIT XX
21 queries
			SELECT cl.`link_rewrite`
			FROM `hgtXX_category_lang` cl
			WHERE `id_lang` = XX
			 AND cl.id_shop = XX 
			AND cl.`id_category` = XX LIMIT XX
18 queries
				SELECT c.*, cl.*
				FROM `hgtXX_category` c
				 INNER JOIN hgtXX_category_shop category_shop
        ON (category_shop.id_category = c.id_category AND category_shop.id_shop = XX)
				LEFT JOIN `hgtXX_category_lang` cl ON c.`id_category` = cl.`id_category` AND cl.id_shop = XX 
				LEFT JOIN `hgtXX_category_group` cg ON c.`id_category` = cg.`id_category`
				RIGHT JOIN `hgtXX_category` cXX ON cXX.`id_category` = XX AND c.`nleft` >= cXX.`nleft` AND c.`nright` <= cXX.`nright`
				WHERE XX  AND `id_lang` = XX
				 AND c.`active` = XX
				 AND cg.`id_group` IN (XX)
				 GROUP BY c.`id_category`
				 ORDER BY c.`level_depth` ASC
				, category_shop.`position` ASC
				
10 queries
SELECT `id_module` FROM `hgtXX_module_shop` WHERE `id_module` = XX AND `id_shop` = XX LIMIT XX
4 queries
SELECT `id_lang` FROM `hgtXX_lang`
                    WHERE `locale` = 'fr-fr'
                    OR `language_code` = 'fr-fr' LIMIT XX
3 queries
							SELECT `name`
							FROM `hgtXX_hook`
							WHERE `id_hook` = XX LIMIT XX
3 queries
				SELECT tr.*
				FROM `hgtXX_tax_rule` tr
				JOIN `hgtXX_tax_rules_group` trg ON (tr.`id_tax_rules_group` = trg.`id_tax_rules_group`)
				WHERE trg.`active` = XX
				AND tr.`id_country` = XX
				AND tr.`id_tax_rules_group` = XX
				AND tr.`id_state` IN (XX, XX)
				AND ('XX' BETWEEN tr.`zipcode_from` AND tr.`zipcode_to`
					OR (tr.`zipcode_to` = XX AND tr.`zipcode_from` IN(XX, 'XX')))
				ORDER BY tr.`zipcode_from` DESC, tr.`zipcode_to` DESC, tr.`id_state` DESC, tr.`id_country` DESC
2 queries
SELECT lower(name) as name
FROM `hgtXX_hook` h
WHERE (h.active = XX)
2 queries
SELECT h.`name` as hook, m.`id_module`, h.`id_hook`, m.`name` as module
FROM `hgtXX_module` m
 INNER JOIN hgtXX_module_shop module_shop
        ON (module_shop.id_module = m.id_module AND module_shop.id_shop = XX AND module_shop.enable_device & XX)
INNER JOIN `hgtXX_hook_module` `hm` ON hm.`id_module` = m.`id_module`
INNER JOIN `hgtXX_hook` `h` ON hm.`id_hook` = h.`id_hook`
LEFT JOIN `hgtXX_module_group` `mg` ON mg.`id_module` = m.`id_module`
WHERE (h.`name` != "paymentOptions") AND (hm.`id_shop` = XX) AND (mg.id_shop = XX AND  mg.`id_group` IN (XX))
GROUP BY hm.id_hook, hm.id_module
ORDER BY hm.`position`
2 queries
SELECT `name`, `alias` FROM `hgtXX_hook_alias`
2 queries
SELECT `id_hook`, `name` FROM `hgtXX_hook`
2 queries
                SELECT m.`id_module`, m.`name`, ms.`id_module`as `mshop`
                FROM `hgtXX_module` m
                LEFT JOIN `hgtXX_module_shop` ms
                ON m.`id_module` = ms.`id_module`
                AND ms.`id_shop` = XX
2 queries
SELECT name, alias FROM `hgtXX_hook_alias`
2 queries
SELECT * FROM `hgtXX_hook_module_exceptions`
                WHERE `id_shop` IN (XX)
2 queries
SELECT *
FROM `hgtXX_currency` a
LEFT JOIN `hgtXX_currency_lang` `b` ON a.`id_currency` = b.`id_currency` AND b.`id_lang` = XX
LEFT JOIN `hgtXX_currency_shop` `c` ON a.`id_currency` = c.`id_currency` AND c.`id_shop` = XX
WHERE (a.`id_currency` = XX) LIMIT XX
2 queries
SELECT *
FROM `hgtXX_currency` a
LEFT JOIN `hgtXX_currency_shop` `c` ON a.`id_currency` = c.`id_currency` AND c.`id_shop` = XX
WHERE (a.`id_currency` = XX) LIMIT XX
2 queries
SELECT *
							FROM `hgtXX_currency_lang`
							WHERE `id_currency` = XX
2 queries
				SELECT id_shop
				FROM `hgtXX_group_shop`
				WHERE `id_group` = XX
				AND id_shop = XX LIMIT XX
2 queries
		SELECT `id_category`
		FROM `hgtXX_category_shop`
		WHERE `id_category` = XX
		AND `id_shop` = XX LIMIT XX
2 queries
				SELECT ctg.`id_group`
				FROM hgtXX_category_group ctg
				WHERE ctg.`id_category` = XX AND ctg.`id_group` = XX LIMIT XX
2 queries
SELECT *
FROM `hgtXX_shop_url` aXX
2 queries
SELECT XX FROM `hgtXX_cart_rule` WHERE ((date_to >= "XX-XX-XX XX:XX:XX" AND date_to <= "XX-XX-XX XX:XX:XX") OR (date_from >= "XX-XX-XX XX:XX:XX" AND date_from <= "XX-XX-XX XX:XX:XX") OR (date_from < "XX-XX-XX XX:XX:XX" AND date_to > "XX-XX-XX XX:XX:XX")) AND `id_customer` IN (XX,XX) LIMIT XX
2 queries
            SELECT *
            FROM `hgtXX_currency` c
             INNER JOIN hgtXX_currency_shop currency_shop
        ON (currency_shop.id_currency = c.id_currency AND currency_shop.id_shop = XX)
                WHERE c.`deleted` = XX AND c.`active` = XX ORDER BY `iso_code` ASC
2 queries
SELECT buttonXX FROM hgtXX_lgcookieslaw_lang WHERE id_lang = XX LIMIT XX

Tables stress

848 product
848 product_shop
562 specific_price
560 cart_product
558 product_attribute
558 image
558 image_shop
558 product_attribute_shop
423 category_lang
288 product_lang
281 stock_available
280 attribute_group
280 feature
280 feature_shop
280 feature_lang
280 product_attribute_combination
279 specific_price_priority
279 product_group_reduction_cache
279 pack
279 feature_product
279 feature_value_lang
279 image_lang
279 attribute
279 attribute_lang
144 category
120 category_shop
23 category_group
17 module
14 module_shop
12 hook
10 currency
8 currency_shop
7 lang
6 shop_url
5 hook_alias
5 image_type
5 lgcookieslaw_lang
4 shop
4 lang_shop
4 currency_lang
4 cart_rule
3 country
3 hook_module
3 group_shop
3 tax_rule
3 tax_rules_group
2 shop_group
2 configuration
2 country_lang
2 country_shop
2 module_group
2 hook_module_exceptions
2 group
2 category_product
2 cart_rule_lang
2 cms
2 cms_lang
2 cms_shop
2 psgdpr_consent
1 configuration_lang
1 meta
1 meta_lang
1 group_lang
1 feature_flag
1 address_format
1 required_field
1 revslider_sliders
1 carrier
1 carrier_shop
1 carrier_lang
1 carrier_zone
1 carrier_group
1 range_price
1 delivery
1 layered_category
1 attribute_group_shop
1 attribute_group_lang
1 layered_indexable_attribute_group
1 layered_indexable_attribute_group_lang_value
1 layered_indexable_feature
1 layered_indexable_feature_lang_value
1 product_sale
1 layered_filter_block
1 manufacturer
1 tax
1 tax_lang
1 iqit_elementor_category
1 cart_rule_group
1 iqitmegamenu_tabs_shop
1 iqitmegamenu_tabs
1 iqitmegamenu_tabs_lang
1 psgdpr_consent_lang
1 connections

ObjectModel instances

Name Instances Source
Product 295 /classes/Link.php:113 (__construct) [id: 2818]
/classes/Link.php:113 (__construct) [id: 10067]
/classes/Link.php:113 (__construct) [id: 10068]
/classes/Link.php:113 (__construct) [id: 10069]
/classes/Link.php:113 (__construct) [id: 10070]
/classes/Link.php:113 (__construct) [id: 10071]
/classes/Link.php:113 (__construct) [id: 10072]
/classes/Link.php:113 (__construct) [id: 10073]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 7543]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 7542]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 7541]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 7540]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 7539]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 6727]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 5148]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 5147]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 5146]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 5145]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 5144]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 5143]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 5142]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 5141]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 5140]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 5139]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 5138]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 5137]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 5136]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 5135]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 5134]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 5133]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4902]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3743]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3741]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3740]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3587]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2893]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2694]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2660]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2652]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2651]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2623]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2767]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2768]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2769]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2770]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2773]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2774]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2775]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2776]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2766]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2765]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2661]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2690]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2691]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2692]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2693]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2771]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2738]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2764]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2777]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2778]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2779]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2795]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2797]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2798]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2799]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2800]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3178]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3075]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3176]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2794]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2793]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2780]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2781]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3179]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2788]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2789]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2790]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2791]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2792]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3177]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2659]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2635]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2631]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2632]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2633]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2634]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2782]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2636]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2637]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2638]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2639]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2630]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2629]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2628]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3477]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2620]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3459]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2622]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3458]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2624]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2625]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2626]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2627]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2640]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2641]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2656]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2648]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2657]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3456]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2649]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2658]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2647]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2646]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2642]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2643]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2655]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2644]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2645]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3252]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3254]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3264]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3265]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3326]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3155]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2818]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2892]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3099]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3107]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3132]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3327]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2490]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2621]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2733]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2650]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2654]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3454]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3455]