Accueil

Load Time 4068 ms
Querying Time 3008 ms
Queries 4408
Memory Peak Usage 78.5 Mb
Included Files 1204 files - 13.59 Mb
PrestaShop Cache 4.03 Mb
Global vars 0.43 Mb
PrestaShop Version 8.2.1
PHP Version 8.1.32
MySQL Version 10.11.11-MariaDB-0ubuntu0.24.04.2
Memory Limit 4096M
Max Execution Time 600s
Smarty Cache enabled
Smarty Compilation auto
  Time Cumulated Time Memory Usage Memory Peak Usage
config 1.920 ms 1.920 ms 3.21 Mb 3.6 Mb
__construct 0.020 ms 1.940 ms - Mb 3.6 Mb
init 25.872 ms 27.812 ms 0.89 Mb 4.4 Mb
checkAccess 0.004 ms 27.816 ms - Mb 4.4 Mb
setMedia 18.457 ms 46.273 ms 0.61 Mb 4.7 Mb
postProcess 0.004 ms 46.277 ms - Mb 4.7 Mb
initHeader 0.002 ms 46.279 ms - Mb 4.7 Mb
initContent 3478 ms 3524 ms 49.77 Mb 54.6 Mb
initFooter 0.003 ms 3524 ms - Mb 54.6 Mb
display 543.363 ms 4068 ms 20.38 Mb 78.5 Mb
Hook Time Memory Usage
displayMainMenu 110.367 ms 5.81 Mb
displayLeftColumn 15.718 ms 0.74 Mb
ActionFrontControllerSetMedia 9.213 ms 0.19 Mb
displayNav2 6.079 ms 0.19 Mb
displayFooter 5.209 ms 0.38 Mb
Footer 3.965 ms 0.18 Mb
displayNav1 3.345 ms 0.08 Mb
DisplayHeader 3.046 ms 0.09 Mb
renderWidget 1.438 ms 0.05 Mb
DisplayBeforeBodyClosingTag 1.280 ms 0.05 Mb
DisplayGDPRConsent 1.068 ms 0.08 Mb
IsJustElementor 0.770 ms 0.02 Mb
ProductSearchProvider 0.430 ms - Mb
DisplayLeftColumn 0.295 ms 0.03 Mb
Header 0.143 ms - Mb
OverrideLayoutTemplate 0.065 ms - Mb
displayVerticalMenu 0.017 ms - Mb
ActionDispatcher 0.013 ms - Mb
DisplayNavFullWidth 0.013 ms - Mb
ActionProductSearchAfter 0.012 ms - Mb
Top 0.012 ms - Mb
DisplayFooterBefore 0.011 ms - Mb
DisplayAfterBodyOpeningTag 0.010 ms - Mb
DisplayFooterAfter 0.009 ms - Mb
ModuleRoutes 0.008 ms - Mb
25 hook(s) 162.536 ms 7.88 Mb
Module Time Memory Usage
ps_checkout 10.883 ms 0.22 Mb
iqitthemeeditor 1.145 ms 0.18 Mb
ps_emailsubscription 2.968 ms 0.26 Mb
blockreassurance 0.304 ms 0.02 Mb
nkmgls 5.323 ms 0.30 Mb
paybox 2.597 ms 0.08 Mb
ps_emailalerts 0.264 ms 0.01 Mb
ps_accounts 0.441 ms - Mb
revsliderprestashop 1.983 ms 0.05 Mb
productcomments 0.265 ms 0.01 Mb
ps_shoppingcart 0.192 ms 0.01 Mb
iqitcontactpage 2.207 ms 0.07 Mb
iqitsociallogin 0.302 ms 0.01 Mb
iqitmegamenu 110.839 ms 5.82 Mb
iqitelementor 1.435 ms 0.03 Mb
iqitfreedeliverycount 0.244 ms 0.01 Mb
sendinblue 1.200 ms 0.04 Mb
colissimo_simplicite 2.943 ms 0.09 Mb
lgcookieslaw 4.688 ms 0.19 Mb
ps_facetedsearch 1.449 ms 0.09 Mb
iqithtmlandbanners 3.662 ms 0.16 Mb
ps_languageselector 0.640 ms 0.05 Mb
ps_currencyselector 5.671 ms 0.15 Mb
iqitsearch 1.820 ms - Mb
ps_customersignin 0.125 ms 0.01 Mb
ps_categorytree 15.860 ms 0.75 Mb
iqitlinksmanager 1.183 ms 0.08 Mb
psgdpr 1.444 ms 0.19 Mb
statsdata 1.377 ms 0.05 Mb
29 module(s) 183.453 ms 8.87 Mb

Stopwatch SQL - 4408 queries

# Query Time (ms) Rows Filesort Group By Location
87
SELECT SQL_NO_CACHE p.id_product FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM hgt78_product p LEFT JOIN hgt78_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN hgt78_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN hgt78_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN hgt78_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN hgt78_category_product cp ON (p.id_product = cp.id_product) INNER JOIN hgt78_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN hgt78_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN hgt78_category_group cg ON (cg.id_category = c.id_category) WHERE ((sa.quantity>0)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND cp.id_category IN (319, 36) GROUP BY p.id_product) p INNER JOIN hgt78_category_product cp ON (p.id_product = cp.id_product) GROUP BY p.id_product ORDER BY p.position ASC, p.id_product DESC
488.053 ms 35424 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
2
SELECT SQL_NO_CACHE c.`name`, cl.`id_lang`, IF(cl.`id_lang` IS NULL, c.`value`, cl.`value`) AS value, c.id_shop_group, c.id_shop
FROM `hgt78_configuration` c
LEFT JOIN `hgt78_configuration_lang` cl ON (c.`id_configuration` = cl.`id_configuration`)
14.515 ms 5859 /classes/Configuration.php:180
89
SELECT SQL_NO_CACHE p.*,
ps.*,
pl.*,
sa.out_of_stock,
IFNULL(sa.quantity, 0) as quantity,
(DATEDIFF(
p.`date_add`,
DATE_SUB(
'2025-05-01 00:00:00',
INTERVAL 20 DAY
)
) > 0) as new
FROM hgt78_product p
LEFT JOIN hgt78_product_lang pl
ON pl.id_product = p.id_product
AND pl.id_shop = 1
AND pl.id_lang = 1
LEFT JOIN hgt78_stock_available sa   ON sa.id_product = p.id_product
AND sa.id_product_attribute = 0
AND sa.id_shop = 1 LEFT JOIN hgt78_product_shop ps
ON ps.id_product = p.id_product
AND ps.id_shop = 1
WHERE p.id_product IN (6017,2553,12682,4225,4224,4286,4285,4282,4280,4279,4309,4310,2554,4317,4315,4314,4313,4278,4277,4276,4264,4263,4262,4260,4259,4248,4212,4266,4275,3183,4274,4271,4270,4269,4267,2547,4318,2528,2529,2531,2532,2533,2534,4329,4328,2493,4327,4324,4323,4322,4321,2536,2537,2543,2542,2541,2545,2546,4281,2548,2549,2550,2552,2538,2539,2540,2544,3554,3553,4218,2941,4216,4214,4210,4213,4114,4113,4112,4111,4105,4109,4106,4116,4069,4074,3184,3042,3041,2845,2608,2606,2844,4088,4080,2523,2522,2518,2476,2487,2517,2516,2474,2524,2525,2526,2599,2597,2558,2916,2801,2430,3056,4043,4044,4046,4047,4048,4060,4061,4062,4064,4090,4129,4130,4133,4148,4140,4141,4146,4142,4144,4183,4195,4196,4206,4207,4303,4307,4306,4304,4227,4572,4573,4576,4577,4697,4696,5033,5036,5037,5038,5039,5040,5041,5042,5043,5044,5045,5046,5047,5048,5049,5050,5051,5052,5053,5054,5055,5056,5057,5058,5059,5078,5081,5158,5159,5173,5174,5308,5322,5331,5332,5334,5470,5472,6043,6044,6151,6152,6153,6154,6155,6156,6157,6158,6159,6198,6435,6664,7952,7954,7957,7958,7959,7962,2515,2491,8978,8984,8985,8986,9057,9058,9059,9061,9062,9063,9067,9068,9069,9070,9071,9072,9073,9074,9075,9076,9077,9078,9079,9081,9082,9084,9085,9086,9089,9090,9091,9092,9093,9094,9095,9096,9097,9098,9099,9100,9101,9102,9103,9104,9105,9106,9107,9108,9144,9262,9266,9733,10423,10424,10467,10469,10576,10852,10853,10891,10926,10928,10999)
13.509 ms 270 /classes/ProductAssembler.php:95
4386
SELECT SQL_NO_CACHE c.*, cl.*
FROM `hgt78_category` c
INNER JOIN hgt78_category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1)
LEFT JOIN `hgt78_category_lang` cl ON c.`id_category` = cl.`id_category` AND cl.id_shop = 1 
LEFT JOIN `hgt78_category_group` cg ON c.`id_category` = cg.`id_category`
RIGHT JOIN `hgt78_category` c2 ON c2.`id_category` = 2 AND c.`nleft` >= c2.`nleft` AND c.`nright` <= c2.`nright`
WHERE 1 AND c.`level_depth` <= 5 AND `id_lang` = 1
AND c.`active` = 1
AND cg.`id_group` IN (1)
GROUP BY c.`id_category`
ORDER BY c.`level_depth` ASC, category_shop.`position` ASC
8.961 ms 242 Yes Yes /classes/Category.php:799
569
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2534
AND image_shop.`cover` = 1 LIMIT 1
8.681 ms 1 /classes/Product.php:3570
103
SELECT SQL_NO_CACHE `id_hook`, `name`
FROM `hgt78_hook`
UNION
SELECT `id_hook`, ha.`alias` as name
FROM `hgt78_hook_alias` ha
INNER JOIN `hgt78_hook` h ON ha.name = h.name
8.283 ms 0 /classes/Hook.php:1348
2767
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 9094 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
5.303 ms 18 Yes /classes/SpecificPrice.php:576
3215
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2531
ORDER BY `position`
5.151 ms 1 Yes /classes/Product.php:3545
1837
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 5044
ORDER BY f.position ASC
5.077 ms 5 Yes /classes/Product.php:6021
443
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4274 AND id_shop=1 LIMIT 1
4.869 ms 1 /classes/Product.php:6876
166
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4286 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
4.826 ms 10 Yes /classes/SpecificPrice.php:576
2475
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 9061
AND image_shop.`cover` = 1 LIMIT 1
4.759 ms 1 /classes/Product.php:3570
3690
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 6198
4.726 ms 1 /classes/Product.php:2902
104
SELECT SQL_NO_CACHE h.id_hook, h.name as h_name, title, description, h.position, hm.position as hm_position, m.id_module, m.name, m.active
FROM `hgt78_hook_module` hm
STRAIGHT_JOIN `hgt78_hook` h ON (h.id_hook = hm.id_hook AND hm.id_shop = 1)
STRAIGHT_JOIN `hgt78_module` as m ON (m.id_module = hm.id_module)
ORDER BY hm.position
4.698 ms 721 /classes/Hook.php:459
1781
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 5039 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 5039 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
4.648 ms 0 /classes/Cart.php:1430
3219
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2532
4.544 ms 1 /classes/Product.php:2902
3691
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 6435) AND (b.`id_shop` = 1) LIMIT 1
4.525 ms 1 /src/Adapter/EntityMapper.php:71
1847
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 5045 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 5045 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
4.463 ms 0 /classes/Cart.php:1430
1893
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 5050
AND image_shop.`cover` = 1 LIMIT 1
4.407 ms 2 /classes/Product.php:3570
3045
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 10853 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
4.307 ms 12 Yes /classes/SpecificPrice.php:576
1788
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 5040)
4.289 ms 1 /classes/Product.php:3860
776
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2549 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2549 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
4.285 ms 0 /classes/Cart.php:1430
3833
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 9098
ORDER BY `position`
4.221 ms 1 Yes /classes/Product.php:3545
320
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4276 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
4.183 ms 11 Yes /classes/SpecificPrice.php:576
1874
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 5048
ORDER BY `id_specific_price_priority` DESC LIMIT 1
4.162 ms 0 /classes/SpecificPrice.php:259
463
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4270 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
4.080 ms 10 Yes /classes/SpecificPrice.php:576
1814
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 5042 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 5042 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
4.072 ms 0 /classes/Cart.php:1430
3209
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2528
ORDER BY `position`
4.069 ms 2 Yes /classes/Product.php:3545
529
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2529 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
4.042 ms 10 Yes /classes/SpecificPrice.php:576
1798
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 5041 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
4.016 ms 10 Yes /classes/SpecificPrice.php:576
283
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4313
AND image_shop.`cover` = 1 LIMIT 1
3.917 ms 1 /classes/Product.php:3570
519
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2528)
3.904 ms 1 /classes/Product.php:3860
1811
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 5042 AND id_shop=1 LIMIT 1
3.879 ms 1 /classes/Product.php:6876
1846
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 5045) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
3.863 ms 1 /classes/stock/StockAvailable.php:453
345
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4263 AND `id_group` = 1 LIMIT 1
3.858 ms 0 /classes/GroupReduction.php:156
3374
SELECT SQL_NO_CACHE h.`name` as hook, m.`id_module`, h.`id_hook`, m.`name` as module
FROM `hgt78_module` m
INNER JOIN hgt78_module_shop module_shop
ON (module_shop.id_module = m.id_module AND module_shop.id_shop = 1 AND module_shop.enable_device & 1)
INNER JOIN `hgt78_hook_module` `hm` ON hm.`id_module` = m.`id_module`
INNER JOIN `hgt78_hook` `h` ON hm.`id_hook` = h.`id_hook`
LEFT JOIN `hgt78_module_group` `mg` ON mg.`id_module` = m.`id_module`
WHERE (h.`name` != "paymentOptions") AND (hm.`id_shop` = 1) AND (mg.id_shop = 1 AND  mg.`id_group` IN (1))
GROUP BY hm.id_hook, hm.id_module
ORDER BY hm.`position`
3.750 ms 219 Yes Yes /classes/Hook.php:1289
391
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4248 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4248 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
3.663 ms 0 /classes/Cart.php:1430
570
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
3.659 ms 1 /classes/Product.php:5659
1861
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
3.656 ms 1 /classes/Product.php:5659
1468
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4130)
3.637 ms 1 /classes/Product.php:3860
2220
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 6155 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
3.620 ms 11 Yes /classes/SpecificPrice.php:576
1783
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 5040
AND image_shop.`cover` = 1 LIMIT 1
3.617 ms 2 /classes/Product.php:3570
530
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2529)
3.587 ms 1 /classes/Product.php:3860
2154
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 6043 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
3.566 ms 10 Yes /classes/SpecificPrice.php:576
91
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `hgt78_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 201 LIMIT 1
3.562 ms 1 /classes/Category.php:1378
2635
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 9078 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
3.500 ms 13 Yes /classes/SpecificPrice.php:576
2463
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 9058
ORDER BY f.position ASC
3.496 ms 5 Yes /classes/Product.php:6021
1852
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 5046
ORDER BY `id_specific_price_priority` DESC LIMIT 1
3.486 ms 1 /classes/SpecificPrice.php:259
837
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2544 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
3.483 ms 10 Yes /classes/SpecificPrice.php:576
152
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
3.479 ms 1 /classes/Product.php:5659
3920
SELECT SQL_NO_CACHE 1 FROM `hgt78_cart_rule` WHERE ((date_to >= "2025-05-01 00:00:00" AND date_to <= "2025-05-01 23:59:59") OR (date_from >= "2025-05-01 00:00:00" AND date_from <= "2025-05-01 23:59:59") OR (date_from < "2025-05-01 00:00:00" AND date_to > "2025-05-01 23:59:59")) AND `id_customer` IN (0,0) LIMIT 1
3.467 ms 29 /classes/CartRule.php:357
1774
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 5039 LIMIT 1
3.460 ms 10 /classes/SpecificPrice.php:435
4020
SELECT SQL_NO_CACHE c.*, cl.*
FROM `hgt78_category` c
INNER JOIN hgt78_category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1)
LEFT JOIN `hgt78_category_lang` cl ON c.`id_category` = cl.`id_category` AND cl.id_shop = 1 
LEFT JOIN `hgt78_category_group` cg ON c.`id_category` = cg.`id_category`
RIGHT JOIN `hgt78_category` c2 ON c2.`id_category` = 37 AND c.`nleft` >= c2.`nleft` AND c.`nright` <= c2.`nright`
WHERE 1  AND `id_lang` = 1
AND c.`active` = 1
AND cg.`id_group` IN (1)
GROUP BY c.`id_category`
ORDER BY c.`level_depth` ASC
, category_shop.`position` ASC
3.421 ms 148 Yes Yes /classes/Category.php:799
2510
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 117 LIMIT 1
3.366 ms 1 /classes/Product.php:5659
1809
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 5042 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