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3484]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3556]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3558]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3584]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3585]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3586]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3639]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3689]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3745]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3746]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3747]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3748]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3749]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3750]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3751]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3752]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3753]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3754]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3755]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3756]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3757]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3763]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3764]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3765]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3766]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3771]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3775]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3776]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3777]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3804]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3805]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3806]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3807]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3808]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4256]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4574]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4575]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4932]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4934]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4935]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4942]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4943]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4944]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4963]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4964]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4965]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4966]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 5282]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 5283]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 5284]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 5293]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 5296]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 5093]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 5589]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 5590]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 5591]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 5970]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 5971]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 5972]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 5973]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 6047]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 6107]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 6108]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 6129]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 6172]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 6173]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 6174]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 6176]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 6177]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 6178]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 6179]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 6180]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 6181]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 6182]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 6183]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 6184]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 6185]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 6186]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 6187]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 6188]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 6189]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 6191]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 6192]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 6193]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 6194]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 6195]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 6499]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 6500]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 6501]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 7938]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 7940]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 7941]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 7942]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 7943]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 7944]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 7945]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 7946]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 7769]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 7773]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 8392]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 8393]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 8395]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 8396]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 8397]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 8401]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 8417]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 8418]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 8419]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 8420]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 8975]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 8976]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 9055]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 9321]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 9323]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 9324]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 9325]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 9535]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 9596]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 9597]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 9598]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 9687]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 9686]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 9688]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 9689]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 9690]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 9691]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 9692]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 9693]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 9694]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 9695]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 9697]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 10067]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 10068]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 10069]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 10070]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 10071]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 10072]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 10073]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 10111]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 10297]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 10298]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 10299]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 10302]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 10303]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 10304]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 10305]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 12552]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 12551]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 11001]
/classes/Link.php:113 (__construct) [id: 2818]
/classes/Link.php:113 (__construct) [id: 10067]
/classes/Link.php:113 (__construct) [id: 10068]
/classes/Link.php:113 (__construct) [id: 10069]
/classes/Link.php:113 (__construct) [id: 10070]
/classes/Link.php:113 (__construct) [id: 10071]
/classes/Link.php:113 (__construct) [id: 10072]
/classes/Link.php:113 (__construct) [id: 10073]
Category 105 /controllers/front/listing/CategoryController.php:78 (__construct) [id: 2]
/controllers/front/listing/CategoryController.php:216 (__construct) [id: 33]
/controllers/front/listing/CategoryController.php:216 (__construct) [id: 34]
/controllers/front/listing/CategoryController.php:216 (__construct) [id: 35]
/controllers/front/listing/CategoryController.php:216 (__construct) [id: 36]
/controllers/front/listing/CategoryController.php:216 (__construct) [id: 37]
/controllers/front/listing/CategoryController.php:216 (__construct) [id: 38]
/controllers/front/listing/CategoryController.php:216 (__construct) [id: 39]
/controllers/front/listing/CategoryController.php:216 (__construct) [id: 40]
/controllers/front/listing/CategoryController.php:216 (__construct) [id: 44]
/controllers/front/listing/CategoryController.php:216 (__construct) [id: 319]
/controllers/front/listing/CategoryController.php:216 (__construct) [id: 11]
/controllers/front/listing/CategoryController.php:216 (__construct) [id: 12]
/controllers/front/listing/CategoryController.php:216 (__construct) [id: 13]
/controllers/front/listing/CategoryController.php:216 (__construct) [id: 18]
/controllers/front/listing/CategoryController.php:216 (__construct) [id: 19]
/controllers/front/listing/CategoryController.php:216 (__construct) [id: 20]
/classes/Meta.php:380 (__construct) [id: 2]
/classes/PrestaShopCollection.php:385 (hydrateCollection) [id: ]
/classes/Link.php:402 (__construct) [id: 2]
/classes/Link.php:402 (__construct) [id: 2]
/modules/iqitmegamenu/iqitmegamenu.php:3282 (__construct) [id: 40]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 40]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 55]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 71]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 165]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 169]
/modules/iqitmegamenu/iqitmegamenu.php:3282 (__construct) [id: 38]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 38]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 50]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 62]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 72]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 172]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 175]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 185]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 186]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 190]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 334]
/modules/iqitmegamenu/iqitmegamenu.php:3282 (__construct) [id: 34]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 344]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 45]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 46]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 54]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 70]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 78]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 199]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 200]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 35]
/modules/iqitmegamenu/iqitmegamenu.php:3282 (__construct) [id: 216]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 44]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 51]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 56]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 192]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 195]
/modules/iqitmegamenu/iqitmegamenu.php:3282 (__construct) [id: 37]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 37]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 48]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 53]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 73]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 74]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 161]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 162]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 163]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 260]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 261]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 262]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 263]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 264]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 265]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 266]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 307]
/modules/iqitmegamenu/iqitmegamenu.php:3282 (__construct) [id: 35]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 35]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 49]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 59]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 60]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 65]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 81]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 82]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 96]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 145]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 196]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 197]
/modules/iqitmegamenu/iqitmegamenu.php:3282 (__construct) [id: 33]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 33]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 61]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 66]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 79]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 80]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 191]
/modules/iqitmegamenu/iqitmegamenu.php:3282 (__construct) [id: 36]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 36]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 42]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 47]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 76]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 77]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 217]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 221]
/modules/iqitmegamenu/iqitmegamenu.php:3282 (__construct) [id: 39]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 39]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 83]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 84]
/classes/Link.php:402 (__construct) [id: 2]
/classes/Link.php:402 (__construct) [id: 2]
/modules/ps_categorytree/ps_categorytree.php:364 (getParentsCategories) [id: 2]
Currency 4 /src/Adapter/Currency/CurrencyDataProvider.php:101 (__construct) [id: 1]
/src/Adapter/Currency/CurrencyDataProvider.php:101 (__construct) [id: 2]
/classes/Tools.php:690 (getCurrencyInstance) [id: 1]
/modules/ps_currencyselector/ps_currencyselector.php:112 (getCurrencies) [id: 2]
Address 4 /classes/shop/Shop.php:486 (__construct) [id: ]
/classes/Product.php:3694 (initialize) [id: ]
/classes/Product.php:3804 (__construct) [id: ]
/classes/Product.php:5964 (__construct) [id: ]
Country 3 /config/config.inc.php:146 (__construct) [id: 8]
/classes/AddressFormat.php:404 (__construct) [id: 8]
/classes/controller/FrontController.php:1779 (__construct) [id: 8]
ShopUrl 2 /classes/PrestaShopCollection.php:385 (hydrateCollection) [id: ]
/classes/PrestaShopCollection.php:385 (hydrateCollection) [id: ]
Language 2 /config/config.inc.php:211 (__construct) [id: 1]
/classes/Tools.php:560 (__construct) [id: 1]
Cart 2 /classes/controller/FrontController.php:467 (__construct) [id: ]
/classes/controller/FrontController.php:541 (__construct) [id: ]
Tax 2 /classes/tax/TaxRulesTaxManager.php:116 (__construct) [id: 1]
/classes/tax/TaxRulesTaxManager.php:116 (__construct) [id: 1]
Carrier 2 /modules/colissimo_simplicite/colissimo_simplicite.php:84 (__construct) [id: 282]
/modules/colissimo_simplicite/colissimo_simplicite.php:1394 (__construct) [id: 282]
Shop 1 /config/config.inc.php:117 (initialize) [id: 1]
CMS 1 /classes/Link.php:555 (__construct) [id: 2]
IqitElementorCategory 1 /modules/iqitelementor/iqitelementor.php:853 (isJustElementor) [id: ]
Risk 1 /classes/controller/FrontController.php:1705 (__construct) [id: ]
State 1 /classes/controller/FrontController.php:1778 (__construct) [id: 0]
AddressFormat 1 /classes/controller/FrontController.php:1773 (generateAddress) [id: ]
Gender 1 /classes/controller/FrontController.php:1702 (__construct) [id: 0]
Group 1 /classes/Cart.php:249 (getCurrent) [id: 1]
Customer 1 /config/config.inc.php:264 (__construct) [id: ]
ShopGroup 1 /classes/shop/Shop.php:561 (__construct) [id: 1]
ConnectionsSource 1 /modules/statsdata/statsdata.php:119 (logHttpReferer) [id: ]

Included Files

# Filename
0 /index.php
1 /config/config.inc.php
2 /config/defines.inc.php
3 /config/autoload.php
4 /vendor/autoload.php
5 /vendor/composer/autoload_real.php
6 /vendor/composer/platform_check.php
7 /vendor/composer/ClassLoader.php
8 /vendor/composer/include_paths.php
9 /vendor/composer/autoload_static.php
10 /vendor/symfony/polyfill-php72/bootstrap.php
11 /vendor/symfony/polyfill-mbstring/bootstrap.php
12 /vendor/symfony/polyfill-mbstring/bootstrap80.php
13 /vendor/symfony/polyfill-intl-normalizer/bootstrap.php
14 /vendor/symfony/polyfill-intl-normalizer/bootstrap80.php
15 /vendor/symfony/polyfill-intl-idn/bootstrap.php
16 /vendor/symfony/deprecation-contracts/function.php
17 /vendor/ralouphie/getallheaders/src/getallheaders.php
18 /vendor/symfony/polyfill-ctype/bootstrap.php
19 /vendor/symfony/polyfill-ctype/bootstrap80.php
20 /vendor/symfony/polyfill-php80/bootstrap.php
21 /vendor/guzzlehttp/promises/src/functions_include.php
22 /vendor/guzzlehttp/promises/src/functions.php
23 /vendor/guzzlehttp/guzzle/src/functions_include.php
24 /vendor/guzzlehttp/guzzle/src/functions.php
25 /vendor/symfony/polyfill-iconv/bootstrap.php
26 /vendor/ezyang/htmlpurifier/library/HTMLPurifier.composer.php
27 /vendor/jakeasmith/http_build_url/src/http_build_url.php
28 /vendor/lcobucci/jwt/compat/class-aliases.php
29 /vendor/lcobucci/jwt/src/Token.php
30 /vendor/lcobucci/jwt/src/Signature.php
31 /vendor/lcobucci/jwt/compat/json-exception-polyfill.php
32 /vendor/lcobucci/jwt/compat/lcobucci-clock-polyfill.php
33 /vendor/swiftmailer/swiftmailer/lib/swift_required.php
34 /vendor/swiftmailer/swiftmailer/lib/classes/Swift.php
35 /vendor/symfony/polyfill-intl-icu/bootstrap.php
36 /vendor/symfony/polyfill-php73/bootstrap.php
37 /vendor/symfony/polyfill-php81/bootstrap.php
38 /vendor/api-platform/core/src/deprecation.php
39 /vendor/api-platform/core/src/Api/FilterInterface.php
40 /vendor/api-platform/core/src/Api/ResourceClassResolverInterface.php
41 /vendor/api-platform/core/src/deprecated_interfaces.php
42 /vendor/api-platform/core/src/Metadata/Property/Factory/PropertyNameCollectionFactoryInterface.php
43 /vendor/api-platform/core/src/Metadata/Resource/Factory/ResourceNameCollectionFactoryInterface.php
44 /vendor/api-platform/core/src/Metadata/Extractor/ResourceExtractorInterface.php
45 /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/DateFilterInterface.php
46 /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/ExistsFilterInterface.php
47 /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/OrderFilterInterface.php
48 /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/RangeFilterInterface.php
49 /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/SearchFilterInterface.php
50 /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Extension/AggregationCollectionExtensionInterface.php
51 /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Extension/AggregationItemExtensionInterface.php
52 /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Extension/AggregationResultCollectionExtensionInterface.php
53 /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Extension/AggregationResultItemExtensionInterface.php
54 /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Filter/FilterInterface.php
55 /vendor/api-platform/core/src/Doctrine/Orm/QueryAwareInterface.php
56 /vendor/api-platform/core/src/Doctrine/Orm/Util/QueryNameGeneratorInterface.php
57 /vendor/api-platform/core/src/Elasticsearch/Metadata/Document/Factory/DocumentMetadataFactoryInterface.php
58 /vendor/api-platform/core/src/Symfony/Validator/ValidationGroupsGeneratorInterface.php
59 /vendor/api-platform/core/src/Symfony/Validator/Exception/ConstraintViolationListAwareExceptionInterface.php
60 /vendor/api-platform/core/src/Exception/ExceptionInterface.php
61 /vendor/api-platform/core/src/Core/Bridge/Symfony/Validator/Metadata/Property/Restriction/PropertySchemaRestrictionMetadataInterface.php
62 /vendor/api-platform/core/src/State/Pagination/PaginatorInterface.php
63 /vendor/api-platform/core/src/State/Pagination/PartialPaginatorInterface.php
64 /vendor/api-platform/core/src/Documentation/DocumentationInterface.php
65 /vendor/api-platform/core/src/JsonLd/AnonymousContextBuilderInterface.php
66 /vendor/api-platform/core/src/JsonLd/ContextBuilderInterface.php
67 /vendor/api-platform/core/src/Core/JsonSchema/SchemaFactoryInterface.php
68 /vendor/api-platform/core/src/JsonSchema/TypeFactoryInterface.php
69 /vendor/api-platform/core/src/OpenApi/Factory/OpenApiFactoryInterface.php
70 /vendor/api-platform/core/src/PathResolver/OperationPathResolverInterface.php
71 /vendor/api-platform/core/src/Symfony/Security/ResourceAccessCheckerInterface.php
72 /vendor/api-platform/core/src/Serializer/Filter/FilterInterface.php
73 /vendor/api-platform/core/src/Serializer/SerializerContextBuilderInterface.php
74 /vendor/api-platform/core/src/Validator/ValidatorInterface.php
75 /vendor/api-platform/core/src/Api/UrlGeneratorInterface.php
76 /vendor/api-platform/core/src/GraphQl/ExecutorInterface.php
77 /vendor/api-platform/core/src/GraphQl/Error/ErrorHandlerInterface.php
78 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/ValidateStageInterface.php
79 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/ReadStageInterface.php
80 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/SecurityPostDenormalizeStageInterface.php
81 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/SecurityStageInterface.php
82 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/WriteStageInterface.php
83 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/SerializeStageInterface.php
84 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/DeserializeStageInterface.php
85 /vendor/api-platform/core/src/GraphQl/Resolver/QueryItemResolverInterface.php
86 /vendor/api-platform/core/src/GraphQl/Resolver/QueryCollectionResolverInterface.php
87 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Factory/ResolverFactoryInterface.php
88 /vendor/api-platform/core/src/GraphQl/Resolver/MutationResolverInterface.php
89 /vendor/api-platform/core/src/Core/GraphQl/Subscription/MercureSubscriptionIriGeneratorInterface.php
90 /vendor/api-platform/core/src/Core/GraphQl/Subscription/SubscriptionIdentifierGeneratorInterface.php
91 /vendor/api-platform/core/src/Core/GraphQl/Subscription/SubscriptionManagerInterface.php
92 /vendor/api-platform/core/src/Core/GraphQl/Serializer/SerializerContextBuilderInterface.php
93 /vendor/api-platform/core/src/GraphQl/Type/TypesFactoryInterface.php
94 /vendor/api-platform/core/src/GraphQl/Type/Definition/TypeInterface.php
95 /vendor/api-platform/core/src/GraphQl/Type/TypesContainerInterface.php
96 /vendor/psr/container/src/ContainerInterface.php
97 /vendor/api-platform/core/src/Operation/PathSegmentNameGeneratorInterface.php
98 /vendor/ircmaxell/password-compat/lib/password.php
99 /vendor/martinlindhe/php-mb-helpers/src/mb_helpers.php
100 /vendor/prestashop/laminas-code-lts/polyfill/ReflectionEnumPolyfill.php
101 /src/Core/Version.php
102 /config/alias.php
103 /vendor/prestashop/autoload/src/PrestashopAutoload.php
104 /vendor/prestashop/autoload/src/LegacyClassLoader.php
105 /vendor/symfony/symfony/src/Symfony/Component/Filesystem/Filesystem.php
106 /vendor/prestashop/autoload/src/Autoloader.php
107 /config/bootstrap.php
108 /src/Core/ContainerBuilder.php
109 /src/Core/Foundation/IoC/Container.php
110 /src/Adapter/ServiceLocator.php
111 /var/cache/prod/appParameters.php
114 /var/cache/prod/class_index.php
115 /classes/controller/Controller.php
117 /classes/ObjectModel.php
118 /src/Core/Foundation/Database/EntityInterface.php
120 /classes/db/Db.php
122 /classes/Hook.php
124 /classes/module/Module.php
125 /src/Core/Module/Legacy/ModuleInterface.php
127 /classes/Tools.php
128 /classes/Context.php
129 /classes/shop/Shop.php
130 /src/Core/Security/PasswordGenerator.php
131 /classes/db/DbPDO.php
132 /classes/AddressFormat.php
133 /classes/Configuration.php
134 /classes/Validate.php
135 /classes/cache/Cache.php
136 /src/Adapter/EntityMapper.php
137 /classes/db/DbQuery.php
138 /src/Core/Addon/Theme/ThemeManagerBuilder.php
139 /vendor/psr/log/Psr/Log/NullLogger.php
140 /vendor/psr/log/Psr/Log/AbstractLogger.php
141 /vendor/psr/log/Psr/Log/LoggerInterface.php
142 /src/Adapter/Configuration.php
143 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/ParameterBag.php
144 /src/Core/Domain/Configuration/ShopConfigurationInterface.php
145 /src/Core/ConfigurationInterface.php
146 /src/Core/Addon/Theme/ThemeRepository.php
147 /src/Core/Addon/AddonRepositoryInterface.php
148 /src/Core/Domain/Shop/ValueObject/ShopConstraint.php
149 /src/Core/Addon/Theme/Theme.php
150 /src/Core/Addon/AddonInterface.php
151 /src/Core/Util/ArrayFinder.php
152 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyAccess.php
153 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyAccessorBuilder.php
154 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyAccessor.php
155 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyAccessorInterface.php
156 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyPath.php
157 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyPathInterface.php
158 /config/defines_uri.inc.php
159 /classes/Language.php
160 /src/Core/Language/LanguageInterface.php
161 /classes/Country.php
162 /classes/PrestaShopCollection.php
163 /classes/shop/ShopGroup.php
164 /classes/Cookie.php
165 /classes/PhpEncryption.php
166 /classes/PhpEncryptionEngine.php
167 /vendor/defuse/php-encryption/src/Key.php
168 /vendor/defuse/php-encryption/src/Encoding.php
169 /vendor/defuse/php-encryption/src/Core.php
170 /vendor/defuse/php-encryption/src/Crypto.php
171 /vendor/defuse/php-encryption/src/KeyOrPassword.php
172 /vendor/defuse/php-encryption/src/RuntimeTests.php
173 /vendor/defuse/php-encryption/src/DerivedKeys.php
174 /vendor/defuse/php-encryption/src/Exception/WrongKeyOrModifiedCiphertextException.php
175 /vendor/defuse/php-encryption/src/Exception/CryptoException.php
176 /src/Core/Session/SessionHandler.php
177 /src/Core/Session/SessionHandlerInterface.php
178 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Session.php
179 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Attribute/AttributeBag.php
180 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Attribute/AttributeBagInterface.php
181 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/SessionBagInterface.php
182 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Flash/FlashBag.php
183 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Flash/FlashBagInterface.php
184 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/SessionBagProxy.php