3.299 ms 10 Yes /classes/SpecificPrice.php:576
505
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4318 LIMIT 1
3.220 ms 10 /classes/SpecificPrice.php:435
150
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4225
ORDER BY f.position ASC
3.213 ms 5 Yes /classes/Product.php:6021
160
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4224 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4224 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
3.202 ms 0 /classes/Cart.php:1430
2464
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 9059
AND image_shop.`cover` = 1 LIMIT 1
3.200 ms 1 /classes/Product.php:3570
340
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4263 LIMIT 1
3.095 ms 10 /classes/SpecificPrice.php:435
568
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2533
ORDER BY f.position ASC
3.077 ms 5 Yes /classes/Product.php:6021
1825
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 5043 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 5043 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
3.054 ms 0 /classes/Cart.php:1430
882
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2941)
3.053 ms 1 /classes/Product.php:3860
2883
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 9104
ORDER BY f.position ASC
3.049 ms 5 Yes /classes/Product.php:6021
2462
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 9058 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 9058 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
3.041 ms 0 /classes/Cart.php:1430
502
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2547
ORDER BY f.position ASC
3.027 ms 5 Yes /classes/Product.php:6021
1827
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 5044
AND image_shop.`cover` = 1 LIMIT 1
3.014 ms 2 /classes/Product.php:3570
1777
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 5039)
2.992 ms 1 /classes/Product.php:3860
4363
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (9103) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
2.964 ms 1 Yes Yes /classes/Product.php:4524
503
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4318
AND image_shop.`cover` = 1 LIMIT 1
2.887 ms 1 /classes/Product.php:3570
3826
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 9096) AND (b.`id_shop` = 1) LIMIT 1
2.837 ms 1 /src/Adapter/EntityMapper.php:71
4362
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (9102) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
2.789 ms 1 Yes Yes /classes/Product.php:4524
2646
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 9079 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
2.750 ms 18 Yes /classes/SpecificPrice.php:576
3692
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 6435
ORDER BY `position`
2.743 ms 1 Yes /classes/Product.php:3545
1130
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4088 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4088 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
2.712 ms 0 /classes/Cart.php:1430
2640
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 9078 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 9078 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
2.672 ms 0 /classes/Cart.php:1430
3836
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 9099
ORDER BY `position`
2.670 ms 1 Yes /classes/Product.php:3545
3832
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 9098) AND (b.`id_shop` = 1) LIMIT 1
2.662 ms 1 /src/Adapter/EntityMapper.php:71
304
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4278
ORDER BY f.position ASC
2.658 ms 5 Yes /classes/Product.php:6021
2580
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 9073 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
2.654 ms 10 Yes /classes/SpecificPrice.php:576
2225
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 6155 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 6155 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
2.631 ms 0 /classes/Cart.php:1430
2882
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 9104 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 9104 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
2.577 ms 0 /classes/Cart.php:1430
514
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2528
AND image_shop.`cover` = 1 LIMIT 1
2.554 ms 2 /classes/Product.php:3570
1850
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
2.545 ms 1 /classes/Product.php:5659
1858
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 5046 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 5046 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
2.524 ms 0 /classes/Cart.php:1430
3918
SELECT SQL_NO_CACHE 1 FROM `hgt78_cart_rule` WHERE ((date_to >= "2025-05-01 00:00:00" AND date_to <= "2025-05-01 23:59:59") OR (date_from >= "2025-05-01 00:00:00" AND date_from <= "2025-05-01 23:59:59") OR (date_from < "2025-05-01 00:00:00" AND date_to > "2025-05-01 23:59:59")) AND `id_customer` IN (0,0) LIMIT 1
2.522 ms 29 /classes/CartRule.php:357
1539
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4142
ORDER BY f.position ASC
2.516 ms 5 Yes /classes/Product.php:6021
364
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4260 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
2.504 ms 10 Yes /classes/SpecificPrice.php:576
4348
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (9086) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
2.478 ms 1 Yes Yes /classes/Product.php:4524
2560
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 9071 AND id_shop=1 LIMIT 1
2.472 ms 1 /classes/Product.php:6876
2629
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 9077 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 9077 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
2.470 ms 0 /classes/Cart.php:1430
14
SELECT SQL_NO_CACHE h.`name` as hook, m.`id_module`, h.`id_hook`, m.`name` as module
FROM `hgt78_module` m
INNER JOIN hgt78_module_shop module_shop
ON (module_shop.id_module = m.id_module AND module_shop.id_shop = 1 AND module_shop.enable_device & 1)
INNER JOIN `hgt78_hook_module` `hm` ON hm.`id_module` = m.`id_module`
INNER JOIN `hgt78_hook` `h` ON hm.`id_hook` = h.`id_hook`
LEFT JOIN `hgt78_module_group` `mg` ON mg.`id_module` = m.`id_module`
WHERE (h.`name` != "paymentOptions") AND (hm.`id_shop` = 1) AND (mg.id_shop = 1 AND  mg.`id_group` IN (1))
GROUP BY hm.id_hook, hm.id_module
ORDER BY hm.`position`
2.455 ms 219 Yes Yes /classes/Hook.php:1289
4366
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (9106) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
2.450 ms 1 Yes Yes /classes/Product.php:4524
358
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4262 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4262 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
2.446 ms 0 /classes/Cart.php:1430
3248
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4321
ORDER BY `position`
2.418 ms 1 Yes /classes/Product.php:3545
3247
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4321) AND (b.`id_shop` = 1) LIMIT 1
2.397 ms 1 /src/Adapter/EntityMapper.php:71
2623
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 9077
ORDER BY `id_specific_price_priority` DESC LIMIT 1
2.386 ms 0 /classes/SpecificPrice.php:259
3944
SELECT SQL_NO_CACHE c.*, cl.*
FROM `hgt78_category` c
INNER JOIN hgt78_category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1)
LEFT JOIN `hgt78_category_lang` cl ON c.`id_category` = cl.`id_category` AND cl.id_shop = 1 
LEFT JOIN `hgt78_category_group` cg ON c.`id_category` = cg.`id_category`
RIGHT JOIN `hgt78_category` c2 ON c2.`id_category` = 40 AND c.`nleft` >= c2.`nleft` AND c.`nright` <= c2.`nright`
WHERE 1  AND `id_lang` = 1
AND c.`active` = 1
AND cg.`id_group` IN (1)
GROUP BY c.`id_category`
ORDER BY c.`level_depth` ASC
, category_shop.`position` ASC
2.383 ms 73 Yes Yes /classes/Category.php:799
339
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
2.379 ms 1 /classes/Product.php:5659
1834
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 5044 AND `id_group` = 1 LIMIT 1
2.356 ms 0 /classes/GroupReduction.php:156
3834
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 9098
2.352 ms 1 /classes/Product.php:2902
2768
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 9094)
2.346 ms 1 /classes/Product.php:3860
1869
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 5047 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 5047 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
2.330 ms 0 /classes/Cart.php:1430
2595
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 9074) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
2.326 ms 1 /classes/stock/StockAvailable.php:453
133
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 12682 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
2.312 ms 14 Yes /classes/SpecificPrice.php:576
129
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 34 LIMIT 1
2.296 ms 1 /classes/Product.php:5659
793
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2552 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
2.276 ms 10 Yes /classes/SpecificPrice.php:576
2532
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 9069
AND image_shop.`cover` = 1 LIMIT 1
2.275 ms 1 /classes/Product.php:3570
3230
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4328
ORDER BY `position`
2.264 ms 1 Yes /classes/Product.php:3545
1770
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 5038 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 5038 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
2.252 ms 0 /classes/Cart.php:1430
4370
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (9262) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
2.249 ms 1 Yes Yes /classes/Product.php:4524
428
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3183 LIMIT 1
2.245 ms 10 /classes/SpecificPrice.php:435
1919
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 5052 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
2.186 ms 10 Yes /classes/SpecificPrice.php:576
523
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2528 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2528 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
2.181 ms 0 /classes/Cart.php:1430
2656
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 9081
ORDER BY `id_specific_price_priority` DESC LIMIT 1
2.181 ms 0 /classes/SpecificPrice.php:259
1656
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4227 AND id_shop=1 LIMIT 1
2.174 ms 1 /classes/Product.php:6876
2651
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 9079 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 9079 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
2.167 ms 0 /classes/Cart.php:1430
1592
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4206) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
2.163 ms 1 /classes/stock/StockAvailable.php:453
3416
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2599
ORDER BY `position`
2.162 ms 1 Yes /classes/Product.php:3545
797
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2552) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
2.153 ms 1 /classes/stock/StockAvailable.php:453
3222
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2533
2.145 ms 1 /classes/Product.php:2902
1897
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 5050 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
2.143 ms 10 Yes /classes/SpecificPrice.php:576
354
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4262)
2.140 ms 1 /classes/Product.php:3860
2633
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 9078 LIMIT 1
2.137 ms 13 /classes/SpecificPrice.php:435
1793
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 5040
ORDER BY f.position ASC
2.132 ms 5 Yes /classes/Product.php:6021
2609
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 9076
AND image_shop.`cover` = 1 LIMIT 1
2.107 ms 1 /classes/Product.php:3570
2027
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 5158 LIMIT 1
2.102 ms 10 /classes/SpecificPrice.php:435
2024
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 5081
ORDER BY f.position ASC
2.097 ms 5 Yes /classes/Product.php:6021
3956
SELECT SQL_NO_CACHE c.*, cl.*
FROM `hgt78_category` c
INNER JOIN hgt78_category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1)
LEFT JOIN `hgt78_category_lang` cl ON c.`id_category` = cl.`id_category` AND cl.id_shop = 1 
LEFT JOIN `hgt78_category_group` cg ON c.`id_category` = cg.`id_category`
RIGHT JOIN `hgt78_category` c2 ON c2.`id_category` = 38 AND c.`nleft` >= c2.`nleft` AND c.`nright` <= c2.`nright`
WHERE 1  AND `id_lang` = 1
AND c.`active` = 1
AND cg.`id_group` IN (1)
GROUP BY c.`id_category`
ORDER BY c.`level_depth` ASC
, category_shop.`position` ASC
2.092 ms 93 Yes Yes /classes/Category.php:799
512
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4318 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4318 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
2.080 ms 0 /classes/Cart.php:1430
821
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2539
ORDER BY f.position ASC
2.074 ms 5 Yes /classes/Product.php:6021
860
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3553)
2.059 ms 1 /classes/Product.php:3860
773
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2549 AND id_shop=1 LIMIT 1
2.052 ms 1 /classes/Product.php:6876
1931
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 5053)
2.051 ms 1 /classes/Product.php:3860
350
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
2.047 ms 1 /classes/Product.php:5659
409
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4266)
2.045 ms 1 /classes/Product.php:3860
1472
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4130 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4130 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
2.043 ms 0 /classes/Cart.php:1430
1838
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 5045
AND image_shop.`cover` = 1 LIMIT 1
2.038 ms 2 /classes/Product.php:3570
2002
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 5059
ORDER BY f.position ASC
2.023 ms 5 Yes /classes/Product.php:6021
2888
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 9105 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
2.019 ms 10 Yes /classes/SpecificPrice.php:576
1726
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4696 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4696 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
2.015 ms 0 /classes/Cart.php:1430
3200
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4267
ORDER BY `position`
2.014 ms 1 Yes /classes/Product.php:3545
1195
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2487) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
1.993 ms 1 /classes/stock/StockAvailable.php:453
3689
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 6198
ORDER BY `position`
1.991 ms 1 Yes /classes/Product.php:3545
841
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2544) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
1.985 ms 1 /classes/stock/StockAvailable.php:453
3830
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 9097
ORDER BY `position`
1.982 ms 1 Yes /classes/Product.php:3545
4345
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (9082) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.979 ms 1 Yes Yes /classes/Product.php:4524