185 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/SessionInterface.php
186 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/PhpBridgeSessionStorage.php
187 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/NativeSessionStorage.php
188 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/MetadataBag.php
189 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/Handler/StrictSessionHandler.php
190 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/Handler/AbstractSessionHandler.php
191 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/Proxy/SessionHandlerProxy.php
192 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/Proxy/AbstractProxy.php
193 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/SessionStorageInterface.php
194 /config/smarty.config.inc.php
195 /vendor/smarty/smarty/libs/Smarty.class.php
196 /vendor/smarty/smarty/libs/functions.php
197 /vendor/smarty/smarty/libs/Autoloader.php
198 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_data.php
199 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_extension_handler.php
200 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php
201 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php
202 /vendor/smarty/smarty/libs/sysplugins/smarty_resource.php
203 /vendor/smarty/smarty/libs/sysplugins/smarty_variable.php
204 /vendor/smarty/smarty/libs/sysplugins/smarty_template_source.php
205 /vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php
206 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_resource_file.php
207 /config/smartyfront.config.inc.php
208 /classes/Smarty/SmartyResourceModule.php
209 /vendor/smarty/smarty/libs/sysplugins/smarty_resource_custom.php
210 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_method_registerresource.php
211 /classes/Smarty/SmartyResourceParent.php
212 /classes/Smarty/SmartyLazyRegister.php
213 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_method_registerplugin.php
214 /vendor/smarty/smarty/libs/plugins/modifier.truncate.php
215 /classes/Customer.php
216 /classes/Group.php
217 /classes/Link.php
218 /classes/shop/ShopUrl.php
219 /classes/Dispatcher.php
220 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Request.php
221 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/AcceptHeader.php
222 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/AcceptHeaderItem.php
223 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/FileBag.php
224 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/HeaderBag.php
225 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/HeaderUtils.php
226 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/ServerBag.php
227 /src/Adapter/SymfonyContainer.php
228 /vendor/mobiledetect/mobiledetectlib/Mobile_Detect.php
229 /config/db_slave_server.inc.php
230 /src/Adapter/ContainerBuilder.php
231 /src/Adapter/Environment.php
232 /src/Core/EnvironmentInterface.php
233 /vendor/symfony/symfony/src/Symfony/Component/Config/ConfigCache.php
234 /vendor/symfony/symfony/src/Symfony/Component/Config/ResourceCheckerConfigCache.php
235 /vendor/symfony/symfony/src/Symfony/Component/Config/ConfigCacheInterface.php
236 /vendor/symfony/symfony/src/Symfony/Component/Cache/DoctrineProvider.php
237 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/CacheProvider.php
238 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/Cache.php
239 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/FlushableCache.php
240 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/ClearableCache.php
241 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/MultiOperationCache.php
242 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/MultiGetCache.php
243 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/MultiDeleteCache.php
244 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/MultiPutCache.php
245 /vendor/symfony/symfony/src/Symfony/Component/Cache/PruneableInterface.php
246 /vendor/symfony/symfony/src/Symfony/Component/Cache/ResettableInterface.php
247 /vendor/symfony/contracts/Service/ResetInterface.php
248 /vendor/symfony/symfony/src/Symfony/Component/Cache/Adapter/ArrayAdapter.php
249 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/ArrayTrait.php
250 /vendor/psr/log/Psr/Log/LoggerAwareTrait.php
251 /vendor/symfony/symfony/src/Symfony/Component/Cache/Adapter/AdapterInterface.php
252 /vendor/symfony/symfony/src/Symfony/Component/Cache/CacheItem.php
253 /vendor/symfony/contracts/Cache/ItemInterface.php
254 /vendor/psr/cache/src/CacheItemInterface.php
255 /vendor/psr/cache/src/CacheItemPoolInterface.php
256 /vendor/symfony/contracts/Cache/CacheInterface.php
257 /vendor/psr/log/Psr/Log/LoggerAwareInterface.php
258 /vendor/doctrine/orm/lib/Doctrine/ORM/Tools/Setup.php
259 /vendor/doctrine/deprecations/lib/Doctrine/Deprecations/Deprecation.php
260 /vendor/doctrine/orm/lib/Doctrine/ORM/Configuration.php
261 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Configuration.php
262 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/Psr6/CacheAdapter.php
263 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/Psr6/DoctrineProvider.php
264 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/AnnotationReader.php
265 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/Reader.php
266 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/AnnotationRegistry.php
267 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Driver/DoctrineAnnotations.php
268 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Annotation.php
269 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Entity.php
270 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Embeddable.php
271 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Embedded.php
272 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/MappedSuperclass.php
273 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/InheritanceType.php
274 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/DiscriminatorColumn.php
275 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/DiscriminatorMap.php
276 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Id.php
277 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/GeneratedValue.php
278 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Version.php
279 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/JoinColumn.php
280 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/JoinColumns.php
281 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Column.php
282 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/OneToOne.php
283 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/OneToMany.php
284 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/ManyToOne.php
285 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/ManyToMany.php
286 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Table.php
287 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/UniqueConstraint.php
288 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Index.php
289 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/JoinTable.php
290 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/SequenceGenerator.php
291 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/CustomIdGenerator.php
292 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/ChangeTrackingPolicy.php
293 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/OrderBy.php
294 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/NamedQueries.php
295 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/NamedQuery.php
296 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/HasLifecycleCallbacks.php
297 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PrePersist.php
298 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PostPersist.php
299 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PreUpdate.php
300 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PostUpdate.php
301 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PreRemove.php
302 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PostRemove.php
303 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PostLoad.php
304 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PreFlush.php
305 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/FieldResult.php
306 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/ColumnResult.php
307 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/EntityResult.php
308 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/NamedNativeQuery.php
309 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/NamedNativeQueries.php
310 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/SqlResultSetMapping.php
311 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/SqlResultSetMappings.php
312 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/AssociationOverride.php
313 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/AssociationOverrides.php
314 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/AttributeOverride.php
315 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/AttributeOverrides.php
316 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/EntityListeners.php
317 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Cache.php
318 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/SimpleAnnotationReader.php
319 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/DocParser.php
320 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/DocLexer.php
321 /vendor/doctrine/lexer/lib/Doctrine/Common/Lexer/AbstractLexer.php
322 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/Annotation/Target.php
323 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Driver/AnnotationDriver.php
324 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Driver/CompatibilityAnnotationDriver.php
325 /vendor/doctrine/persistence/src/Persistence/Mapping/Driver/MappingDriver.php
326 /vendor/doctrine/persistence/src/Persistence/Mapping/Driver/ColocatedMappingDriver.php
327 /var/cache/prod/FrontContainer.php
328 /src/Adapter/Container/LegacyContainer.php
329 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/Container.php
330 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/Argument/RewindableGenerator.php
331 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/Argument/ServiceLocator.php
332 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/ServiceLocator.php
333 /vendor/symfony/contracts/Service/ServiceLocatorTrait.php
334 /vendor/psr/container/src/ContainerExceptionInterface.php
335 /vendor/psr/container/src/NotFoundExceptionInterface.php
336 /vendor/symfony/contracts/Service/ServiceProviderInterface.php
337 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/ResettableContainerInterface.php
338 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/ContainerInterface.php
339 /src/Adapter/Container/LegacyContainerInterface.php
340 /modules/blockwishlist/vendor/autoload.php
341 /modules/blockwishlist/vendor/composer/autoload_real.php
342 /modules/blockwishlist/vendor/composer/autoload_static.php
343 /modules/contactform/vendor/autoload.php
344 /modules/contactform/vendor/composer/autoload_real.php
345 /modules/contactform/vendor/composer/autoload_static.php
346 /modules/dashactivity/vendor/autoload.php
347 /modules/dashactivity/vendor/composer/autoload_real.php
348 /modules/dashactivity/vendor/composer/autoload_static.php
349 /modules/dashtrends/vendor/autoload.php
350 /modules/dashtrends/vendor/composer/autoload_real.php
351 /modules/dashtrends/vendor/composer/autoload_static.php
352 /modules/dashgoals/vendor/autoload.php
353 /modules/dashgoals/vendor/composer/autoload_real.php
354 /modules/dashgoals/vendor/composer/autoload_static.php
355 /modules/dashproducts/vendor/autoload.php
356 /modules/dashproducts/vendor/composer/autoload_real.php
357 /modules/dashproducts/vendor/composer/autoload_static.php
358 /modules/graphnvd3/vendor/autoload.php
359 /modules/graphnvd3/vendor/composer/autoload_real.php
360 /modules/graphnvd3/vendor/composer/autoload_static.php
361 /modules/gridhtml/vendor/autoload.php
362 /modules/gridhtml/vendor/composer/autoload_real.php
363 /modules/gridhtml/vendor/composer/autoload_static.php
364 /modules/gsitemap/vendor/autoload.php
365 /modules/gsitemap/vendor/composer/autoload_real.php
366 /modules/gsitemap/vendor/composer/autoload_static.php
367 /modules/pagesnotfound/vendor/autoload.php
368 /modules/pagesnotfound/vendor/composer/autoload_real.php
369 /modules/pagesnotfound/vendor/composer/autoload_static.php
370 /modules/productcomments/vendor/autoload.php
371 /modules/productcomments/vendor/composer/autoload_real.php
372 /modules/productcomments/vendor/composer/autoload_static.php
373 /modules/ps_categorytree/vendor/autoload.php
374 /modules/ps_categorytree/vendor/composer/autoload_real.php
375 /modules/ps_categorytree/vendor/composer/autoload_static.php
376 /modules/ps_checkpayment/vendor/autoload.php
377 /modules/ps_checkpayment/vendor/composer/autoload_real.php
378 /modules/ps_checkpayment/vendor/composer/autoload_static.php
379 /modules/ps_contactinfo/vendor/autoload.php
380 /modules/ps_contactinfo/vendor/composer/autoload_real.php
381 /modules/ps_contactinfo/vendor/composer/autoload_static.php
382 /modules/ps_crossselling/vendor/autoload.php
383 /modules/ps_crossselling/vendor/composer/autoload_real.php
384 /modules/ps_crossselling/vendor/composer/autoload_static.php
385 /modules/ps_currencyselector/vendor/autoload.php
386 /modules/ps_currencyselector/vendor/composer/autoload_real.php
387 /modules/ps_currencyselector/vendor/composer/autoload_static.php
388 /modules/ps_customeraccountlinks/vendor/autoload.php
389 /modules/ps_customeraccountlinks/vendor/composer/autoload_real.php
390 /modules/ps_customeraccountlinks/vendor/composer/autoload_static.php
391 /modules/ps_customtext/vendor/autoload.php
392 /modules/ps_customtext/vendor/composer/autoload_real.php
393 /modules/ps_customtext/vendor/composer/autoload_static.php
394 /modules/ps_dataprivacy/vendor/autoload.php
395 /modules/ps_dataprivacy/vendor/composer/autoload_real.php
396 /modules/ps_dataprivacy/vendor/composer/autoload_static.php
397 /modules/ps_emailsubscription/vendor/autoload.php
398 /modules/ps_emailsubscription/vendor/composer/autoload_real.php
399 /modules/ps_emailsubscription/vendor/composer/autoload_static.php
400 /modules/ps_faviconnotificationbo/vendor/autoload.php
401 /modules/ps_faviconnotificationbo/vendor/composer/autoload_real.php
402 /modules/ps_faviconnotificationbo/vendor/composer/autoload_static.php
403 /modules/ps_featuredproducts/vendor/autoload.php
404 /modules/ps_featuredproducts/vendor/composer/autoload_real.php
405 /modules/ps_featuredproducts/vendor/composer/autoload_static.php
406 /modules/ps_imageslider/vendor/autoload.php
407 /modules/ps_imageslider/vendor/composer/autoload_real.php
408 /modules/ps_imageslider/vendor/composer/autoload_static.php
409 /modules/ps_languageselector/vendor/autoload.php
410 /modules/ps_languageselector/vendor/composer/autoload_real.php
411 /modules/ps_languageselector/vendor/composer/autoload_static.php
412 /modules/ps_linklist/vendor/autoload.php
413 /modules/ps_linklist/vendor/composer/autoload_real.php
414 /modules/ps_linklist/vendor/composer/autoload_static.php
415 /modules/ps_mainmenu/vendor/autoload.php
416 /modules/ps_mainmenu/vendor/composer/autoload_real.php
417 /modules/ps_mainmenu/vendor/composer/autoload_static.php
418 /modules/ps_searchbar/vendor/autoload.php
419 /modules/ps_searchbar/vendor/composer/autoload_real.php
420 /modules/ps_searchbar/vendor/composer/platform_check.php
421 /modules/ps_searchbar/vendor/composer/autoload_static.php
422 /modules/ps_sharebuttons/vendor/autoload.php
423 /modules/ps_sharebuttons/vendor/composer/autoload_real.php
424 /modules/ps_sharebuttons/vendor/composer/platform_check.php
425 /modules/ps_sharebuttons/vendor/composer/autoload_static.php
426 /modules/ps_shoppingcart/vendor/autoload.php
427 /modules/ps_shoppingcart/vendor/composer/autoload_real.php
428 /modules/ps_shoppingcart/vendor/composer/autoload_static.php
429 /modules/ps_socialfollow/vendor/autoload.php
430 /modules/ps_socialfollow/vendor/composer/autoload_real.php
431 /modules/ps_socialfollow/vendor/composer/autoload_static.php
432 /modules/ps_themecusto/vendor/autoload.php
433 /modules/ps_themecusto/vendor/composer/autoload_real.php
434 /modules/ps_themecusto/vendor/composer/autoload_static.php
435 /modules/ps_wirepayment/vendor/autoload.php
436 /modules/ps_wirepayment/vendor/composer/autoload_real.php
437 /modules/ps_wirepayment/vendor/composer/autoload_static.php
438 /modules/statsbestcustomers/vendor/autoload.php
439 /modules/statsbestcustomers/vendor/composer/autoload_real.php
440 /modules/statsbestcustomers/vendor/composer/autoload_static.php
441 /modules/statsbestsuppliers/vendor/autoload.php
442 /modules/statsbestsuppliers/vendor/composer/autoload_real.php
443 /modules/statsbestsuppliers/vendor/composer/autoload_static.php
444 /modules/statscatalog/vendor/autoload.php
445 /modules/statscatalog/vendor/composer/autoload_real.php
446 /modules/statscatalog/vendor/composer/autoload_static.php
447 /modules/statscheckup/vendor/autoload.php
448 /modules/statscheckup/vendor/composer/autoload_real.php
449 /modules/statscheckup/vendor/composer/autoload_static.php
450 /modules/statsdata/vendor/autoload.php
451 /modules/statsdata/vendor/composer/autoload_real.php
452 /modules/statsdata/vendor/composer/autoload_static.php
453 /modules/statsproduct/vendor/autoload.php
454 /modules/statsproduct/vendor/composer/autoload_real.php
455 /modules/statsproduct/vendor/composer/autoload_static.php
456 /modules/statsstock/vendor/autoload.php
457 /modules/statsstock/vendor/composer/autoload_real.php
458 /modules/statsstock/vendor/composer/autoload_static.php
459 /modules/psgdpr/vendor/autoload.php
460 /modules/psgdpr/vendor/composer/autoload_real.php
461 /modules/psgdpr/vendor/composer/autoload_static.php
462 /modules/blockreassurance/vendor/autoload.php
463 /modules/blockreassurance/vendor/composer/autoload_real.php
464 /modules/blockreassurance/vendor/composer/autoload_static.php
465 /modules/ps_facetedsearch/vendor/autoload.php
466 /modules/ps_facetedsearch/vendor/composer/autoload_real.php
467 /modules/ps_facetedsearch/vendor/composer/autoload_static.php
468 /modules/nkmgls/vendor/autoload.php
469 /modules/nkmgls/vendor/composer/autoload_real.php
470 /modules/nkmgls/vendor/composer/platform_check.php
471 /modules/nkmgls/vendor/composer/autoload_static.php
472 /modules/nkmgls/vendor/nukium/gls-prestashop/lib/NkmHelper.php
473 /modules/paybox/vendor/autoload.php
474 /modules/paybox/vendor/composer/autoload_real.php
475 /modules/paybox/vendor/composer/platform_check.php
476 /modules/paybox/vendor/composer/autoload_static.php
477 /modules/paybox/vendor/clue/stream-filter/src/functions_include.php
478 /modules/paybox/vendor/clue/stream-filter/src/functions.php
479 /modules/paybox/vendor/php-http/message/src/filters.php
480 /modules/iqitsociallogin/vendor/autoload.php
481 /modules/iqitsociallogin/vendor/composer/autoload_real.php
482 /modules/iqitsociallogin/vendor/composer/platform_check.php
483 /modules/iqitsociallogin/vendor/composer/autoload_static.php
484 /modules/ps_eventbus/vendor/autoload.php
485 /modules/ps_eventbus/vendor/composer/autoload_real.php
486 /modules/ps_eventbus/vendor/composer/autoload_static.php
487 /modules/ps_accounts/vendor/autoload.php
488 /modules/ps_accounts/vendor/composer/autoload_real.php
489 /modules/ps_accounts/vendor/composer/platform_check.php
490 /modules/ps_accounts/vendor/composer/autoload_static.php
491 /modules/ps_accounts/vendor/paragonie/random_compat/lib/random.php
492 /modules/ps_accounts/vendor/symfony/polyfill-ctype/bootstrap.php
493 /modules/ps_accounts/vendor/lcobucci/jwt/compat/class-aliases.php
494 /modules/ps_accounts/vendor/lcobucci/jwt/src/Token.php
495 /modules/ps_accounts/vendor/lcobucci/jwt/src/Signature.php
496 /modules/ps_accounts/vendor/lcobucci/jwt/compat/json-exception-polyfill.php
497 /modules/ps_accounts/vendor/lcobucci/jwt/compat/lcobucci-clock-polyfill.php
498 /modules/ps_accounts/vendor/phpseclib/phpseclib/phpseclib/bootstrap.php
499 /modules/ps_accounts/vendor/ramsey/uuid/src/functions.php
500 /modules/ps_accounts/vendor/segmentio/analytics-php/lib/Segment.php
501 /modules/ps_accounts/vendor/segmentio/analytics-php/lib/Segment/Client.php
502 /modules/ps_accounts/vendor/segmentio/analytics-php/lib/Segment/Consumer.php
503 /modules/ps_accounts/vendor/segmentio/analytics-php/lib/Segment/QueueConsumer.php
504 /modules/ps_accounts/vendor/segmentio/analytics-php/lib/Segment/Consumer/File.php
505 /modules/ps_accounts/vendor/segmentio/analytics-php/lib/Segment/Consumer/ForkCurl.php
506 /modules/ps_accounts/vendor/segmentio/analytics-php/lib/Segment/Consumer/LibCurl.php
507 /modules/ps_accounts/vendor/segmentio/analytics-php/lib/Segment/Consumer/Socket.php
508 /modules/ps_accounts/vendor/segmentio/analytics-php/lib/Segment/Version.php
509 /modules/ps_emailalerts/vendor/autoload.php
510 /modules/ps_emailalerts/vendor/composer/autoload_real.php
511 /modules/ps_emailalerts/vendor/composer/autoload_static.php
512 /modules/ps_checkout/vendor/autoload.php
513 /modules/ps_checkout/vendor/composer/autoload_real.php
514 /modules/ps_checkout/vendor/composer/platform_check.php
515 /modules/ps_checkout/vendor/composer/autoload_static.php
516 /modules/ps_checkout/vendor/ramsey/uuid/src/functions.php
517 /modules/autoupgrade/vendor/autoload.php
518 /modules/autoupgrade/vendor/composer/autoload_real.php
519 /modules/autoupgrade/vendor/composer/autoload_static.php
520 /modules/sendinblue/vendor/autoload.php
521 /modules/sendinblue/vendor/composer/autoload_real.php
522 /modules/sendinblue/vendor/composer/platform_check.php
523 /modules/sendinblue/vendor/composer/autoload_static.php
524 /src/Core/Hook/HookModuleFilter.php
525 /src/Core/Hook/HookModuleFilterInterface.php
526 /modules/ps_checkout/ps_checkout.php
527 /classes/PaymentModule.php
528 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_method_createdata.php
529 /vendor/smarty/smarty/libs/sysplugins/smarty_data.php
530 /classes/Translate.php
531 /modules/ps_checkout/translations/fr.php
532 /src/PrestaShopBundle/Translation/TranslatorComponent.php
533 /vendor/symfony/symfony/src/Symfony/Component/Translation/Translator.php
534 /vendor/symfony/symfony/src/Symfony/Component/Translation/TranslatorInterface.php
535 /vendor/symfony/contracts/Translation/LocaleAwareInterface.php
536 /vendor/symfony/contracts/Translation/TranslatorInterface.php
537 /vendor/symfony/symfony/src/Symfony/Component/Translation/TranslatorBagInterface.php
538 /src/PrestaShopBundle/Translation/PrestaShopTranslatorTrait.php
539 /src/PrestaShopBundle/Translation/TranslatorLanguageTrait.php
540 /src/PrestaShopBundle/Translation/TranslatorInterface.php
541 /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/MessageFormatter.php
542 /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/IntlFormatter.php
543 /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/IntlFormatterInterface.php
544 /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/MessageFormatterInterface.php
545 /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/ChoiceMessageFormatterInterface.php
546 /vendor/symfony/symfony/src/Symfony/Component/Translation/IdentityTranslator.php
547 /vendor/symfony/contracts/Translation/TranslatorTrait.php
548 /vendor/symfony/symfony/src/Symfony/Component/Config/ConfigCacheFactory.php
549 /vendor/symfony/symfony/src/Symfony/Component/Config/ConfigCacheFactoryInterface.php
550 /var/cache/prod/translations/catalogue.fr-FR.NXhscRe.php
551 /vendor/symfony/symfony/src/Symfony/Component/Translation/MessageCatalogue.php
552 /vendor/symfony/symfony/src/Symfony/Component/Translation/MessageCatalogueInterface.php
553 /vendor/symfony/symfony/src/Symfony/Component/Translation/MetadataAwareInterface.php
554 /controllers/front/listing/CategoryController.php
555 /classes/controller/ProductListingFrontController.php
556 /classes/controller/ProductPresentingFrontController.php
557 /classes/controller/FrontController.php
558 /src/Adapter/Presenter/Object/ObjectPresenter.php
559 /src/Adapter/Presenter/PresenterInterface.php
560 /src/Adapter/Presenter/Cart/CartPresenter.php
561 /src/Adapter/Image/ImageRetriever.php
562 /classes/tax/TaxConfiguration.php
563 /classes/Smarty/TemplateFinder.php
564 /classes/assets/StylesheetManager.php
565 /classes/assets/AbstractAssetManager.php
566 /src/Adapter/Assets/AssetUrlGeneratorTrait.php
567 /classes/assets/JavascriptManager.php
568 /classes/assets/CccReducer.php
569 /modules/iqitthemeeditor/iqitthemeeditor.php
570 /modules/iqitthemeeditor/src/IqitSmartyModifiers.php
571 /modules/iqitthemeeditor/translations/fr.php
572 /classes/Category.php
573 /classes/webservice/WebserviceRequest.php
574 /src/Core/Localization/Locale/Repository.php
575 /src/Core/Localization/Locale/RepositoryInterface.php
576 /src/Core/Localization/CLDR/LocaleRepository.php
577 /src/Core/Localization/CLDR/LocaleDataSource.php
578 /src/Core/Localization/CLDR/DataLayer/LocaleCache.php
579 /src/Core/Data/Layer/AbstractDataLayer.php
580 /src/Core/Localization/CLDR/LocaleDataLayerInterface.php
581 /vendor/symfony/symfony/src/Symfony/Component/Cache/Adapter/FilesystemAdapter.php
582 /vendor/symfony/symfony/src/Symfony/Component/Cache/Adapter/AbstractAdapter.php
583 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/AbstractAdapterTrait.php
584 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/AbstractTrait.php
585 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/ContractsTrait.php
586 /vendor/symfony/contracts/Cache/CacheTrait.php
587 /vendor/psr/cache/src/InvalidArgumentException.php
588 /vendor/psr/cache/src/CacheException.php
589 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/FilesystemTrait.php
590 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/FilesystemCommonTrait.php
591 /vendor/symfony/symfony/src/Symfony/Component/Cache/Marshaller/DefaultMarshaller.php
592 /vendor/symfony/symfony/src/Symfony/Component/Cache/Marshaller/MarshallerInterface.php
593 /src/Core/Localization/CLDR/DataLayer/LocaleReference.php
594 /src/Core/Localization/CLDR/Reader.php
595 /src/Core/Localization/CLDR/ReaderInterface.php
596 /src/Core/Localization/Currency/Repository.php
597 /src/Core/Localization/Currency/RepositoryInterface.php
598 /src/Core/Localization/Currency/CurrencyDataSource.php
599 /src/Core/Localization/Currency/DataSourceInterface.php
600 /src/Core/Localization/Currency/DataLayer/CurrencyCache.php
601 /src/Core/Localization/Currency/CurrencyDataLayerInterface.php
602 /src/Core/Localization/Currency/DataLayer/CurrencyDatabase.php
603 /src/Adapter/Currency/CurrencyDataProvider.php
604 /src/Core/Currency/CurrencyDataProviderInterface.php
605 /src/Adapter/LegacyContext.php
606 /src/Adapter/Tools.php
607 /src/Core/Localization/Currency/DataLayer/CurrencyReference.php
608 /src/Core/Localization/Currency/DataLayer/CurrencyInstalled.php
609 /vendor/prestashop/decimal/src/Operation/Rounding.php
610 /src/Core/Localization/Locale.php
611 /src/Core/Localization/LocaleInterface.php
612 /src/Core/Localization/Specification/Price.php
613 /src/Core/Localization/Specification/Number.php
614 /src/Core/Localization/Specification/NumberInterface.php
615 /src/Core/Localization/Specification/Factory.php
616 /src/Core/Localization/CLDR/LocaleData.php
617 /src/Core/Localization/CLDR/NumberSymbolsData.php
618 /src/Core/Localization/CLDR/CurrencyData.php
619 /src/Core/Localization/CLDR/Locale.php
620 /src/Core/Localization/CLDR/LocaleInterface.php
621 /src/Core/Localization/Specification/NumberSymbolList.php
622 /classes/Currency.php
623 /src/Core/Localization/Currency/LocalizedCurrencyId.php
624 /src/Core/Localization/Currency/CurrencyData.php
625 /src/Core/Localization/Currency/CurrencyCollection.php
626 /src/Core/Localization/Currency.php
627 /src/Core/Localization/CurrencyInterface.php
628 /src/Core/Localization/Specification/NumberCollection.php
629 /src/Core/Localization/Number/Formatter.php
630 /classes/Cart.php
631 /src/Adapter/AddressFactory.php
632 /classes/CartRule.php
633 /classes/Product.php
634 /src/Core/Domain/Product/ValueObject/RedirectType.php
635 /src/Core/Util/DateTime/DateTime.php
636 /src/Core/Domain/Product/Stock/ValueObject/OutOfStockType.php
637 /src/Core/Domain/Product/Pack/ValueObject/PackStockType.php