528
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2529
ORDER BY `id_specific_price_priority` DESC LIMIT 1
1.973 ms 0 /classes/SpecificPrice.php:259
3227
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4329
ORDER BY `position`
1.963 ms 1 Yes /classes/Product.php:3545
4397
SELECT SQL_NO_CACHE required FROM hgt78_lgcookieslaw_lang WHERE id_lang = 1 LIMIT 1
1.962 ms 1 /modules/lgcookieslaw/lgcookieslaw.php:161
805
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2538)
1.953 ms 1 /classes/Product.php:3860
2973
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 9733
ORDER BY f.position ASC
1.952 ms 5 Yes /classes/Product.php:6021
854
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3554
ORDER BY f.position ASC
1.945 ms 5 Yes /classes/Product.php:6021
3217
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2532) AND (b.`id_shop` = 1) LIMIT 1
1.927 ms 1 /src/Adapter/EntityMapper.php:71
2828
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 9099
ORDER BY f.position ASC
1.912 ms 5 Yes /classes/Product.php:6021
1886
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 5049 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.900 ms 10 Yes /classes/SpecificPrice.php:576
673
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2536)
1.898 ms 1 /classes/Product.php:3860
424
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4275 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4275 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.892 ms 0 /classes/Cart.php:1430
1276
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
1.877 ms 1 /classes/Product.php:5659
1881
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 5048
ORDER BY f.position ASC
1.861 ms 5 Yes /classes/Product.php:6021
666
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4321 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4321 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.852 ms 0 /classes/Cart.php:1430
2001
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 5059 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 5059 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.842 ms 0 /classes/Cart.php:1430
2576
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 9073
AND image_shop.`cover` = 1 LIMIT 1
1.840 ms 1 /classes/Product.php:3570
1928
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 5053 LIMIT 1
1.836 ms 10 /classes/SpecificPrice.php:435
1833
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 5044 AND id_shop=1 LIMIT 1
1.833 ms 1 /classes/Product.php:6876
2972
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 9733 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 9733 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.822 ms 0 /classes/Cart.php:1430
3024
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 10576)
1.800 ms 1 /classes/Product.php:3860
2545
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 9070 LIMIT 1
1.793 ms 10 /classes/SpecificPrice.php:435
4365
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (9105) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.789 ms 1 Yes Yes /classes/Product.php:4524
551
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2532 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.788 ms 10 Yes /classes/SpecificPrice.php:576
562
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2533 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.781 ms 10 Yes /classes/SpecificPrice.php:576
716
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2541 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.781 ms 10 Yes /classes/SpecificPrice.php:576
1780
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 5039) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
1.772 ms 1 /classes/stock/StockAvailable.php:453
2989
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 10424 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.772 ms 10 Yes /classes/SpecificPrice.php:576
755
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4281
ORDER BY f.position ASC
1.763 ms 5 Yes /classes/Product.php:6021
349
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4262
AND image_shop.`cover` = 1 LIMIT 1
1.756 ms 1 /classes/Product.php:3570
710
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2542 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2542 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.754 ms 0 /classes/Cart.php:1430
4089
SELECT SQL_NO_CACHE c.*, cl.*
FROM `hgt78_category` c
INNER JOIN hgt78_category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1)
LEFT JOIN `hgt78_category_lang` cl ON c.`id_category` = cl.`id_category` AND cl.id_shop = 1 
LEFT JOIN `hgt78_category_group` cg ON c.`id_category` = cg.`id_category`
RIGHT JOIN `hgt78_category` c2 ON c2.`id_category` = 36 AND c.`nleft` >= c2.`nleft` AND c.`nright` <= c2.`nright`
WHERE 1  AND `id_lang` = 1
AND c.`active` = 1
AND cg.`id_group` IN (1)
GROUP BY c.`id_category`
ORDER BY c.`level_depth` ASC
, category_shop.`position` ASC
1.751 ms 73 Yes Yes /classes/Category.php:799
2639
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 9078) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
1.749 ms 1 /classes/stock/StockAvailable.php:453
3245
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4322
ORDER BY `position`
1.749 ms 1 Yes /classes/Product.php:3545
1831
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 5044 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.748 ms 10 Yes /classes/SpecificPrice.php:576
752
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4281 AND `id_group` = 1 LIMIT 1
1.748 ms 0 /classes/GroupReduction.php:156
622
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4327 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4327 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.737 ms 0 /classes/Cart.php:1430
2750
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 9092 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 9092 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.735 ms 0 /classes/Cart.php:1430
520
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2528 AND id_shop=1 LIMIT 1
1.726 ms 1 /classes/Product.php:6876
871
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4218)
1.721 ms 1 /classes/Product.php:3860
2927
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 9108
ORDER BY f.position ASC
1.719 ms 5 Yes /classes/Product.php:6021
2252
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 6158
ORDER BY `id_specific_price_priority` DESC LIMIT 1
1.713 ms 0 /classes/SpecificPrice.php:259
3828
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 9096
1.712 ms 1 /classes/Product.php:2902
743
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2546 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2546 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.710 ms 0 /classes/Cart.php:1430
788
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2550
ORDER BY f.position ASC
1.710 ms 5 Yes /classes/Product.php:6021
2663
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 9081
ORDER BY f.position ASC
1.706 ms 5 Yes /classes/Product.php:6021
840
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2544 AND `id_group` = 1 LIMIT 1
1.701 ms 0 /classes/GroupReduction.php:156
2479
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 9061 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.696 ms 18 Yes /classes/SpecificPrice.php:576
3040
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 10852
ORDER BY f.position ASC
1.692 ms 5 Yes /classes/Product.php:6021
1930
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 5053 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.690 ms 10 Yes /classes/SpecificPrice.php:576
2457
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 9058 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.689 ms 11 Yes /classes/SpecificPrice.php:576
595
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4328 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.686 ms 10 Yes /classes/SpecificPrice.php:576
1599
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4207 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.680 ms 10 Yes /classes/SpecificPrice.php:576
351
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4262 LIMIT 1
1.677 ms 10 /classes/SpecificPrice.php:435
2029
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 5158 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.677 ms 10 Yes /classes/SpecificPrice.php:576
1963
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 5056 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.646 ms 10 Yes /classes/SpecificPrice.php:576
406
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4266 LIMIT 1
1.643 ms 10 /classes/SpecificPrice.php:435
1821
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 5043)
1.642 ms 1 /classes/Product.php:3860
584
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4329 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.637 ms 10 Yes /classes/SpecificPrice.php:576
4105
SELECT SQL_NO_CACHE c.*, cl.*
FROM `hgt78_category` c
INNER JOIN hgt78_category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1)
LEFT JOIN `hgt78_category_lang` cl ON c.`id_category` = cl.`id_category` AND cl.id_shop = 1 
LEFT JOIN `hgt78_category_group` cg ON c.`id_category` = cg.`id_category`
RIGHT JOIN `hgt78_category` c2 ON c2.`id_category` = 39 AND c.`nleft` >= c2.`nleft` AND c.`nright` <= c2.`nright`
WHERE 1  AND `id_lang` = 1
AND c.`active` = 1
AND cg.`id_group` IN (1)
GROUP BY c.`id_category`
ORDER BY c.`level_depth` ASC
, category_shop.`position` ASC
1.635 ms 73 Yes Yes /classes/Category.php:799
3398
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2517
ORDER BY `position`
1.634 ms 1 Yes /classes/Product.php:3545
3034
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 10852 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.631 ms 12 Yes /classes/SpecificPrice.php:576
2916
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 9107
ORDER BY f.position ASC
1.625 ms 5 Yes /classes/Product.php:6021
2474
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 9059
ORDER BY f.position ASC
1.621 ms 5 Yes /classes/Product.php:6021
2165
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 6044 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.618 ms 10 Yes /classes/SpecificPrice.php:576
2932
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 9144 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.617 ms 14 Yes /classes/SpecificPrice.php:576
2099
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 5331 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.614 ms 10 Yes /classes/SpecificPrice.php:576
823
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
1.609 ms 1 /classes/Product.php:5659
1327
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2430) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
1.605 ms 1 /classes/stock/StockAvailable.php:453
2822
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 9099 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.599 ms 10 Yes /classes/SpecificPrice.php:576
3006
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 10467
ORDER BY f.position ASC
1.587 ms 5 Yes /classes/Product.php:6021
2951
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 9266
AND image_shop.`cover` = 1 LIMIT 1
1.586 ms 1 /classes/Product.php:3570
325
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4276 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4276 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.581 ms 0 /classes/Cart.php:1430
3941
SELECT SQL_NO_CACHE hs.`id_tab` as id_tab, hssl.`title`, hssl.`label`, hssl.`url`,
hss.`position`,  hss.`active_label`, hss.`url_type`, hss.`id_url`, hss.`icon_type`, hss.`icon_class`, hss.`icon`, hss.`legend_icon`,
hss.`new_window`, hss.`float`, hss.`submenu_type`, hss.`submenu_content`, hss.`submenu_width`, hss.`group_access`
FROM hgt78_iqitmegamenu_tabs_shop hs
LEFT JOIN hgt78_iqitmegamenu_tabs hss ON (hs.id_tab = hss.id_tab)
LEFT JOIN hgt78_iqitmegamenu_tabs_lang hssl ON (hss.id_tab = hssl.id_tab)
WHERE id_shop = 1 AND menu_type = 1 AND active = 1
AND hssl.id_lang = 1
ORDER BY hss.position
1.573 ms 12 Yes /modules/iqitmegamenu/models/IqitMenuTab.php:178
1924
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 5052 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 5052 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.570 ms 0 /classes/Cart.php:1430
784
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2550 AND id_shop=1 LIMIT 1
1.569 ms 1 /classes/Product.php:6876
4008
SELECT SQL_NO_CACHE c.*, cl.*
FROM `hgt78_category` c
INNER JOIN hgt78_category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1)
LEFT JOIN `hgt78_category_lang` cl ON c.`id_category` = cl.`id_category` AND cl.id_shop = 1 
LEFT JOIN `hgt78_category_group` cg ON c.`id_category` = cg.`id_category`
RIGHT JOIN `hgt78_category` c2 ON c2.`id_category` = 44 AND c.`nleft` >= c2.`nleft` AND c.`nright` <= c2.`nright`
WHERE 1  AND `id_lang` = 1
AND c.`active` = 1
AND cg.`id_group` IN (1)
GROUP BY c.`id_category`
ORDER BY c.`level_depth` ASC
, category_shop.`position` ASC
1.567 ms 24 Yes Yes /classes/Category.php:799
3256
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2543) AND (b.`id_shop` = 1) LIMIT 1
1.560 ms 1 /src/Adapter/EntityMapper.php:71
3205
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4318) AND (b.`id_shop` = 1) LIMIT 1
1.557 ms 1 /src/Adapter/EntityMapper.php:71
677
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2536 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2536 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.546 ms 0 /classes/Cart.php:1430
40
SELECT SQL_NO_CACHE c.*, cl.`id_lang`, cl.`name`, cl.`description`, cl.`additional_description`, cl.`link_rewrite`, cl.`meta_title`, cl.`meta_keywords`, cl.`meta_description`
FROM `hgt78_category` c
INNER JOIN hgt78_category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1)
LEFT JOIN `hgt78_category_lang` cl ON (c.`id_category` = cl.`id_category` AND `id_lang` = 1  AND cl.id_shop = 1 )
LEFT JOIN `hgt78_category_group` cg ON (cg.`id_category` = c.`id_category`)
WHERE `id_parent` = 2
AND `active` = 1
AND cg.`id_group` =1
GROUP BY c.`id_category`
ORDER BY `level_depth` ASC, category_shop.`position` ASC
1.539 ms 31 Yes Yes /classes/Category.php:924
2473
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 9059 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 9059 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.537 ms 0 /classes/Cart.php:1430
1892
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 5049
ORDER BY f.position ASC
1.537 ms 5 Yes /classes/Product.php:6021
3925
SELECT SQL_NO_CACHE COUNT(DISTINCT c.id_currency) FROM `hgt78_currency` c
LEFT JOIN hgt78_currency_shop cs ON (cs.id_currency = c.id_currency AND cs.id_shop = 1)
WHERE c.`active` = 1 AND c.`deleted` = 0 LIMIT 1
1.533 ms 2 /classes/Currency.php:1136
518
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2528 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.533 ms 10 Yes /classes/SpecificPrice.php:576
672
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2536 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.529 ms 10 Yes /classes/SpecificPrice.php:576
2468
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 9059 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.526 ms 18 Yes /classes/SpecificPrice.php:576