638 /src/Core/Domain/Product/ValueObject/ProductType.php
639 /src/Core/Domain/Product/ValueObject/Reference.php
640 /src/Core/Domain/Product/ValueObject/Ean13.php
641 /src/Core/Domain/Product/ValueObject/Isbn.php
642 /src/Core/Domain/Product/ValueObject/Upc.php
643 /src/Core/Domain/Product/ProductSettings.php
644 /src/Core/Image/ImageFormatConfiguration.php
645 /src/Core/Image/ImageFormatConfigurationInterface.php
646 /classes/FeatureFlag.php
647 /src/Core/FeatureFlag/FeatureFlagSettings.php
648 /classes/ImageType.php
649 /src/Core/Domain/Shop/ValueObject/ShopId.php
650 /src/Core/Domain/Shop/ValueObject/ShopIdInterface.php
651 /modules/ps_emailsubscription/ps_emailsubscription.php
652 /src/Core/Module/WidgetInterface.php
653 /src/PrestaShopBundle/Translation/DomainNormalizer.php
654 /classes/Media.php
655 /modules/blockreassurance/blockreassurance.php
656 /modules/nkmgls/nkmgls.php
657 /modules/nkmgls/controllers/admin/AdminGlsOrderController.php
658 /classes/controller/ModuleAdminController.php
659 /classes/controller/AdminController.php
660 /modules/nkmgls/controllers/admin/AdminGlsAjaxController.php
661 /modules/nkmgls/controllers/admin/AdminGlsLabelController.php
662 /modules/nkmgls/controllers/admin/AdminGlsPackingListController.php
663 /classes/module/CarrierModule.php
664 /modules/nkmgls/translations/fr.php
665 /modules/nkmgls/vendor/nukium/gls-prestashop/src/Service/Init/PrestashopGlsInit.php
666 /modules/nkmgls/vendor/nukium/gls-common/src/Service/Init/GlsInit.php
667 /modules/nkmgls/vendor/nukium/gls-common/src/Util/ServiceInstantiationTrait.php
668 /modules/nkmgls/vendor/nukium/gls-common/src/Service/Container.php
669 /modules/nkmgls/vendor/nukium/gls-common/src/Service/ContainerInterface.php
670 /modules/nkmgls/vendor/nukium/gls-common/src/Service/Init/ShipItAdapterResolutionInit.php
671 /modules/nkmgls/vendor/nukium/gls-prestashop/src/Service/Init/PrestashopAdapterInit.php
672 /modules/nkmgls/vendor/nukium/gls-common/src/Service/Init/AdapterInitInterface.php
673 /modules/nkmgls/vendor/nukium/gls-common/src/Service/Repository/Cache/CacheRepositoryFactory.php
674 /modules/nkmgls/vendor/nukium/gls-prestashop/src/Service/Repository/Cache/PrestashopCacheRepository.php
675 /modules/nkmgls/vendor/nukium/gls-prestashop/src/Service/Repository/AbstractRepository.php
676 /modules/nkmgls/vendor/nukium/gls-common/src/Service/Repository/Cache/CacheRepositoryInterface.php
677 /modules/nkmgls/vendor/nukium/gls-prestashop/classes/GlsCacheClass.php
678 /modules/nkmgls/vendor/nukium/gls-common/src/Entity/CacheInterface.php
679 /modules/nkmgls/vendor/nukium/gls-common/src/Service/Handler/DTO/Adapter/Address/AddressHandlerFactory.php
680 /modules/nkmgls/vendor/nukium/gls-prestashop/src/Service/Handler/DTO/Adapter/Address/PrestashopAddressHandler.php
681 /modules/nkmgls/vendor/nukium/gls-common/src/Service/Handler/DTO/Adapter/Address/AddressHandler.php
682 /modules/nkmgls/vendor/nukium/gls-common/src/Service/Handler/DTO/Adapter/Carrier/CarrierHandlerFactory.php
683 /modules/nkmgls/vendor/nukium/gls-prestashop/src/Service/Handler/DTO/Adapter/Carrier/PrestashopCarrierHandler.php
684 /modules/nkmgls/vendor/nukium/gls-common/src/Service/Handler/DTO/Adapter/Carrier/CarrierHandler.php
685 /modules/nkmgls/vendor/nukium/gls-prestashop/src/Service/Helper/ModuleHelper.php
686 /modules/nkmgls/vendor/nukium/gls-prestashop/src/Service/Adapter/Config/PrestashopConfig.php
687 /modules/nkmgls/vendor/nukium/gls-common/src/Service/Adapter/Config/ConfigInterface.php
688 /modules/nkmgls/vendor/nukium/gls-prestashop/src/Service/Repository/Carrier/PrestashopCarrierRepository.php
689 /classes/Carrier.php
690 /modules/nkmgls/vendor/nukium/gls-common/src/Service/Handler/Entity/Cache/CacheHandlerFactory.php
691 /modules/nkmgls/vendor/nukium/gls-prestashop/src/Service/Handler/Entity/Cache/PrestashopCacheHandler.php
692 /modules/nkmgls/vendor/nukium/gls-common/src/Service/Handler/Entity/Cache/CacheHandler.php
693 /modules/nkmgls/vendor/nukium/gls-common/src/Service/Adapter/Config/ConfigFactory.php
694 /modules/nkmgls/vendor/nukium/gls-common/src/Service/Adapter/EntityManager/EntityManagerFactory.php
695 /modules/nkmgls/vendor/nukium/gls-prestashop/src/Service/Adapter/EntityManager/PrestashopEntityManager.php
696 /modules/nkmgls/vendor/nukium/gls-common/src/Service/Adapter/EntityManager/EntityManagerInterface.php
697 /modules/nkmgls/vendor/nukium/gls-common/src/Service/Adapter/Shop/ShopFactory.php
698 /modules/nkmgls/vendor/nukium/gls-prestashop/src/Service/Adapter/Shop/PrestashopShop.php
699 /modules/nkmgls/vendor/nukium/gls-common/src/Service/Adapter/Shop/ShopInterface.php
700 /modules/nkmgls/vendor/nukium/gls-common/src/Service/Adapter/Translator/TranslatorFactory.php
701 /modules/nkmgls/vendor/nukium/gls-prestashop/src/Service/Adapter/Translator/PrestashopTranslator.php
702 /modules/nkmgls/vendor/nukium/gls-common/src/Service/Adapter/Translator/TranslatorInterface.php
703 /modules/nkmgls/vendor/nukium/gls-common/src/Service/Adapter/Utility/UtilityFactory.php
704 /modules/nkmgls/vendor/nukium/gls-prestashop/src/Service/Adapter/Utility/PrestashopUtility.php
705 /modules/nkmgls/vendor/nukium/gls-common/src/Service/Adapter/Utility/Component/DefaultUtility.php
706 /modules/nkmgls/vendor/nukium/gls-prestashop/src/Service/Patch/PatchSystem.php
707 /modules/nkmgls/vendor/nukium/gls-common/src/Service/Adapter/Logger/Component/DefaultLogger.php
708 /modules/nkmgls/vendor/nukium/gls-prestashop/src/Service/Patch/Component/AddOriginalAddressPatch.php
709 /modules/nkmgls/vendor/nukium/gls-prestashop/src/Service/Patch/PatchComponentInterface.php
710 /modules/nkmgls/vendor/nukium/gls-common/src/Service/ShipIt/ShipItAdapterResolution.php
711 /modules/nkmgls/vendor/nukium/gls-common/src/Service/ShipIt/Adapter/NoShipItAdapter.php
712 /modules/nkmgls/vendor/nukium/gls-common/src/Service/ShipIt/ShipItAdapterInterface.php
713 /modules/nkmgls/vendor/nukium/gls-common/src/Service/ShipIt/Adapter/LabelAdapter.php
714 /modules/nkmgls/vendor/nukium/gls-common/src/Service/ShipIt/Adapter/AbstractAdapter.php
715 /modules/nkmgls/vendor/nukium/gls-common/src/Service/ShipIt/Adapter/Component/AuthErrorComponent.php
716 /modules/nkmgls/vendor/nukium/gls-common/src/Service/ShipIt/ShipItComponentInterface.php
717 /modules/nkmgls/vendor/nukium/gls-common/src/Service/ShipIt/Adapter/Component/DefaultErrorComponent.php
718 /modules/nkmgls/vendor/nukium/gls-common/src/Service/Adapter/Logger/LoggerFactory.php
719 /modules/nkmgls/vendor/nukium/gls-common/src/Service/ShipIt/Adapter/Component/LabelInternationalComponent.php
720 /modules/nkmgls/vendor/nukium/gls-common/src/Service/ShipIt/Routine/ShipItErrorRoutine.php
721 /modules/nkmgls/vendor/nukium/gls-common/src/Service/API/ShipmentApi.php
722 /modules/nkmgls/vendor/nukium/gls-common/src/Service/HttpClient/LegacyClient.php
723 /modules/nkmgls/vendor/nukium/gls-common/src/Service/Handler/Legacy/GlsApiHandler.php
724 /modules/nkmgls/vendor/nukium/gls-common/src/Service/HttpClient/GlsCurlClient.php
725 /modules/nkmgls/vendor/nukium/gls-common/src/Service/Helper/GlsHelper.php
726 /modules/nkmgls/vendor/nukium/gls-common/src/Service/ShipIt/Adapter/Component/LabelErrorComponent.php
727 /modules/nkmgls/vendor/nukium/gls-common/src/Service/ShipIt/Adapter/Component/LabelComponent.php
728 /modules/nkmgls/vendor/nukium/gls-common/src/Service/ShipIt/Adapter/RelayAdapter.php
729 /modules/nkmgls/vendor/nukium/gls-common/src/Service/ShipIt/Adapter/Component/RelayComponent.php
730 /modules/nkmgls/vendor/nukium/gls-common/src/Service/ShipIt/Adapter/TrackingAdapter.php
731 /modules/nkmgls/vendor/nukium/gls-common/src/Service/ShipIt/Adapter/Component/TrackingComponent.php
732 /modules/nkmgls/vendor/nukium/gls-common/src/Service/API/TrackingApi.php
733 /modules/nkmgls/vendor/nukium/gls-prestashop/src/Service/Handler/Carrier/GlsExpressHandler.php
734 /modules/nkmgls/vendor/nukium/gls-prestashop/src/Service/Helper/FtpHelper.php
735 /modules/nkmgls/vendor/nukium/gls-prestashop/src/Service/Helper/EnvHelper.php
736 /modules/nkmgls/vendor/nukium/gls-common/src/Service/Routine/AllowedServicesRoutine.php
737 /modules/nkmgls/vendor/nukium/gls-common/src/Service/DataLoader/AllowedServicesLoader.php
738 /modules/nkmgls/vendor/nukium/gls-common/src/Service/Handler/DTO/GLS/AllowedServicesHandler.php
739 /modules/nkmgls/vendor/nukium/gls-common/src/Service/API/AllowedServicesApi.php
740 /modules/nkmgls/vendor/nukium/gls-common/src/Service/Routine/CacheRoutine.php
741 /modules/nkmgls/vendor/nukium/gls-common/src/Service/DataLoader/CacheLoader.php
742 /modules/paybox/paybox.php
743 /modules/paybox/src/Configuration/Settings.php
744 /modules/paybox/vendor/netresearch/jsonmapper/src/JsonMapper.php
745 /modules/paybox/src/Configuration/Account.php
746 /modules/paybox/src/Configuration/DemoAccount.php
747 /modules/paybox/src/Configuration/PaymentConfiguration.php
748 /modules/paybox/src/Configuration/SubscriptionConfiguration.php
749 /modules/paybox/src/Configuration/InstalmentConfiguration.php
750 /modules/paybox/src/Configuration/Instalment.php
751 /modules/paybox/src/Configuration/Contract.php
752 /modules/paybox/src/Utils/Tools.php
753 /vendor/monolog/monolog/src/Monolog/Logger.php
754 /vendor/monolog/monolog/src/Monolog/ResettableInterface.php
755 /vendor/monolog/monolog/src/Monolog/Handler/RotatingFileHandler.php
756 /vendor/monolog/monolog/src/Monolog/Handler/StreamHandler.php
757 /vendor/monolog/monolog/src/Monolog/Handler/AbstractProcessingHandler.php
758 /vendor/monolog/monolog/src/Monolog/Handler/AbstractHandler.php
759 /vendor/monolog/monolog/src/Monolog/Handler/HandlerInterface.php
760 /vendor/monolog/monolog/src/Monolog/Utils.php
761 /modules/paybox/translations/fr.php
762 /modules/ps_emailalerts/ps_emailalerts.php
763 /modules/ps_emailalerts/MailAlert.php
764 /modules/ps_checkout/vendor/prestashop/module-lib-service-container/src/DependencyInjection/ServiceContainer.php
765 /modules/ps_checkout/vendor/prestashop/module-lib-cache-directory-provider/src/Cache/CacheDirectoryProvider.php
766 /modules/ps_checkout/vendor/prestashop/module-lib-service-container/src/DependencyInjection/ContainerProvider.php
767 /var/cache/prod/Ps_checkout8440FrontContainer.php
768 /modules/ps_checkout/src/Validator/FrontControllerValidator.php
769 /modules/ps_checkout/src/Validator/MerchantValidator.php
770 /modules/ps_checkout/src/PayPal/PayPalConfiguration.php
771 /modules/ps_checkout/src/Configuration/PrestaShopConfiguration.php
772 /modules/ps_checkout/src/Configuration/PrestaShopConfigurationOptionsResolver.php
773 /modules/ps_checkout/src/Shop/ShopProvider.php
774 /vendor/symfony/symfony/src/Symfony/Component/OptionsResolver/OptionsResolver.php
775 /vendor/symfony/symfony/src/Symfony/Component/OptionsResolver/Options.php
776 /modules/ps_checkout/src/Repository/PayPalCodeRepository.php
777 /modules/ps_checkout/src/Repository/PsAccountRepository.php
778 /modules/ps_checkout/vendor/prestashop/prestashop-accounts-installer/src/Installer/Facade/PsAccounts.php
779 /modules/ps_checkout/vendor/prestashop/prestashop-accounts-installer/src/Installer/Installer.php
780 /src/Core/Addon/Module/ModuleManagerBuilder.php
781 /src/Core/Util/File/YamlParser.php
782 /vendor/symfony/symfony/src/Symfony/Component/Config/Resource/SelfCheckingResourceChecker.php
783 /vendor/symfony/symfony/src/Symfony/Component/Config/ResourceCheckerInterface.php
784 /vendor/symfony/symfony/src/Symfony/Component/Config/Resource/FileResource.php
785 /vendor/symfony/symfony/src/Symfony/Component/Config/Resource/SelfCheckingResourceInterface.php
786 /vendor/symfony/symfony/src/Symfony/Component/Config/Resource/ResourceInterface.php
787 /var/cache/prod/yaml/4b591b7a28d98961575010499c0558f3.php
788 /src/Adapter/LegacyLogger.php
789 /src/PrestaShopBundle/Service/DataProvider/Admin/CategoriesProvider.php
790 /src/Adapter/Module/ModuleDataProvider.php
791 /src/Adapter/Module/AdminModuleDataProvider.php
792 /src/PrestaShopBundle/Service/DataProvider/Admin/ModuleInterface.php
793 /src/Adapter/Module/Module.php
794 /src/Core/Module/ModuleInterface.php
795 /vendor/symfony/symfony/src/Symfony/Component/Config/FileLocator.php
796 /vendor/symfony/symfony/src/Symfony/Component/Config/FileLocatorInterface.php
797 /vendor/symfony/symfony/src/Symfony/Component/Routing/Loader/YamlFileLoader.php
798 /vendor/symfony/symfony/src/Symfony/Component/Config/Loader/FileLoader.php
799 /vendor/symfony/symfony/src/Symfony/Component/Config/Loader/Loader.php
800 /vendor/symfony/symfony/src/Symfony/Component/Config/Loader/LoaderInterface.php
801 /vendor/symfony/symfony/src/Symfony/Component/Routing/Router.php
802 /vendor/symfony/symfony/src/Symfony/Component/Routing/RouterInterface.php
803 /vendor/symfony/symfony/src/Symfony/Component/Routing/Matcher/UrlMatcherInterface.php
804 /vendor/symfony/symfony/src/Symfony/Component/Routing/RequestContextAwareInterface.php
805 /vendor/symfony/symfony/src/Symfony/Component/Routing/Generator/UrlGeneratorInterface.php
806 /vendor/symfony/symfony/src/Symfony/Component/Routing/Matcher/RequestMatcherInterface.php
807 /vendor/symfony/symfony/src/Symfony/Component/Routing/RequestContext.php
808 /src/Adapter/Module/ModuleDataUpdater.php
809 /src/Core/Module/ModuleManager.php
810 /src/Core/Module/ModuleManagerInterface.php
811 /src/Core/Module/ModuleRepository.php
812 /src/Core/Module/ModuleRepositoryInterface.php
813 /src/Adapter/HookManager.php
814 /src/Core/Module/SourceHandler/SourceHandlerFactory.php
815 /src/PrestaShopBundle/Event/Dispatcher/NullDispatcher.php
816 /vendor/symfony/symfony/src/Symfony/Component/EventDispatcher/EventDispatcherInterface.php
817 /vendor/symfony/contracts/EventDispatcher/EventDispatcherInterface.php
818 /src/Core/Hook/HookDispatcherInterface.php
819 /modules/ps_accounts/ps_accounts.php
820 /modules/ps_accounts/src/Hook/HookableTrait.php
821 /modules/ps_accounts/src/Module/Install.php
822 /modules/ps_accounts/translations/fr.php
823 /modules/ps_accounts/src/ServiceContainer/PsAccountsContainer.php
824 /modules/ps_accounts/vendor/prestashopcorp/lightweight-container/src/ServiceContainer/ServiceContainer.php
825 /modules/ps_accounts/config.php
826 /modules/ps_accounts/src/Log/Logger.php
827 /modules/ps_accounts/vendor/monolog/monolog/src/Monolog/Logger.php
828 /modules/ps_accounts/vendor/psr/log/Psr/Log/LoggerInterface.php
829 /modules/ps_accounts/vendor/monolog/monolog/src/Monolog/ResettableInterface.php
830 /modules/ps_accounts/vendor/monolog/monolog/src/Monolog/Handler/RotatingFileHandler.php
831 /modules/ps_accounts/vendor/monolog/monolog/src/Monolog/Handler/StreamHandler.php
832 /modules/ps_accounts/vendor/monolog/monolog/src/Monolog/Handler/AbstractProcessingHandler.php
833 /modules/ps_accounts/vendor/monolog/monolog/src/Monolog/Handler/AbstractHandler.php
834 /modules/ps_accounts/vendor/monolog/monolog/src/Monolog/Handler/HandlerInterface.php
835 /modules/ps_accounts/vendor/monolog/monolog/src/Monolog/Utils.php
836 /modules/ps_accounts/src/ServiceProvider/ApiClientProvider.php
837 /modules/ps_accounts/vendor/prestashopcorp/lightweight-container/src/ServiceContainer/Contract/IServiceProvider.php
838 /modules/ps_accounts/src/ServiceProvider/CommandProvider.php
839 /modules/ps_accounts/src/ServiceProvider/DefaultProvider.php
840 /modules/ps_accounts/src/ServiceProvider/OAuth2Provider.php
841 /modules/ps_accounts/src/ServiceProvider/RepositoryProvider.php
842 /modules/ps_accounts/src/ServiceProvider/SessionProvider.php
843 /modules/ps_accounts/src/Service/PsAccountsService.php
844 /modules/ps_accounts/src/Account/Session/ShopSession.php
845 /modules/ps_accounts/src/Account/Session/Session.php
846 /modules/ps_accounts/src/Account/Session/SessionInterface.php
847 /modules/ps_accounts/src/Repository/ConfigurationRepository.php
848 /modules/ps_accounts/src/Adapter/Configuration.php
849 /modules/ps_accounts/src/Service/OAuth2/OAuth2Service.php
850 /modules/ps_accounts/src/Http/Client/ClientConfig.php
851 /modules/ps_accounts/src/Http/Client/ConfigObject.php
852 /modules/ps_accounts/src/Type/Enum.php
853 /modules/ps_accounts/src/Service/OAuth2/OAuth2Client.php
854 /modules/ps_accounts/src/Adapter/Link.php
855 /modules/ps_accounts/src/Context/ShopContext.php
856 /modules/ps_accounts/vendor/ramsey/uuid/src/Uuid.php
857 /modules/ps_accounts/vendor/ramsey/uuid/src/UuidInterface.php
858 /modules/ps_accounts/vendor/ramsey/uuid/src/UuidFactory.php
859 /modules/ps_accounts/vendor/ramsey/uuid/src/UuidFactoryInterface.php
860 /modules/ps_accounts/vendor/ramsey/uuid/src/FeatureSet.php
861 /modules/ps_accounts/vendor/ramsey/uuid/src/Converter/Number/DegradedNumberConverter.php
862 /modules/ps_accounts/vendor/ramsey/uuid/src/Converter/NumberConverterInterface.php
863 /modules/ps_accounts/vendor/ramsey/uuid/src/Builder/DefaultUuidBuilder.php
864 /modules/ps_accounts/vendor/ramsey/uuid/src/Builder/UuidBuilderInterface.php
865 /modules/ps_accounts/vendor/ramsey/uuid/src/Codec/StringCodec.php
866 /modules/ps_accounts/vendor/ramsey/uuid/src/Codec/CodecInterface.php
867 /modules/ps_accounts/vendor/ramsey/uuid/src/Provider/Node/FallbackNodeProvider.php
868 /modules/ps_accounts/vendor/ramsey/uuid/src/Provider/NodeProviderInterface.php
869 /modules/ps_accounts/vendor/ramsey/uuid/src/Provider/Node/SystemNodeProvider.php
870 /modules/ps_accounts/vendor/ramsey/uuid/src/Provider/Node/RandomNodeProvider.php
871 /modules/ps_accounts/vendor/ramsey/uuid/src/Generator/RandomGeneratorFactory.php
872 /modules/ps_accounts/vendor/ramsey/uuid/src/Generator/RandomBytesGenerator.php
873 /modules/ps_accounts/vendor/ramsey/uuid/src/Generator/RandomGeneratorInterface.php
874 /modules/ps_accounts/vendor/ramsey/uuid/src/Provider/Time/SystemTimeProvider.php
875 /modules/ps_accounts/vendor/ramsey/uuid/src/Provider/TimeProviderInterface.php
876 /modules/ps_accounts/vendor/ramsey/uuid/src/Generator/TimeGeneratorFactory.php
877 /modules/ps_accounts/vendor/ramsey/uuid/src/Converter/Time/PhpTimeConverter.php
878 /modules/ps_accounts/vendor/ramsey/uuid/src/Converter/TimeConverterInterface.php
879 /modules/ps_accounts/vendor/ramsey/uuid/src/Generator/DefaultTimeGenerator.php
880 /modules/ps_accounts/vendor/ramsey/uuid/src/Generator/TimeGeneratorInterface.php
881 /modules/ps_accounts/vendor/ramsey/uuid/src/BinaryUtils.php
882 /modules/ps_accounts/src/Service/OAuth2/CachedFile.php
883 /modules/ps_accounts/src/Account/LinkShop.php
884 /modules/ps_accounts/src/Cqrs/CommandBus.php
885 /modules/ps_accounts/src/Cqrs/Bus.php
886 /modules/ps_accounts/src/Account/Session/Firebase/ShopSession.php
887 /modules/ps_accounts/src/Account/Session/Firebase/FirebaseSession.php
888 /modules/ps_accounts/src/Account/Session/Firebase/OwnerSession.php
889 /modules/ps_checkout/src/Context/PrestaShopContext.php
890 /modules/ps_checkout/src/ExpressCheckout/ExpressCheckoutConfiguration.php
891 /modules/ps_checkout/src/PayPal/PayPalPayLaterConfiguration.php
892 /modules/ps_checkout/src/Version/Version.php
893 /modules/ps_accounts/src/Adapter/ConfigurationKeys.php
894 /src/Adapter/Presenter/Cart/CartLazyArray.php
895 /src/Adapter/Presenter/AbstractLazyArray.php
896 /src/Adapter/Product/PriceFormatter.php
897 /src/Core/Util/Inflector.php
898 /vendor/doctrine/inflector/lib/Doctrine/Inflector/InflectorFactory.php
899 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Language.php
900 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/English/InflectorFactory.php
901 /vendor/doctrine/inflector/lib/Doctrine/Inflector/GenericLanguageInflectorFactory.php
902 /vendor/doctrine/inflector/lib/Doctrine/Inflector/LanguageInflectorFactory.php
903 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/English/Rules.php
904 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Ruleset.php
905 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Transformations.php
906 /vendor/doctrine/inflector/lib/Doctrine/Inflector/WordInflector.php
907 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/English/Inflectible.php
908 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Transformation.php
909 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Pattern.php
910 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Patterns.php
911 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/English/Uninflected.php
912 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Substitutions.php
913 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Substitution.php
914 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Word.php
915 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Inflector.php
916 /vendor/doctrine/inflector/lib/Doctrine/Inflector/CachedWordInflector.php
917 /vendor/doctrine/inflector/lib/Doctrine/Inflector/RulesetInflector.php
918 /classes/Gender.php
919 /classes/Risk.php
920 /classes/Meta.php
921 /modules/revsliderprestashop/revsliderprestashop.php
922 /modules/revsliderprestashop/rev-loader.php
923 /modules/revsliderprestashop/includes/revslider_db.class.php
924 /modules/revsliderprestashop/includes/data.class.php
925 /modules/revsliderprestashop/includes/functions.class.php
926 /modules/revsliderprestashop/includes/em-integration.class.php
927 /modules/revsliderprestashop/includes/cssparser.class.php
928 /modules/revsliderprestashop/includes/woocommerce.class.php
929 /modules/revsliderprestashop/includes/wpml.class.php
930 /modules/revsliderprestashop/includes/colorpicker.class.php
931 /modules/revsliderprestashop/includes/navigation.class.php
932 /modules/revsliderprestashop/includes/object-library.class.php
933 /modules/revsliderprestashop/admin/includes/loadbalancer.class.php
934 /modules/revsliderprestashop/admin/includes/plugin-update.class.php
935 /modules/revsliderprestashop/includes/extension.class.php
936 /modules/revsliderprestashop/includes/favorite.class.php
937 /modules/revsliderprestashop/includes/aq-resizer.class.php
938 /modules/revsliderprestashop/includes/external-sources.class.php
939 /modules/revsliderprestashop/includes/page-template.class.php
940 /modules/revsliderprestashop/includes/slider.class.php
941 /modules/revsliderprestashop/includes/slide.class.php
942 /modules/revsliderprestashop/includes/output.class.php
943 /modules/revsliderprestashop/public/revslider-front.class.php
944 /modules/revsliderprestashop/includes/backwards.php
945 /modules/revsliderprestashop/admin/includes/class-pclzip.php
946 /modules/revsliderprestashop/admin/includes/license.class.php
947 /modules/revsliderprestashop/admin/includes/addons.class.php
948 /modules/revsliderprestashop/admin/includes/template.class.php
949 /modules/revsliderprestashop/admin/includes/functions-admin.class.php
950 /modules/revsliderprestashop/admin/includes/folder.class.php
951 /modules/revsliderprestashop/admin/includes/import.class.php
952 /modules/revsliderprestashop/admin/includes/export.class.php
953 /modules/revsliderprestashop/admin/includes/export-html.class.php
954 /modules/revsliderprestashop/admin/includes/newsletter.class.php
955 /modules/revsliderprestashop/admin/revslider-admin.class.php
956 /modules/revsliderprestashop/includes/update.class.php
957 /modules/revsliderprestashop/includes/resize-imag.php
958 /modules/revsliderprestashop/translations/fr.php
959 /classes/Address.php
960 /classes/State.php
961 /src/Core/Security/PasswordPolicyConfiguration.php
962 /src/Core/Configuration/DataConfigurationInterface.php
963 /src/Core/Security/Hashing.php
964 /src/Core/Filter/FrontEndObject/MainFilter.php
965 /src/Core/Filter/FilterInterface.php
966 /src/Core/Filter/FrontEndObject/CartFilter.php
967 /src/Core/Filter/HashMapWhitelistFilter.php
968 /src/Core/Filter/CollectionFilter.php
969 /src/Core/Filter/FrontEndObject/ProductFilter.php
970 /src/Core/Filter/FrontEndObject/EmbeddedAttributesFilter.php
971 /src/Core/Filter/FrontEndObject/CustomerFilter.php
972 /src/Core/Filter/FrontEndObject/ShopFilter.php
973 /src/Core/Filter/FrontEndObject/ConfigurationFilter.php
974 /modules/productcomments/productcomments.php
975 /modules/ps_shoppingcart/ps_shoppingcart.php
976 /modules/iqitcontactpage/iqitcontactpage.php
977 /modules/iqitcontactpage/translations/fr.php
978 /modules/iqitsociallogin/iqitsociallogin.php
979 /modules/iqitsociallogin/translations/fr.php
980 /modules/iqitmegamenu/iqitmegamenu.php
981 /modules/iqitmegamenu/models/IqitMenuTab.php
982 /modules/iqitmegamenu/models/IqitMenuHtml.php
983 /modules/iqitmegamenu/models/IqitMenuLinks.php
984 /modules/iqitmegamenu/translations/fr.php
985 /modules/iqitelementor/iqitelementor.php
986 /modules/iqitelementor/src/IqitElementorLanding.php
987 /modules/iqitelementor/src/IqitElementorTemplate.php
988 /modules/iqitelementor/src/IqitElementorProduct.php
989 /modules/iqitelementor/src/IqitElementorCategory.php
990 /modules/iqitelementor/src/IqitElementorContent.php
991 /modules/iqitelementor/src/iqitElementorWpHelper.php
992 /modules/iqitelementor/includes/plugin-elementor.php
993 /modules/iqitelementor/src/widgets/IqitElementorWidget_Brands.php
994 /modules/iqitelementor/src/widgets/IqitElementorWidget_ProductsList.php
995 /modules/iqitelementor/src/widgets/IqitElementorWidget_ProductsListTabs.php
996 /modules/iqitelementor/src/widgets/IqitElementorWidget_Modules.php
997 /modules/iqitelementor/src/widgets/IqitElementorWidget_CustomTpl.php
998 /modules/iqitelementor/src/widgets/IqitElementorWidget_Menu.php
999 /modules/iqitelementor/src/widgets/IqitElementorWidget_RevolutionSlider.php
1000 /modules/iqitelementor/src/widgets/IqitElementorWidget_Newsletter.php
1001 /modules/iqitelementor/src/widgets/IqitElementorWidget_Blog.php
1002 /modules/iqitelementor/src/widgets/IqitElementorWidget_Search.php
1003 /modules/iqitelementor/src/widgets/IqitElementorWidget_Links.php
1004 /modules/iqitelementor/src/widgets/IqitElementorWidget_ContactForm.php
1005 /modules/iqitelementor/translations/fr.php
1006 /modules/iqitfreedeliverycount/iqitfreedeliverycount.php
1007 /modules/iqitfreedeliverycount/translations/fr.php
1008 /modules/sendinblue/sendinblue.php
1009 /modules/sendinblue/translations/fr.php
1010 /modules/sendinblue/services/ConfigService.php
1011 /modules/colissimo_simplicite/colissimo_simplicite.php
1012 /modules/colissimo_simplicite/models/ColissimoDeliveryInfo.php
1013 /modules/colissimo_simplicite/models/ColissimoDeliveryPoint.php
1014 /modules/colissimo_simplicite/translations/fr.php
1015 /modules/lgcookieslaw/lgcookieslaw.php
1016 /modules/lgcookieslaw/translations/fr.php
1017 /src/Core/Product/Search/ProductSearchContext.php
1018 /src/Core/Product/Search/ProductSearchQuery.php
1019 /src/Core/Product/Search/SortOrder.php
1020 /modules/ps_facetedsearch/ps_facetedsearch.php
1021 /modules/ps_facetedsearch/src/HookDispatcher.php
1022 /modules/ps_facetedsearch/src/Hook/Attribute.php
1023 /modules/ps_facetedsearch/src/Hook/AbstractHook.php
1024 /modules/ps_facetedsearch/src/Hook/AttributeGroup.php
1025 /modules/ps_facetedsearch/src/Hook/Category.php
1026 /modules/ps_facetedsearch/src/Hook/Configuration.php
1027 /modules/ps_facetedsearch/src/Hook/Design.php
1028 /modules/ps_facetedsearch/src/Hook/Feature.php
1029 /modules/ps_facetedsearch/src/Form/Feature/FormModifier.php
1030 /modules/ps_facetedsearch/src/Form/Feature/FormDataProvider.php
1031 /modules/ps_facetedsearch/src/Hook/FeatureValue.php
1032 /modules/ps_facetedsearch/src/Form/FeatureValue/FormModifier.php
1033 /modules/ps_facetedsearch/src/Form/FeatureValue/FormDataProvider.php
1034 /modules/ps_facetedsearch/src/Hook/Product.php
1035 /modules/ps_facetedsearch/src/Hook/ProductSearch.php
1036 /modules/ps_facetedsearch/src/Hook/SpecificPrice.php
1037 /modules/ps_facetedsearch/src/Filters/Provider.php
1038 /modules/ps_facetedsearch/src/URLSerializer.php
1039 /modules/ps_facetedsearch/src/Filters/DataAccessor.php
1040 /modules/ps_facetedsearch/src/Product/SearchProvider.php
1041 /src/Core/Product/Search/FacetsRendererInterface.php
1042 /src/Core/Product/Search/ProductSearchProviderInterface.php
1043 /modules/ps_facetedsearch/src/Filters/Converter.php
1044 /modules/ps_facetedsearch/src/Product/SearchFactory.php
1045 /src/Core/Product/Search/ProductSearchResult.php
1046 /classes/Combination.php
1047 /modules/ps_facetedsearch/src/Definition/Availability.php
1048 /modules/ps_facetedsearch/src/Product/Search.php
1049 /modules/ps_facetedsearch/src/Adapter/MySQL.php
1050 /modules/ps_facetedsearch/src/Adapter/AbstractAdapter.php