727
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2545 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.523 ms 10 Yes /classes/SpecificPrice.php:576
3921
SELECT SQL_NO_CACHE * FROM `hgt78_cart_rule` cr
LEFT JOIN `hgt78_cart_rule_lang` crl 
ON (cr.`id_cart_rule` = crl.`id_cart_rule` AND crl.`id_lang` = 0) WHERE (cr.`id_customer` = 0) AND NOW() BETWEEN cr.date_from AND cr.date_to
AND cr.`active` = 1
AND cr.`quantity` > 0 AND highlight = 1 AND code NOT LIKE "BO_ORDER_%"
1.523 ms 1 /classes/CartRule.php:423
492
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2547
AND image_shop.`cover` = 1 LIMIT 1
1.521 ms 1 /classes/Product.php:3570
2685
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 9084
ORDER BY f.position ASC
1.510 ms 5 Yes /classes/Product.php:6021
496
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2547 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.509 ms 10 Yes /classes/SpecificPrice.php:576
458
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4271
ORDER BY f.position ASC
1.508 ms 5 Yes /classes/Product.php:6021
686
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2537 AND `id_group` = 1 LIMIT 1
1.508 ms 0 /classes/GroupReduction.php:156
1986
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 5058)
1.506 ms 1 /classes/Product.php:3860
628
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4324 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.503 ms 10 Yes /classes/SpecificPrice.php:576
2529
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 9068) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
1.498 ms 1 /classes/stock/StockAvailable.php:453
711
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2542
ORDER BY f.position ASC
1.494 ms 5 Yes /classes/Product.php:6021
898
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4216
ORDER BY f.position ASC
1.492 ms 5 Yes /classes/Product.php:6021
1997
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 5059)
1.491 ms 1 /classes/Product.php:3860
1946
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 5054 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 5054 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.490 ms 0 /classes/Cart.php:1430
2910
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 9107 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.490 ms 14 Yes /classes/SpecificPrice.php:576
732
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2545 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2545 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.489 ms 0 /classes/Cart.php:1430
1891
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 5049 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 5049 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.486 ms 0 /classes/Cart.php:1430
699
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2543 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2543 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.483 ms 0 /classes/Cart.php:1430
1859
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 5046
ORDER BY f.position ASC
1.479 ms 5 Yes /classes/Product.php:6021
782
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2550 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.477 ms 10 Yes /classes/SpecificPrice.php:576
886
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2941 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2941 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.473 ms 0 /classes/Cart.php:1430
1864
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 5047 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.473 ms 10 Yes /classes/SpecificPrice.php:576
2446
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 9057 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.471 ms 10 Yes /classes/SpecificPrice.php:576
16
SELECT SQL_NO_CACHE `id_hook`, `name` FROM `hgt78_hook`
1.465 ms 1185 /classes/Hook.php:1348
1937
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 5054
AND image_shop.`cover` = 1 LIMIT 1
1.463 ms 2 /classes/Product.php:3570
469
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4270
ORDER BY f.position ASC
1.462 ms 5 Yes /classes/Product.php:6021
3835
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 9099) AND (b.`id_shop` = 1) LIMIT 1
1.461 ms 1 /src/Adapter/EntityMapper.php:71
369
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4260 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4260 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.459 ms 0 /classes/Cart.php:1430
355
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4262 AND id_shop=1 LIMIT 1
1.458 ms 1 /classes/Product.php:6876
3403
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2474) AND (b.`id_shop` = 1) LIMIT 1
1.457 ms 1 /src/Adapter/EntityMapper.php:71
750
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4281)
1.454 ms 1 /classes/Product.php:3860
2564
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 9071
ORDER BY f.position ASC
1.451 ms 5 Yes /classes/Product.php:6021
3207
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4318
1.451 ms 1 /classes/Product.php:2902
3933
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 2) AND (b.`id_shop` = 1) LIMIT 1
1.451 ms 1 /src/Adapter/EntityMapper.php:71
397
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4212 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.446 ms 10 Yes /classes/SpecificPrice.php:576
639
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4323 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.445 ms 10 Yes /classes/SpecificPrice.php:576
1870
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 5047
ORDER BY f.position ASC
1.434 ms 5 Yes /classes/Product.php:6021
2778
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 9095 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.434 ms 17 Yes /classes/SpecificPrice.php:576
2573
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 9072) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
1.430 ms 1 /classes/stock/StockAvailable.php:453
4004
SELECT SQL_NO_CACHE c.*, cl.*
FROM `hgt78_category` c
INNER JOIN hgt78_category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1)
LEFT JOIN `hgt78_category_lang` cl ON c.`id_category` = cl.`id_category` AND cl.id_shop = 1 
LEFT JOIN `hgt78_category_group` cg ON c.`id_category` = cg.`id_category`
RIGHT JOIN `hgt78_category` c2 ON c2.`id_category` = 35 AND c.`nleft` >= c2.`nleft` AND c.`nright` <= c2.`nright`
WHERE 1  AND `id_lang` = 1
AND c.`active` = 1
AND cg.`id_group` IN (1)
GROUP BY c.`id_category`
ORDER BY c.`level_depth` ASC
, category_shop.`position` ASC
1.430 ms 27 Yes Yes /classes/Category.php:799
573
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2534 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.427 ms 10 Yes /classes/SpecificPrice.php:576
892
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4216 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.413 ms 10 Yes /classes/SpecificPrice.php:576
2816
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 9098 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 9098 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.409 ms 0 /classes/Cart.php:1430
365
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4260)
1.396 ms 1 /classes/Product.php:3860
2017
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 5081
ORDER BY `id_specific_price_priority` DESC LIMIT 1
1.393 ms 0 /classes/SpecificPrice.php:259
792
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2552
ORDER BY `id_specific_price_priority` DESC LIMIT 1
1.389 ms 0 /classes/SpecificPrice.php:259
1883
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
1.387 ms 1 /classes/Product.php:5659
2886
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 9105 LIMIT 1
1.378 ms 10 /classes/SpecificPrice.php:435
2833
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 9100 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.370 ms 16 Yes /classes/SpecificPrice.php:576
3550
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 5038) AND (b.`id_shop` = 1) LIMIT 1
1.368 ms 1 /src/Adapter/EntityMapper.php:71
479
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4269 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4269 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.366 ms 0 /classes/Cart.php:1430
474
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4269 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.364 ms 10 Yes /classes/SpecificPrice.php:576
749
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4281 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.363 ms 10 Yes /classes/SpecificPrice.php:576
2899
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 9106 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.358 ms 11 Yes /classes/SpecificPrice.php:576
3827
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 9096
ORDER BY `position`
1.358 ms 1 Yes /classes/Product.php:3545
2630
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 9077
ORDER BY f.position ASC
1.357 ms 5 Yes /classes/Product.php:6021
1957
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 5055 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 5055 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.352 ms 0 /classes/Cart.php:1430
3044
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 10853
ORDER BY `id_specific_price_priority` DESC LIMIT 1
1.347 ms 1 /classes/SpecificPrice.php:259
2439
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 8986) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
1.346 ms 1 /classes/stock/StockAvailable.php:453
2205
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 6154
AND image_shop.`cover` = 1 LIMIT 1
1.345 ms 1 /classes/Product.php:3570
3250
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2536) AND (b.`id_shop` = 1) LIMIT 1
1.342 ms 1 /src/Adapter/EntityMapper.php:71
419
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4275 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.341 ms 10 Yes /classes/SpecificPrice.php:576
1801
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 5041 AND `id_group` = 1 LIMIT 1
1.340 ms 0 /classes/GroupReduction.php:156
1985
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 5058 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.332 ms 10 Yes /classes/SpecificPrice.php:576
2080
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 5308 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 5308 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.329 ms 0 /classes/Cart.php:1430
517
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2528
ORDER BY `id_specific_price_priority` DESC LIMIT 1
1.328 ms 0 /classes/SpecificPrice.php:259
356
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4262 AND `id_group` = 1 LIMIT 1
1.321 ms 0 /classes/GroupReduction.php:156
3979
SELECT SQL_NO_CACHE c.*, cl.*
FROM `hgt78_category` c
INNER JOIN hgt78_category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1)
LEFT JOIN `hgt78_category_lang` cl ON c.`id_category` = cl.`id_category` AND cl.id_shop = 1 
LEFT JOIN `hgt78_category_group` cg ON c.`id_category` = cg.`id_category`
RIGHT JOIN `hgt78_category` c2 ON c2.`id_category` = 344 AND c.`nleft` >= c2.`nleft` AND c.`nright` <= c2.`nright`
WHERE 1  AND `id_lang` = 1
AND c.`active` = 1
AND cg.`id_group` IN (1)
GROUP BY c.`id_category`
ORDER BY c.`level_depth` ASC
, category_shop.`position` ASC
1.320 ms 15 Yes Yes /classes/Category.php:799
831
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2540 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2540 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.319 ms 0 /classes/Cart.php:1430
2819
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 228 LIMIT 1
1.319 ms 1 /classes/Product.php:5659
656
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4322
ORDER BY f.position ASC
1.318 ms 5 Yes /classes/Product.php:6021
2591
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 9074 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.317 ms 10 Yes /classes/SpecificPrice.php:576
1902
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 5050 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 5050 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.315 ms 0 /classes/Cart.php:1430
3440
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4044
ORDER BY `position`
1.311 ms 1 Yes /classes/Product.php:3545
1835
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 5044) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
1.310 ms 1 /classes/stock/StockAvailable.php:453
485
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4267 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.309 ms 10 Yes /classes/SpecificPrice.php:576
2008
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 5078)
1.308 ms 1 /classes/Product.php:3860
601
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4328
ORDER BY f.position ASC
1.307 ms 5 Yes /classes/Product.php:6021
2471
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 9059 AND `id_group` = 1 LIMIT 1
1.306 ms 0 /classes/GroupReduction.php:156
1974
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 5057 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.304 ms 10 Yes /classes/SpecificPrice.php:576
1969
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 5056
ORDER BY f.position ASC
1.303 ms 5 Yes /classes/Product.php:6021
3929
SELECT SQL_NO_CACHE `id_module` FROM `hgt78_module_shop` WHERE `id_module` = 17 AND `id_shop` = 1 LIMIT 1
1.294 ms 1 /classes/module/Module.php:2137
3992
SELECT SQL_NO_CACHE c.*, cl.*
FROM `hgt78_category` c
INNER JOIN hgt78_category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1)
LEFT JOIN `hgt78_category_lang` cl ON c.`id_category` = cl.`id_category` AND cl.id_shop = 1 
LEFT JOIN `hgt78_category_group` cg ON c.`id_category` = cg.`id_category`
RIGHT JOIN `hgt78_category` c2 ON c2.`id_category` = 70 AND c.`nleft` >= c2.`nleft` AND c.`nright` <= c2.`nright`
WHERE 1  AND `id_lang` = 1
AND c.`active` = 1
AND cg.`id_group` IN (1)
GROUP BY c.`id_category`
ORDER BY c.`level_depth` ASC
, category_shop.`position` ASC
1.293 ms 11 Yes Yes /classes/Category.php:799
611
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2493 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2493 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.292 ms 0 /classes/Cart.php:1430
483
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4267 LIMIT 1
1.290 ms 10 /classes/SpecificPrice.php:435
689
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2537
ORDER BY f.position ASC
1.290 ms 5 Yes /classes/Product.php:6021
155
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4224 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.289 ms 10 Yes /classes/SpecificPrice.php:576
3046
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 10853)
1.288 ms 1 /classes/Product.php:3860
3211
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2529) AND (b.`id_shop` = 1) LIMIT 1
1.288 ms 1 /src/Adapter/EntityMapper.php:71
3652
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 5472) AND (b.`id_shop` = 1) LIMIT 1
1.286 ms 1 /src/Adapter/EntityMapper.php:71
1991
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 5058
ORDER BY f.position ASC
1.281 ms 5 Yes /classes/Product.php:6021
1875
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 5048 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.278 ms 10 Yes /classes/SpecificPrice.php:576
759
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2548
ORDER BY `id_specific_price_priority` DESC LIMIT 1
1.278 ms 0 /classes/SpecificPrice.php:259
1935
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 5053 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 5053 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.275 ms 0 /classes/Cart.php:1430
810
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2538
ORDER BY f.position ASC
1.273 ms 5 Yes /classes/Product.php:6021
1952
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 5055 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.273 ms 10 Yes /classes/SpecificPrice.php:576
3213
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2529
1.271 ms 1 /classes/Product.php:2902
2558
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 9071 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.270 ms 17 Yes /classes/SpecificPrice.php:576
2631
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 9078
AND image_shop.`cover` = 1 LIMIT 1
1.269 ms 1 /classes/Product.php:3570
437
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4274
AND image_shop.`cover` = 1 LIMIT 1
1.268 ms 1 /classes/Product.php:3570
634
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4324
ORDER BY f.position ASC
1.268 ms 5 Yes /classes/Product.php:6021
2921
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 9108 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.265 ms 10 Yes /classes/SpecificPrice.php:576
2945
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 9262)
1.265 ms 1 /classes/Product.php:3860
435
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3183 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3183 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.262 ms 0 /classes/Cart.php:1430
525
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2529
AND image_shop.`cover` = 1 LIMIT 1
1.261 ms 1 /classes/Product.php:3570
1813
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 5042) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
1.260 ms 1 /classes/stock/StockAvailable.php:453
2176
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 6151 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.256 ms 11 Yes /classes/SpecificPrice.php:576
524
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2528
ORDER BY f.position ASC
1.254 ms 5 Yes /classes/Product.php:6021
2472
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 9059) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
1.253 ms 1 /classes/stock/StockAvailable.php:453
2834
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 9100)
1.252 ms 1 /classes/Product.php:3860
2021
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 5081 AND `id_group` = 1 LIMIT 1
1.251 ms 0 /classes/GroupReduction.php:156
2690
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 9085 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.248 ms 10 Yes /classes/SpecificPrice.php:576
1920
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 5052)
1.247 ms 1 /classes/Product.php:3860
1882
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 5049
AND image_shop.`cover` = 1 LIMIT 1
1.245 ms 2 /classes/Product.php:3570
2713
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 9089)
1.239 ms 1 /classes/Product.php:3860
633
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4324 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4324 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.238 ms 0 /classes/Cart.php:1430
2235
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 6156) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
1.238 ms 1 /classes/stock/StockAvailable.php:453
815
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2539 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.234 ms 10 Yes /classes/SpecificPrice.php:576
376
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4259)
1.233 ms 1 /classes/Product.php:3860
765
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2548 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2548 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.233 ms 0 /classes/Cart.php:1430
3214
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2531) AND (b.`id_shop` = 1) LIMIT 1
1.231 ms 1 /src/Adapter/EntityMapper.php:71
866
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4218
AND image_shop.`cover` = 1 LIMIT 1
1.230 ms 1 /classes/Product.php:3570
2238
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 6157
AND image_shop.`cover` = 1 LIMIT 1
1.230 ms 1 /classes/Product.php:3570
4341
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (9077) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.229 ms 1 Yes Yes /classes/Product.php:4524
1941
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 5054 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.226 ms 10 Yes /classes/SpecificPrice.php:576
1665
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4572 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.226 ms 10 Yes /classes/SpecificPrice.php:576
441
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4274 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.223 ms 10 Yes /classes/SpecificPrice.php:576
645
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4323
ORDER BY f.position ASC
1.222 ms 5 Yes /classes/Product.php:6021
2482
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 9061 AND `id_group` = 1 LIMIT 1
1.218 ms 0 /classes/GroupReduction.php:156
4075
SELECT SQL_NO_CACHE c.*, cl.*
FROM `hgt78_category` c
INNER JOIN hgt78_category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1)
LEFT JOIN `hgt78_category_lang` cl ON c.`id_category` = cl.`id_category` AND cl.id_shop = 1 
LEFT JOIN `hgt78_category_group` cg ON c.`id_category` = cg.`id_category`
RIGHT JOIN `hgt78_category` c2 ON c2.`id_category` = 33 AND c.`nleft` >= c2.`nleft` AND c.`nright` <= c2.`nright`
WHERE 1  AND `id_lang` = 1
AND c.`active` = 1
AND cg.`id_group` IN (1)
GROUP BY c.`id_category`
ORDER BY c.`level_depth` ASC
, category_shop.`position` ASC
1.212 ms 7 Yes Yes /classes/Category.php:799
348
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4263
ORDER BY f.position ASC
1.211 ms 5 Yes /classes/Product.php:6021
1421
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4062
ORDER BY `id_specific_price_priority` DESC LIMIT 1
1.208 ms 0 /classes/SpecificPrice.php:259
2018
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 5081 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.203 ms 10 Yes /classes/SpecificPrice.php:576
4001
SELECT SQL_NO_CACHE c.*, cl.*
FROM `hgt78_category` c
INNER JOIN hgt78_category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1)
LEFT JOIN `hgt78_category_lang` cl ON c.`id_category` = cl.`id_category` AND cl.id_shop = 1 
LEFT JOIN `hgt78_category_group` cg ON c.`id_category` = cg.`id_category`
RIGHT JOIN `hgt78_category` c2 ON c2.`id_category` = 200 AND c.`nleft` >= c2.`nleft` AND c.`nright` <= c2.`nright`
WHERE 1  AND `id_lang` = 1
AND c.`active` = 1
AND cg.`id_group` IN (1)
GROUP BY c.`id_category`
ORDER BY c.`level_depth` ASC
, category_shop.`position` ASC
1.202 ms 14 Yes Yes /classes/Category.php:799
130
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 12682) AND (b.`id_shop` = 1) LIMIT 1
1.200 ms 1 /src/Adapter/EntityMapper.php:71
1805
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 5042
AND image_shop.`cover` = 1 LIMIT 1
1.200 ms 2 /classes/Product.php:3570
2742
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 228 LIMIT 1
1.198 ms 1 /classes/Product.php:5659
722
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2541
ORDER BY f.position ASC
1.197 ms 5 Yes /classes/Product.php:6021
786
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2550) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
1.197 ms 1 /classes/stock/StockAvailable.php:453
2901
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 9106 AND id_shop=1 LIMIT 1
1.194 ms 1 /classes/Product.php:6876
2214
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 6154 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 6154 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.192 ms 0 /classes/Cart.php:1430
534
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2529 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2529 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.192 ms 0 /classes/Cart.php:1430
2839
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 9100
ORDER BY f.position ASC
1.192 ms 5 Yes /classes/Product.php:6021
3838
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 9100) AND (b.`id_shop` = 1) LIMIT 1
1.192 ms 1 /src/Adapter/EntityMapper.php:71
3241
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4323) AND (b.`id_shop` = 1) LIMIT 1
1.191 ms 1 /src/Adapter/EntityMapper.php:71
2807
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 9098
AND image_shop.`cover` = 1 LIMIT 1
1.187 ms 1 /classes/Product.php:3570
2110
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 5332 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.184 ms 10 Yes /classes/SpecificPrice.php:576
2218
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 6155 LIMIT 1
1.184 ms 11 /classes/SpecificPrice.php:435
579
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2534
ORDER BY f.position ASC
1.183 ms 5 Yes /classes/Product.php:6021
3940
SELECT SQL_NO_CACHE `width`, `height`
FROM hgt78_image_type
WHERE `name` = 'small_default' LIMIT 1
1.181 ms 1 /classes/Image.php:563
3995
SELECT SQL_NO_CACHE c.*, cl.*
FROM `hgt78_category` c
INNER JOIN hgt78_category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1)
LEFT JOIN `hgt78_category_lang` cl ON c.`id_category` = cl.`id_category` AND cl.id_shop = 1 
LEFT JOIN `hgt78_category_group` cg ON c.`id_category` = cg.`id_category`
RIGHT JOIN `hgt78_category` c2 ON c2.`id_category` = 78 AND c.`nleft` >= c2.`nleft` AND c.`nright` <= c2.`nright`
WHERE 1  AND `id_lang` = 1
AND c.`active` = 1
AND cg.`id_group` IN (1)
GROUP BY c.`id_category`
ORDER BY c.`level_depth` ASC
, category_shop.`position` ASC
1.180 ms 12 Yes Yes /classes/Category.php:799
859
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3553 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.179 ms 10 Yes /classes/SpecificPrice.php:576
2151
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
1.177 ms 1 /classes/Product.php:5659
607
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2493)
1.176 ms 1 /classes/Product.php:3860
3216
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2531
1.176 ms 1 /classes/Product.php:2902
3542
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5033
ORDER BY `position`
1.173 ms 2 Yes /classes/Product.php:3545
3985
SELECT SQL_NO_CACHE c.*, cl.*
FROM `hgt78_category` c
INNER JOIN hgt78_category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1)
LEFT JOIN `hgt78_category_lang` cl ON c.`id_category` = cl.`id_category` AND cl.id_shop = 1 
LEFT JOIN `hgt78_category_group` cg ON c.`id_category` = cg.`id_category`
RIGHT JOIN `hgt78_category` c2 ON c2.`id_category` = 46 AND c.`nleft` >= c2.`nleft` AND c.`nright` <= c2.`nright`
WHERE 1  AND `id_lang` = 1
AND c.`active` = 1
AND cg.`id_group` IN (1)
GROUP BY c.`id_category`
ORDER BY c.`level_depth` ASC
, category_shop.`position` ASC
1.170 ms 9 Yes Yes /classes/Category.php:799
618
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4327)
1.169 ms 1 /classes/Product.php:3860
2593
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 9074 AND id_shop=1 LIMIT 1
1.169 ms 1 /classes/Product.php:6876
489
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4267) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
1.167 ms 1 /classes/stock/StockAvailable.php:453
3982
SELECT SQL_NO_CACHE c.*, cl.*
FROM `hgt78_category` c
INNER JOIN hgt78_category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1)
LEFT JOIN `hgt78_category_lang` cl ON c.`id_category` = cl.`id_category` AND cl.id_shop = 1 
LEFT JOIN `hgt78_category_group` cg ON c.`id_category` = cg.`id_category`
RIGHT JOIN `hgt78_category` c2 ON c2.`id_category` = 45 AND c.`nleft` >= c2.`nleft` AND c.`nright` <= c2.`nright`
WHERE 1  AND `id_lang` = 1
AND c.`active` = 1
AND cg.`id_group` IN (1)
GROUP BY c.`id_category`
ORDER BY c.`level_depth` ASC
, category_shop.`position` ASC
1.166 ms 8 Yes Yes /classes/Category.php:799
137
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 12682) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
1.165 ms 1 /classes/stock/StockAvailable.php:453
2137
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 5470 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 5470 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.165 ms 0 /classes/Cart.php:1430
2172
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 6151
AND image_shop.`cover` = 1 LIMIT 1
1.164 ms 1 /classes/Product.php:3570
504
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
1.163 ms 1 /classes/Product.php:5659
2892
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 9105) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
1.162 ms 1 /classes/stock/StockAvailable.php:453
640
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4323)
1.159 ms 1 /classes/Product.php:3860
1964
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 5056)
1.158 ms 1 /classes/Product.php:3860
3919
SELECT SQL_NO_CACHE * FROM `hgt78_cart_rule` cr
LEFT JOIN `hgt78_cart_rule_lang` crl 
ON (cr.`id_cart_rule` = crl.`id_cart_rule` AND crl.`id_lang` = 1) WHERE (cr.`id_customer` = 0) AND NOW() BETWEEN cr.date_from AND cr.date_to
AND cr.`active` = 1
AND free_shipping = 1 AND carrier_restriction = 1
1.158 ms 6 /classes/CartRule.php:423
2208
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 6154
ORDER BY `id_specific_price_priority` DESC LIMIT 1
1.155 ms 0 /classes/SpecificPrice.php:259
1950
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 5055 LIMIT 1
1.150 ms 10 /classes/SpecificPrice.php:435
1936
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 5053
ORDER BY f.position ASC
1.148 ms 5 Yes /classes/Product.php:6021
3839
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 9100
ORDER BY `position`
1.145 ms 1 Yes /classes/Product.php:3545
879
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2941 LIMIT 1
1.144 ms 10 /classes/SpecificPrice.php:435
426
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3183
AND image_shop.`cover` = 1 LIMIT 1
1.143 ms 1 /classes/Product.php:3570
2159
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 6043 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 6043 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.142 ms 0 /classes/Cart.php:1430
3998
SELECT SQL_NO_CACHE c.*, cl.*
FROM `hgt78_category` c
INNER JOIN hgt78_category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1)
LEFT JOIN `hgt78_category_lang` cl ON c.`id_category` = cl.`id_category` AND cl.id_shop = 1 
LEFT JOIN `hgt78_category_group` cg ON c.`id_category` = cg.`id_category`
RIGHT JOIN `hgt78_category` c2 ON c2.`id_category` = 199 AND c.`nleft` >= c2.`nleft` AND c.`nright` <= c2.`nright`
WHERE 1  AND `id_lang` = 1
AND c.`active` = 1
AND cg.`id_group` IN (1)
GROUP BY c.`id_category`
ORDER BY c.`level_depth` ASC
, category_shop.`position` ASC
1.141 ms 13 Yes Yes /classes/Category.php:799
2896
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 228 LIMIT 1