1051 /modules/ps_facetedsearch/src/Adapter/InterfaceAdapter.php
1052 /vendor/doctrine/collections/lib/Doctrine/Common/Collections/ArrayCollection.php
1053 /vendor/doctrine/collections/lib/Doctrine/Common/Collections/Collection.php
1054 /vendor/doctrine/collections/lib/Doctrine/Common/Collections/ReadableCollection.php
1055 /vendor/doctrine/collections/lib/Doctrine/Common/Collections/Selectable.php
1056 /modules/ps_facetedsearch/src/Filters/Products.php
1057 /classes/stock/StockAvailable.php
1058 /modules/ps_facetedsearch/src/Filters/Block.php
1059 /src/Core/Product/Search/Facet.php
1060 /src/Core/Product/Search/Filter.php
1061 /vendor/prestashop/decimal/src/DecimalNumber.php
1062 /vendor/prestashop/decimal/src/Builder.php
1063 /src/Core/Product/Search/FacetCollection.php
1064 /classes/ProductAssembler.php
1065 /classes/tax/Tax.php
1066 /classes/Manufacturer.php
1067 /classes/SpecificPrice.php
1068 /classes/tax/TaxManagerFactory.php
1069 /classes/tax/TaxRulesTaxManager.php
1070 /classes/tax/TaxManagerInterface.php
1071 /classes/tax/TaxCalculator.php
1072 /classes/GroupReduction.php
1073 /src/Core/Localization/CLDR/ComputingPrecision.php
1074 /src/Core/Localization/CLDR/ComputingPrecisionInterface.php
1075 /classes/Pack.php
1076 /classes/order/Order.php
1077 /classes/Feature.php
1078 /classes/ProductPresenterFactory.php
1079 /src/Adapter/Presenter/Product/ProductListingPresenter.php
1080 /src/Adapter/Presenter/Product/ProductPresenter.php
1081 /src/Adapter/Product/ProductColorsRetriever.php
1082 /src/Core/Product/ProductPresentationSettings.php
1083 /src/Adapter/Presenter/Product/ProductListingLazyArray.php
1084 /src/Adapter/Presenter/Product/ProductLazyArray.php
1085 /classes/Image.php
1086 /vendor/prestashop/decimal/src/Operation/Division.php
1087 /vendor/prestashop/decimal/src/Operation/Multiplication.php
1088 /vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php
1089 /var/cache/prod/smarty/compile/warehouse/d4/1d/65/d41d65d76b9471b5d365fe06cf1737c89a53af9f_2.module.ps_facetedsearchviewstemplatesfrontcatalogfacets.tpl.php
1090 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_block.php
1091 /vendor/smarty/smarty/libs/plugins/modifier.count.php
1092 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php
1093 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_foreach.php
1094 /var/cache/prod/smarty/compile/warehouse/2e/80/73/2e807335546cfa2360c36327ac89dd2fcb054379_2.module.ps_facetedsearchviewstemplatesfrontcatalogactivefilters.tpl.php
1095 /src/Core/Product/Search/Pagination.php
1096 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/bb/85/6b/bb856bc456eeb8d3881b4b16559692931100cee3_2.file.category.tpl.php
1097 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_capture.php
1098 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/92/5b/54/925b5420d64b948b3229da21ab6dd2ff798a7a1a_2.file.product-list.tpl.php
1099 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/24/3e/71/243e71636e97556888c0393b2f9b2707ca88ed68_2.file.layout-left-column.tpl.php
1100 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/71/d7/35/71d735abfb624f417275d842d825bca284f61193_2.file.layout-both-columns.tpl.php
1101 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/7d/45/b7/7d45b7ec7efac918307809de29557d44680a63e4_2.file.helpers.tpl.php
1102 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_tplfunction.php
1103 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/86/07/8b/86078b28459fa7cd90601729f42410aa6198246a_2.file.head.tpl.php
1104 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/75/a1/41/75a14189d0796b2f1afd51b5286ce629009a30ed_2.file.head-jsonld.tpl.php
1105 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/4f/0b/1f/4f0b1fdd2b9e22e8147a81c8cb2124c0a64a0d9f_2.file.product-list-jsonld.tpl.php
1106 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/53/60/5f/53605fdf8a8949b6a22d2d9cb063fe42d53e06b8_2.file.pagination-seo.tpl.php
1107 /vendor/smarty/smarty/libs/plugins/modifier.replace.php
1108 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/39/a8/b1/39a8b12a758387bfe9a459af55b35aa2633c339c_2.file.stylesheets.tpl.php
1109 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/cd/b1/00/cdb100cf3c2798f0d78781ef17d51d53ad8d6aa3_2.file.javascript.tpl.php
1110 /classes/ProductDownload.php
1111 /src/Core/Cart/Calculator.php
1112 /src/Core/Cart/CartRowCollection.php
1113 /src/Core/Cart/Fees.php
1114 /src/Core/Cart/AmountImmutable.php
1115 /src/Core/Cart/CartRuleCollection.php
1116 /src/Core/Cart/CartRuleCalculator.php
1117 /src/Adapter/Product/PriceCalculator.php
1118 /src/Core/Cart/CartRow.php
1119 /vendor/symfony/symfony/src/Symfony/Component/Translation/PluralizationRules.php
1120 /src/Core/Util/String/StringModifier.php
1121 /src/Core/Util/String/StringModifierInterface.php
1122 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/15/5f/49/155f4970adacdf2bb136d57371ece6919a20a9f4_2.file.product-activation.tpl.php
1123 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/49/3f/fd/493ffd63fb8e54f110fda59bc59cba5f0243b073_2.file.header.tpl.php
1124 /modules/iqithtmlandbanners/iqithtmlandbanners.php
1125 /modules/iqithtmlandbanners/src/IqitHtmlAndBannerRepository.php
1126 /modules/iqithtmlandbanners/src/IqitHtmlAndBannerPresenter.php
1127 /modules/iqithtmlandbanners/src/IqitHtmlAndBanner.php
1128 /modules/iqithtmlandbanners/translations/fr.php
1129 /vendor/smarty/smarty/libs/sysplugins/smarty_template_cached.php
1130 /vendor/smarty/smarty/libs/sysplugins/smarty_cacheresource.php
1131 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_cacheresource_file.php
1132 /var/cache/prod/smarty/cache/iqithtmlandbanners/1/1/1/1/8/displayNav1/warehouse/c7/74/df/c774dfa1ec092af1bad964e2e84d44e094a12e16.iqithtmlandbannersviewstemplateshookiqithtmlandbanners.tpl.php
1133 /modules/ps_languageselector/ps_languageselector.php
1134 /modules/ps_currencyselector/ps_currencyselector.php
1135 /var/cache/prod/smarty/compile/warehouse/b9/77/56/b97756c07f8c7dd53da6530f78f67ddd242f77c9_2.module.ps_currencyselectorps_currencyselector.tpl.php
1136 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/16/a1/8f/16a18f495002f0441eaa5151434d5866441bac65_2.file.header-2.tpl.php
1137 /modules/iqitsearch/iqitsearch.php
1138 /modules/iqitsearch/translations/fr.php
1139 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_method_gettemplatevars.php
1140 /var/cache/prod/smarty/compile/warehouse/78/3c/e0/783ce0bc99544193d9645b02e003b32e879d6a43_2.module.iqitsearchviewstemplateshookiqitsearch.tpl.php
1141 /var/cache/prod/smarty/compile/warehouse/46/29/db/4629dbb3c4efa13c090c633dc2e46e5f2b42bed3_2.module.iqitsearchviewstemplateshooksearchbar.tpl.php
1142 /modules/ps_customersignin/ps_customersignin.php
1143 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/72/be/19/72be192e406191c1cad554abe284e159adeb4234_2.module.ps_customersigninps_customersigninbtn.tpl.php
1144 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/b4/a4/76/b4a476e0a8201677b298f7c0f8ca1ac698e1bac3_2.module.ps_shoppingcartps_shoppingcartbtn.tpl.php
1145 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/35/65/5e/35655e6409b6198f29dd6e732ef9598dec599880_2.module.ps_shoppingcartps_shoppingcart.tpl.php
1146 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/f6/e9/f2/f6e9f2b1680a466582d2199d038efe2cfa3a83f7_2.module.ps_shoppingcartps_shoppingcartcontent.tpl.php
1147 /var/cache/prod/smarty/cache/iqitmegamenu/index/1/1/1/1/8/warehouse/12/c6/31/12c63107907c6d214b90e77509786468cad41332.iqitmegamenuviewstemplateshookhorizontal.tpl.php
1148 /classes/CMS.php
1149 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_updatecache.php
1150 /var/cache/prod/smarty/compile/warehouse/79/74/04/797404135c3d6163c184d5946c377ac2bc91c4d2_2.module.iqitmegamenuviewstemplateshookhorizontal.tpl.cache.php
1151 /vendor/smarty/smarty/libs/plugins/shared.mb_str_replace.php
1152 /var/cache/prod/smarty/compile/warehouse/47/0d/5c/470d5c96fd175e37e89afd5cc78d331c9756e29d_2.module.iqitmegamenuviewstemplateshook_partialssubmenu_content.tpl.cache.php
1153 /var/cache/prod/smarty/compile/warehouse/98/cb/9e/98cb9e3fbf4c879e219db3109049550b02a2da1b_2.module.iqitmegamenuviewstemplateshookmobile.tpl.cache.php
1154 /var/cache/prod/smarty/compile/warehouse/56/f0/d4/56f0d4faf7cc1ec9240e891fedda6e0b4794dc62_2.module.iqitmegamenuviewstemplateshook_partialssubmenu_content_mobile.tpl.cache.php
1155 /var/cache/prod/smarty/compile/warehouse/9b/b6/a9/9bb6a9970aa01b8fd3c752c16e574cb1b14bf323_2.module.ps_languageselectorps_languageselectormobilemenu.tpl.cache.php
1156 /var/cache/prod/smarty/compile/warehouse/dd/65/22/dd6522dbacb2ead7139cef7a64e59ac80e0726fc_2.module.ps_currencyselectorps_currencyselectormobilemenu.tpl.cache.php
1157 /var/cache/prod/smarty/compile/warehouse/d3/f6/c8/d3f6c8247111f1ef9bebabfff451b9cb9207ba0b_2.module.ps_customersigninps_customersigninmobilemenu.tpl.cache.php
1158 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_codeframe.php
1159 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_writefile.php
1160 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/27/7f/d3/277fd37fbd4e3d5997a6729163ed4291fb7b747e_2.file.mobile-header-1.tpl.php
1161 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/7a/30/38/7a3038780284d52e9fcd7a66e51e5b86a166106b_2.module.iqitsearchviewstemplateshooksearchbarmobile.tpl.php
1162 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/be/ee/e6/beeee6f3d87613010f8af1cabc4c4562f8cf600a_2.module.ps_customersigninps_customersigninmobile.tpl.php
1163 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/d4/e1/57/d4e1571b6b210795247564db06deb17061778b51_2.module.ps_shoppingcartps_shoppingcartmqty.tpl.php
1164 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/9a/64/f3/9a64f33010c8c3420bbc410257bdb57f0a9bc3be_2.file.breadcrumb.tpl.php
1165 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/d4/35/7f/d4357f43e19050f2d2f2028e6f165cd3b7cc2cd7_2.file.notifications.tpl.php
1166 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/a7/28/48/a72848955674ed794c6c6a5e504b11a1cb173ed8_2.file.category-header.tpl.php
1167 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/92/94/ca/9294ca5ac8cef4c021336349ebba4cf8ccc608a1_2.file.products-top.tpl.php
1168 /vendor/smarty/smarty/libs/plugins/modifier.regex_replace.php
1169 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/83/e9/08/83e90827ba40fafa2a771c4073ac57f31928625e_2.file.sort-orders.tpl.php
1170 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/18/fe/cb/18fecbdf20428cf6869837dea2e0d5ca5dd8d3ec_2.file.products.tpl.php
1171 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/3f/3e/f7/3f3ef74c741ca95575dc32ec76705f946e3422a0_2.file.product.tpl.php
1172 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/0d/c1/99/0dc199c5d12599ceeb88b6a2b1d98a7a56f14314_2.file.product-miniature-1.tpl.php
1173 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/b6/dd/21/b6dd2164727c4f6493fca8e8e7fc27495f5e513d_2.file.product-miniature-thumb.tpl.php
1174 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/56/c3/f2/56c3f2a516718b563166d070fcdb1702f53c5b74_2.file.product-miniature-btn.tpl.php
1175 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/c3/b4/5d/c3b45dd17613497fe3573058ca4c0e68116beb49_2.file.pagination.tpl.php
1176 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/d7/38/da/d738dab394eb6986b6d095fda5b79bd9db20b43b_2.file.products-bottom.tpl.php
1177 /modules/ps_categorytree/ps_categorytree.php
1178 /var/cache/prod/smarty/compile/warehouse/89/21/00/8921007f54626fc7fe42cbff53f1d70828d3393d_2.module.ps_categorytreeviewstemplateshookps_categorytree.tpl.php
1179 /var/cache/prod/smarty/compile/warehouse/81/a1/04/81a1040ed0eeab6f58198f9907167c7fced628c5_2.module.ps_facetedsearchps_facetedsearch.tpl.php
1180 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/a1/9f/e0/a19fe04169c26490610977ee4790590b01e18353_2.file.footer.tpl.php
1181 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/49/8a/94/498a94e3fb2e357d8f6d4e4c267d7b70c033a1c3_2.file.footer-1.tpl.php
1182 /modules/iqitlinksmanager/iqitlinksmanager.php
1183 /modules/iqitlinksmanager/src/IqitLinkBlockRepository.php
1184 /modules/iqitlinksmanager/src/IqitLinkBlock.php
1185 /modules/iqitlinksmanager/src/IqitLinkBlockPresenter.php
1186 /modules/iqitlinksmanager/translations/fr.php
1187 /var/cache/prod/smarty/cache/iqitlinksmanager/1/1/1/1/8/displayFooter/warehouse/a3/94/0b/a3940bd1d7ebdb077f5394215b97cf9d975f5741.iqitlinksmanagerviewstemplateshookiqitlinksmanager.tpl.php
1188 /var/cache/prod/smarty/cache/iqitcontactpage/1/1/1/1/8/warehouse/c4/e5/8b/c4e58ba5baab27adb5450fcac6725664cd1cef81.iqitcontactpageviewstemplateshookiqitcontactpageblock.tpl.php
1189 /var/cache/prod/smarty/compile/warehouse/ee/75/26/ee752603de038a9aef5378771f6bf531aa9e40f3_2.module.iqitcontactpageviewstemplateshookiqitcontactpageblock.tpl.cache.php
1190 /var/cache/prod/smarty/compile/warehouse/44/b4/ef/44b4ef888deb2f933dcd9da2c1066fcd712ea5c6_2.module.iqitcontactpageviewstemplateshook_partialscontent.tpl.cache.php
1191 /var/cache/prod/smarty/compile/warehouse/2d/c2/29/2dc229bcd2fcd72db57e2012572582b00bdf5abe_2.file.cookieslaw.tpl.php
1192 /vendor/smarty/smarty/libs/plugins/modifier.escape.php
1193 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/63/d3/ad/63d3adee5f6b5e391329228d089f792c3bb82b69_2.file.social-links.tpl.php
1194 /var/cache/prod/smarty/compile/warehouse/30/7d/c6/307dc6bd4724d29d1572cc301dd7148e962604ef_2.module.ps_emailsubscriptionviewstemplateshookps_emailsubscription.tpl.php
1195 /modules/psgdpr/psgdpr.php
1196 /modules/psgdpr/translations/fr.php
1197 /modules/psgdpr/classes/GDPRConsent.php
1198 /var/cache/prod/smarty/compile/warehouse/5e/ee/24/5eee242e5cbca9bb89b8ffa439cebef7beaaf2e4_2.module.psgdprviewstemplateshookdisplayGDPRConsent.tpl.php
1199 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/16/d6/b8/16d6b8721374815caf8784f27e2d077ed824ca86_2.file.footer-copyrights-1.tpl.php
1200 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/22/f3/55/22f35596a1c264e5427f9b58f5206b3b8a797425_2.file.password-policy-template.tpl.php
1201 /modules/statsdata/statsdata.php
1202 /classes/Connection.php
1203 /classes/ConnectionsSource.php