1.140 ms 1 /classes/Product.php:5659
2787
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 9096 LIMIT 1
1.138 ms 18 /classes/SpecificPrice.php:435
2827
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 9099 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 9099 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.135 ms 0 /classes/Cart.php:1430
3988
SELECT SQL_NO_CACHE c.*, cl.*
FROM `hgt78_category` c
INNER JOIN hgt78_category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1)
LEFT JOIN `hgt78_category_lang` cl ON c.`id_category` = cl.`id_category` AND cl.id_shop = 1 
LEFT JOIN `hgt78_category_group` cg ON c.`id_category` = cg.`id_category`
RIGHT JOIN `hgt78_category` c2 ON c2.`id_category` = 54 AND c.`nleft` >= c2.`nleft` AND c.`nright` <= c2.`nright`
WHERE 1  AND `id_lang` = 1
AND c.`active` = 1
AND cg.`id_group` IN (1)
GROUP BY c.`id_category`
ORDER BY c.`level_depth` ASC
, category_shop.`position` ASC
1.132 ms 10 Yes Yes /classes/Category.php:799
2905
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 9106
ORDER BY f.position ASC
1.128 ms 5 Yes /classes/Product.php:6021
1980
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 5057
ORDER BY f.position ASC
1.127 ms 5 Yes /classes/Product.php:6021
617
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4327 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.126 ms 10 Yes /classes/SpecificPrice.php:576
2801
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 9097)
1.125 ms 1 /classes/Product.php:3860
3850
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 9104) AND (b.`id_shop` = 1) LIMIT 1
1.124 ms 1 /src/Adapter/EntityMapper.php:71
2585
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 9073 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 9073 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.122 ms 0 /classes/Cart.php:1430
2012
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 5078 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 5078 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.121 ms 0 /classes/Cart.php:1430
495
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2547
ORDER BY `id_specific_price_priority` DESC LIMIT 1
1.120 ms 0 /classes/SpecificPrice.php:259
1880
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 5048 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 5048 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.114 ms 0 /classes/Cart.php:1430
4364
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (9104) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.107 ms 1 Yes Yes /classes/Product.php:4524
770
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2549
ORDER BY `id_specific_price_priority` DESC LIMIT 1
1.104 ms 0 /classes/SpecificPrice.php:259
412
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4266) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
1.104 ms 1 /classes/stock/StockAvailable.php:453
800
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2538
AND image_shop.`cover` = 1 LIMIT 1
1.103 ms 1 /classes/Product.php:3570
2170
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 6044 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 6044 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.103 ms 0 /classes/Cart.php:1430
2985
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 10424
AND image_shop.`cover` = 1 LIMIT 1
1.101 ms 1 /classes/Product.php:3570
2596
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 9074 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 9074 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.099 ms 0 /classes/Cart.php:1430
1670
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4572 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4572 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.098 ms 0 /classes/Cart.php:1430
877
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2941
AND image_shop.`cover` = 1 LIMIT 1
1.097 ms 1 /classes/Product.php:3570
2221
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 6155)
1.097 ms 1 /classes/Product.php:3860
2877
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 9104 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.097 ms 10 Yes /classes/SpecificPrice.php:576
418
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4275
ORDER BY `id_specific_price_priority` DESC LIMIT 1
1.095 ms 0 /classes/SpecificPrice.php:259
2209
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 6154 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.094 ms 11 Yes /classes/SpecificPrice.php:576
661
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4321 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.093 ms 10 Yes /classes/SpecificPrice.php:576
738
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2546 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.093 ms 10 Yes /classes/SpecificPrice.php:576
3978
SELECT SQL_NO_CACHE c.*, cl.*
FROM `hgt78_category` c
INNER JOIN hgt78_category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1)
LEFT JOIN `hgt78_category_lang` cl ON c.`id_category` = cl.`id_category` AND cl.id_shop = 1 
LEFT JOIN `hgt78_category_group` cg ON c.`id_category` = cg.`id_category`
RIGHT JOIN `hgt78_category` c2 ON c2.`id_category` = 41 AND c.`nleft` >= c2.`nleft` AND c.`nright` <= c2.`nright`
WHERE 1  AND `id_lang` = 1
AND c.`active` = 1
AND cg.`id_group` IN (1)
GROUP BY c.`id_category`
ORDER BY c.`level_depth` ASC
, category_shop.`position` ASC
1.093 ms 7 Yes Yes /classes/Category.php:799
3824
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 9095
ORDER BY `position`
1.092 ms 1 Yes /classes/Product.php:3545
721
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2541 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2541 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.085 ms 0 /classes/Cart.php:1430
2087
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 5322 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.083 ms 11 Yes /classes/SpecificPrice.php:576
2559
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 9071)
1.083 ms 1 /classes/Product.php:3860
536
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2531
AND image_shop.`cover` = 1 LIMIT 1
1.082 ms 1 /classes/Product.php:3570
302
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4278) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
1.080 ms 1 /classes/stock/StockAvailable.php:453
1654
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4227 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.080 ms 10 Yes /classes/SpecificPrice.php:576
507
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4318 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.078 ms 10 Yes /classes/SpecificPrice.php:576
556
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2532 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2532 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.078 ms 0 /classes/Cart.php:1430
247
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2554) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
1.077 ms 1 /classes/stock/StockAvailable.php:453
2800
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 9097 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.071 ms 18 Yes /classes/SpecificPrice.php:576
3218
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2532
ORDER BY `position`
1.071 ms 1 Yes /classes/Product.php:3545
3027
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 10576) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
1.066 ms 1 /classes/stock/StockAvailable.php:453
2752
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 9093
AND image_shop.`cover` = 1 LIMIT 1
1.065 ms 1 /classes/Product.php:3570
3257
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2543
ORDER BY `position`
1.063 ms 2 Yes /classes/Product.php:3545
1290
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2558 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.062 ms 10 Yes /classes/SpecificPrice.php:576
1312
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2801 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.062 ms 10 Yes /classes/SpecificPrice.php:576
2613
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 9076 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.056 ms 18 Yes /classes/SpecificPrice.php:576
1860
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 5047
AND image_shop.`cover` = 1 LIMIT 1
1.055 ms 2 /classes/Product.php:3570
3910
SELECT SQL_NO_CACHE `id_hook`, `name` FROM `hgt78_hook`
1.055 ms 1185 /classes/Hook.php:1348
513
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4318
ORDER BY f.position ASC
1.050 ms 5 Yes /classes/Product.php:6021
468
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4270 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4270 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.047 ms 0 /classes/Cart.php:1430
2569
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 9072 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.043 ms 13 Yes /classes/SpecificPrice.php:576
2679
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 9084 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.043 ms 14 Yes /classes/SpecificPrice.php:576
2127
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 5334
ORDER BY f.position ASC
1.043 ms 5 Yes /classes/Product.php:6021
3023
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 10576 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.041 ms 10 Yes /classes/SpecificPrice.php:576
2121
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 5334 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.040 ms 10 Yes /classes/SpecificPrice.php:576
2686
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 9085
AND image_shop.`cover` = 1 LIMIT 1
1.040 ms 1 /classes/Product.php:3570
2691
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 9085)
1.040 ms 1 /classes/Product.php:3860
3439
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4044) AND (b.`id_shop` = 1) LIMIT 1
1.039 ms 1 /src/Adapter/EntityMapper.php:71
958
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4112 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.038 ms 10 Yes /classes/SpecificPrice.php:576
1962
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 5056
ORDER BY `id_specific_price_priority` DESC LIMIT 1
1.038 ms 0 /classes/SpecificPrice.php:259
475
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4269)
1.037 ms 1 /classes/Product.php:3860
2203
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 6153 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 6153 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.037 ms 0 /classes/Cart.php:1430
3532
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4577) AND (b.`id_shop` = 1) LIMIT 1
1.036 ms 1 /src/Adapter/EntityMapper.php:71
359
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4262
ORDER BY f.position ASC
1.034 ms 5 Yes /classes/Product.php:6021
2057
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 5173 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 5173 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.034 ms 0 /classes/Cart.php:1430
676
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2536) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
1.031 ms 1 /classes/stock/StockAvailable.php:453
2022
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 5081) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
1.029 ms 1 /classes/stock/StockAvailable.php:453
705
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2542 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.028 ms 10 Yes /classes/SpecificPrice.php:576
3208
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2528) AND (b.`id_shop` = 1) LIMIT 1
1.027 ms 1 /src/Adapter/EntityMapper.php:71
309
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4277 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.025 ms 10 Yes /classes/SpecificPrice.php:576
3991
SELECT SQL_NO_CACHE c.*, cl.*
FROM `hgt78_category` c
INNER JOIN hgt78_category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1)
LEFT JOIN `hgt78_category_lang` cl ON c.`id_category` = cl.`id_category` AND cl.id_shop = 1 
LEFT JOIN `hgt78_category_group` cg ON c.`id_category` = cg.`id_category`
RIGHT JOIN `hgt78_category` c2 ON c2.`id_category` = 64 AND c.`nleft` >= c2.`nleft` AND c.`nright` <= c2.`nright`
WHERE 1  AND `id_lang` = 1
AND c.`active` = 1
AND cg.`id_group` IN (1)
GROUP BY c.`id_category`
ORDER BY c.`level_depth` ASC
, category_shop.`position` ASC
1.024 ms 10 Yes Yes /classes/Category.php:799
593
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4328 LIMIT 1
1.023 ms 10 /classes/SpecificPrice.php:435
2216
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 6155
AND image_shop.`cover` = 1 LIMIT 1
1.021 ms 1 /classes/Product.php:3570
1588
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4206 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.020 ms 10 Yes /classes/SpecificPrice.php:576
2844
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 9101 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.020 ms 18 Yes /classes/SpecificPrice.php:576
540
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2531 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.017 ms 10 Yes /classes/SpecificPrice.php:576
2855
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 9102 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.017 ms 13 Yes /classes/SpecificPrice.php:576
1003
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4106 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.016 ms 10 Yes /classes/SpecificPrice.php:576
2020
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 5081 AND id_shop=1 LIMIT 1
1.015 ms 1 /classes/Product.php:6876
613
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4327
AND image_shop.`cover` = 1 LIMIT 1
1.011 ms 1 /classes/Product.php:3570
1014
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4116 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.011 ms 10 Yes /classes/SpecificPrice.php:576
694
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2543 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.009 ms 10 Yes /classes/SpecificPrice.php:576
2618
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 9076 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 9076 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.008 ms 0 /classes/Cart.php:1430
2805
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 9097 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 9097 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.007 ms 0 /classes/Cart.php:1430
820
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2539 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2539 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.007 ms 0 /classes/Cart.php:1430
1981
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 5058
AND image_shop.`cover` = 1 LIMIT 1
1.005 ms 2 /classes/Product.php:3570
2052
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 5173 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.005 ms 10 Yes /classes/SpecificPrice.php:576
650
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4322 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.003 ms 10 Yes /classes/SpecificPrice.php:576
655
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4322 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4322 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.003 ms 0 /classes/Cart.php:1430
457
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4271 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4271 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.000 ms 0 /classes/Cart.php:1430
1345
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4043 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.000 ms 10 Yes /classes/SpecificPrice.php:576
1876
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 5048)
0.999 ms 1 /classes/Product.php:3860
1884
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 5049 LIMIT 1
0.998 ms 10 /classes/SpecificPrice.php:435
2881
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 9104) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.998 ms 1 /classes/stock/StockAvailable.php:453
3030
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 10852
AND image_shop.`cover` = 1 LIMIT 1
0.998 ms 1 /classes/Product.php:3570
221
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4309 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.995 ms 10 Yes /classes/SpecificPrice.php:576
254
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4317 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.995 ms 10 Yes /classes/SpecificPrice.php:576
347
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4263 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4263 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.992 ms 0 /classes/Cart.php:1430
13
SELECT SQL_NO_CACHE lower(name) as name
FROM `hgt78_hook` h
WHERE (h.active = 1)
0.991 ms 1185 /classes/Hook.php:1388
1908
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 5051 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.989 ms 10 Yes /classes/SpecificPrice.php:576
2264
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 6159 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.988 ms 11 Yes /classes/SpecificPrice.php:576
2675
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 9084
AND image_shop.`cover` = 1 LIMIT 1
0.988 ms 1 /classes/Product.php:3570
809
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2538 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2538 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.987 ms 0 /classes/Cart.php:1430
3233
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2493
ORDER BY `position`
0.987 ms 1 Yes /classes/Product.php:3545
2007
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 5078 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.982 ms 10 Yes /classes/SpecificPrice.php:576
171
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4286 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4286 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.979 ms 0 /classes/Cart.php:1430
219
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4309 LIMIT 1
0.978 ms 10 /classes/SpecificPrice.php:435
2227
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 6156
AND image_shop.`cover` = 1 LIMIT 1
0.978 ms 1 /classes/Product.php:3570
2574
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 9072 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 9072 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.977 ms 0 /classes/Cart.php:1430
2866
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 9103 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.977 ms 17 Yes /classes/SpecificPrice.php:576
2900
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 9106)
0.977 ms 1 /classes/Product.php:3860
606
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2493 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.976 ms 10 Yes /classes/SpecificPrice.php:576
2076
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 5308)
0.976 ms 1 /classes/Product.php:3860
3373
SELECT SQL_NO_CACHE lower(name) as name
FROM `hgt78_hook` h
WHERE (h.active = 1)
0.975 ms 1185 /classes/Hook.php:1388
1947
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 5054
ORDER BY f.position ASC
0.974 ms 5 Yes /classes/Product.php:6021
2435
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 8986 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.974 ms 17 Yes /classes/SpecificPrice.php:576
2783
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 9095 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 9095 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.974 ms 0 /classes/Cart.php:1430
2923
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 9108 AND id_shop=1 LIMIT 1
0.974 ms 1 /classes/Product.php:6876
783
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2550)
0.973 ms 1 /classes/Product.php:3860
969
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4111 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.972 ms 10 Yes /classes/SpecificPrice.php:576
1213
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2516 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.972 ms 10 Yes /classes/SpecificPrice.php:576
2469
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 9059)
0.972 ms 1 /classes/Product.php:3860
2624
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 9077 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.972 ms 10 Yes /classes/SpecificPrice.php:576
2150
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 6043
AND image_shop.`cover` = 1 LIMIT 1
0.971 ms 1 /classes/Product.php:3570
331
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4264 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.971 ms 10 Yes /classes/SpecificPrice.php:576
571
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2534 LIMIT 1
0.970 ms 10 /classes/SpecificPrice.php:435
1301
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2916 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.970 ms 10 Yes /classes/SpecificPrice.php:576
2718
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 9089
ORDER BY f.position ASC
0.967 ms 5 Yes /classes/Product.php:6021
1929
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 5053
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.967 ms 0 /classes/SpecificPrice.php:259
2466
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 9059 LIMIT 1
0.966 ms 18 /classes/SpecificPrice.php:435
2040
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 5159 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.964 ms 10 Yes /classes/SpecificPrice.php:576
2772
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 9094 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 9094 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.963 ms 0 /classes/Cart.php:1430
188
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4282 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.962 ms 11 Yes /classes/SpecificPrice.php:576
2253
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 6158 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.962 ms 12 Yes /classes/SpecificPrice.php:576
430
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3183 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.962 ms 10 Yes /classes/SpecificPrice.php:576
1989
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 5058) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.960 ms 1 /classes/stock/StockAvailable.php:453
3922
SELECT SQL_NO_CACHE id_group FROM hgt78_cart_rule_group WHERE id_cart_rule = 0
0.960 ms 1 /classes/CartRule.php:438
2662
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 9081 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 9081 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.960 ms 0 /classes/Cart.php:1430
2023
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 5081 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 5081 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.957 ms 0 /classes/Cart.php:1430
3898
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 10891) AND (b.`id_shop` = 1) LIMIT 1
0.956 ms 1 /src/Adapter/EntityMapper.php:71
2586
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 9073
ORDER BY f.position ASC
0.956 ms 5 Yes /classes/Product.php:6021
2961
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 9266 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 9266 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.956 ms 0 /classes/Cart.php:1430
2681
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 9084 AND id_shop=1 LIMIT 1
0.955 ms 1 /classes/Product.php:6876
1971
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.954 ms 1 /classes/Product.php:5659
2575
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 9072
ORDER BY f.position ASC
0.954 ms 5 Yes /classes/Product.php:6021
3005
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 10467 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 10467 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.952 ms 0 /classes/Cart.php:1430
897
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4216 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4216 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.951 ms 0 /classes/Cart.php:1430
120
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2553 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.950 ms 10 Yes /classes/SpecificPrice.php:576
1610
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4303 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.950 ms 10 Yes /classes/SpecificPrice.php:576
501
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2547 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2547 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.949 ms 0 /classes/Cart.php:1430
1776
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 5039 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.949 ms 10 Yes /classes/SpecificPrice.php:576
3000
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 10467 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.949 ms 10 Yes /classes/SpecificPrice.php:576
338
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4263
AND image_shop.`cover` = 1 LIMIT 1
0.947 ms 1 /classes/Product.php:3570
2926
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 9108 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 9108 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.947 ms 0 /classes/Cart.php:1430
4368
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (9108) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.947 ms 1 Yes Yes /classes/Product.php:4524
545
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2531 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2531 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.945 ms 0 /classes/Cart.php:1430
1721
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4696 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.941 ms 10 Yes /classes/SpecificPrice.php:576
2956
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 9266 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.941 ms 10 Yes /classes/SpecificPrice.php:576
3011
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 10469 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.940 ms 10 Yes /classes/SpecificPrice.php:576
3232
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2493) AND (b.`id_shop` = 1) LIMIT 1
0.940 ms 1 /src/Adapter/EntityMapper.php:71
1765
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 5038 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.939 ms 10 Yes /classes/SpecificPrice.php:576
2242
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 6157 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.938 ms 11 Yes /classes/SpecificPrice.php:576
2231
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 6156 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.936 ms 11 Yes /classes/SpecificPrice.php:576
2536
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 9069 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.936 ms 18 Yes /classes/SpecificPrice.php:576
2893
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 9105 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 9105 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.936 ms 0 /classes/Cart.php:1430
2132
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 5470 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.935 ms 10 Yes /classes/SpecificPrice.php:576
317
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.934 ms 1 /classes/Product.php:5659
3904
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 10928) AND (b.`id_shop` = 1) LIMIT 1
0.934 ms 1 /src/Adapter/EntityMapper.php:71
3253
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2537) AND (b.`id_shop` = 1) LIMIT 1
0.934 ms 1 /src/Adapter/EntityMapper.php:71
2247
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 6157 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 6157 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.933 ms 0 /classes/Cart.php:1430
1577
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4196 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.932 ms 10 Yes /classes/SpecificPrice.php:576
2232
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 6156)
0.930 ms 1 /classes/Product.php:3860
380
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4259 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4259 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.929 ms 0 /classes/Cart.php:1430
360
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4260
AND image_shop.`cover` = 1 LIMIT 1
0.929 ms 1 /classes/Product.php:3570
789
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2552
AND image_shop.`cover` = 1 LIMIT 1
0.928 ms 1 /classes/Product.php:3570
804
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2538 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.928 ms 10 Yes /classes/SpecificPrice.php:576
842
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2544 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2544 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.927 ms 0 /classes/Cart.php:1430
2236
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 6156 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 6156 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.926 ms 0 /classes/Cart.php:1430
2299
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 6664 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.926 ms 10 Yes /classes/SpecificPrice.php:576
1096
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2608 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2608 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.925 ms 0 /classes/Cart.php:1430
2401
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 8978 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.925 ms 14 Yes /classes/SpecificPrice.php:576
276
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4314 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.924 ms 10 Yes /classes/SpecificPrice.php:576
3229
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4328) AND (b.`id_shop` = 1) LIMIT 1
0.924 ms 1 /src/Adapter/EntityMapper.php:71
1091
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2608 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.924 ms 10 Yes /classes/SpecificPrice.php:576
1356
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4044 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.923 ms 10 Yes /classes/SpecificPrice.php:576
644
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4323 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4323 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.921 ms 0 /classes/Cart.php:1430
1125
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4088 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.920 ms 10 Yes /classes/SpecificPrice.php:576
1423
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4062)
0.920 ms 1 /classes/Product.php:3860
903
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4214 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.919 ms 10 Yes /classes/SpecificPrice.php:576
1334
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3056 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.919 ms 10 Yes /classes/SpecificPrice.php:576
1732
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 5033 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.919 ms 10 Yes /classes/SpecificPrice.php:576
127
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 12682
AND image_shop.`cover` = 1 LIMIT 1
0.919 ms 2 /classes/Product.php:3570
174
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.918 ms 1 /classes/Product.php:5659
2838
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 9100 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 9100 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.918 ms 0 /classes/Cart.php:1430
2789
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 9096 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.918 ms 18 Yes /classes/SpecificPrice.php:576
287
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4313 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.917 ms 10 Yes /classes/SpecificPrice.php:576
2674
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 9082
ORDER BY f.position ASC
0.917 ms 5 Yes /classes/Product.php:6021
2722
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 9090
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.917 ms 0 /classes/SpecificPrice.php:259
490
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4267 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4267 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.915 ms 0 /classes/Cart.php:1430
1621
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4307 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.915 ms 10 Yes /classes/SpecificPrice.php:576
2745
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 9092 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.912 ms 18 Yes /classes/SpecificPrice.php:576
1853
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 5046 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.911 ms 15 Yes /classes/SpecificPrice.php:576
470
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4269
AND image_shop.`cover` = 1 LIMIT 1
0.910 ms 1 /classes/Product.php:3570
887
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2941
ORDER BY f.position ASC
0.910 ms 5 Yes /classes/Product.php:6021
3020
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 10576) AND (b.`id_shop` = 1) LIMIT 1
0.910 ms 1 /src/Adapter/EntityMapper.php:71
2275
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 6198 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.909 ms 10 Yes /classes/SpecificPrice.php:576
2440
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 8986 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 8986 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.909 ms 0 /classes/Cart.php:1430
2490
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 9062 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.909 ms 18 Yes /classes/SpecificPrice.php:576
1942
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 5054)
0.909 ms 1 /classes/Product.php:3860
754
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4281 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4281 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.908 ms 0 /classes/Cart.php:1430
1445
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4090 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.908 ms 10 Yes /classes/SpecificPrice.php:576
1246
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2525 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.907 ms 10 Yes /classes/SpecificPrice.php:576
2642
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 9079
AND image_shop.`cover` = 1 LIMIT 1
0.907 ms 1 /classes/Product.php:3570
353
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4262 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.906 ms 10 Yes /classes/SpecificPrice.php:576
925
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4213 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.906 ms 10 Yes /classes/SpecificPrice.php:576
144
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4225 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.905 ms 10 Yes /classes/SpecificPrice.php:576
149
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4225 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4225 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.905 ms 0 /classes/Cart.php:1430
232
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4310 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.905 ms 10 Yes /classes/SpecificPrice.php:576
2139
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 5472
AND image_shop.`cover` = 1 LIMIT 1
0.905 ms 1 /classes/Product.php:3570
914
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4210 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.904 ms 10 Yes /classes/SpecificPrice.php:576
2070
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 5308
AND image_shop.`cover` = 1 LIMIT 1
0.901 ms 1 /classes/Product.php:3570
578
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2534 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2534 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.900 ms 0 /classes/Cart.php:1430
2187
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 6152 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.900 ms 11 Yes /classes/SpecificPrice.php:576
4376
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (10469) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.899 ms 1 Yes Yes /classes/Product.php:4524
1566
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4195 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.898 ms 10 Yes /classes/SpecificPrice.php:576
652
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4322 AND id_shop=1 LIMIT 1
0.898 ms 1 /classes/Product.php:6876
1743
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 5036 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.897 ms 10 Yes /classes/SpecificPrice.php:576
1996
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 5059 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.897 ms 10 Yes /classes/SpecificPrice.php:576
2619
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 9076
ORDER BY f.position ASC
0.896 ms 5 Yes /classes/Product.php:6021
3057
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 10891 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.895 ms 12 Yes /classes/SpecificPrice.php:576
2723
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 9090 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.893 ms 13 Yes /classes/SpecificPrice.php:576
2894
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 9105
ORDER BY f.position ASC
0.893 ms 5 Yes /classes/Product.php:6021
2999
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 10467
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.893 ms 1 /classes/SpecificPrice.php:259
3251
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2536
ORDER BY `position`
0.893 ms 1 Yes /classes/Product.php:3545
664
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4321 AND `id_group` = 1 LIMIT 1
0.892 ms 0 /classes/GroupReduction.php:156
623
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4327
ORDER BY f.position ASC
0.892 ms 5 Yes /classes/Product.php:6021
2091
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 5322) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.892 ms 1 /classes/stock/StockAvailable.php:453
2811
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 9098 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.891 ms 18 Yes /classes/SpecificPrice.php:576
2810
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 9098
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.890 ms 0 /classes/SpecificPrice.php:259
670
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2536 LIMIT 1
0.886 ms 10 /classes/SpecificPrice.php:435
2106
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 5332
AND image_shop.`cover` = 1 LIMIT 1
0.886 ms 1 /classes/Product.php:3570
2344
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 7958 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.886 ms 10 Yes /classes/SpecificPrice.php:576
3038
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 10852) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.886 ms 1 /classes/stock/StockAvailable.php:453
1533
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4142 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.883 ms 10 Yes /classes/SpecificPrice.php:576
2915
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 9107 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 9107 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.883 ms 0 /classes/Cart.php:1430
2117
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 5334
AND image_shop.`cover` = 1 LIMIT 1
0.883 ms 1 /classes/Product.php:3570
2198
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 6153 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.883 ms 11 Yes /classes/SpecificPrice.php:576
637
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4323 LIMIT 1
0.882 ms 10 /classes/SpecificPrice.php:435
1158
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2522 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.882 ms 10 Yes /classes/SpecificPrice.php:576
2497
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 9063
AND image_shop.`cover` = 1 LIMIT 1
0.882 ms 1 /classes/Product.php:3570
362
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4260 LIMIT 1
0.881 ms 10 /classes/SpecificPrice.php:435
3014
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 10469 AND `id_group` = 1 LIMIT 1
0.881 ms 0 /classes/GroupReduction.php:156
836
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2544
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.880 ms 0 /classes/SpecificPrice.php:259
1389
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4048 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.879 ms 10 Yes /classes/SpecificPrice.php:576
177
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4285 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.878 ms 10 Yes /classes/SpecificPrice.php:576
2671
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 9082 AND `id_group` = 1 LIMIT 1
0.877 ms 0 /classes/GroupReduction.php:156
1411
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4061 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.876 ms 10 Yes /classes/SpecificPrice.php:576
1522
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4146 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.876 ms 10 Yes /classes/SpecificPrice.php:576
848
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3554 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.874 ms 10 Yes /classes/SpecificPrice.php:576
2287
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 6435 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.872 ms 10 Yes /classes/SpecificPrice.php:576
2751
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 9092
ORDER BY f.position ASC
0.871 ms 5 Yes /classes/Product.php:6021
1544
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4144 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.871 ms 10 Yes /classes/SpecificPrice.php:576
2734
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 9091 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.869 ms 18 Yes /classes/SpecificPrice.php:576
2978
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 10423 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.869 ms 10 Yes /classes/SpecificPrice.php:576
2310
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 7952 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.868 ms 10 Yes /classes/SpecificPrice.php:576
853
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3554 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3554 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.867 ms 0 /classes/Cart.php:1430
2806
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 9097
ORDER BY f.position ASC
0.867 ms 5 Yes /classes/Product.php:6021
1505
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4140 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4140 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.865 ms 0 /classes/Cart.php:1430
1978
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 5057) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.865 ms 1 /classes/stock/StockAvailable.php:453
1871
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 5048
AND image_shop.`cover` = 1 LIMIT 1
0.863 ms 2 /classes/Product.php:3570
2223
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 6155 AND `id_group` = 1 LIMIT 1
0.862 ms 0 /classes/GroupReduction.php:156
336
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4264 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4264 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.862 ms 0 /classes/Cart.php:1430
422
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4275 AND `id_group` = 1 LIMIT 1
0.861 ms 0 /classes/GroupReduction.php:156
1202
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2517 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.861 ms 10 Yes /classes/SpecificPrice.php:576
2149
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 5472
ORDER BY f.position ASC
0.861 ms 5 Yes /classes/Product.php:6021
2939
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 9262
AND image_shop.`cover` = 1 LIMIT 1
0.860 ms 1 /classes/Product.php:3570
870
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4218 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.859 ms 10 Yes /classes/SpecificPrice.php:576
3223
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2534) AND (b.`id_shop` = 1) LIMIT 1
0.857 ms 1 /src/Adapter/EntityMapper.php:71
199
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4280 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.856 ms 10 Yes /classes/SpecificPrice.php:576
2133
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 5470)
0.853 ms 1 /classes/Product.php:3860
3523
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4572) AND (b.`id_shop` = 1) LIMIT 1
0.853 ms 1 /src/Adapter/EntityMapper.php:71
2075
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 5308 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.852 ms 10 Yes /classes/SpecificPrice.php:576
2130
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 5470 LIMIT 1
0.852 ms 10 /classes/SpecificPrice.php:435
2728
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 9090 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 9090 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.851 ms 0 /classes/Cart.php:1430
3244
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4322) AND (b.`id_shop` = 1) LIMIT 1
0.850 ms 1 /src/Adapter/EntityMapper.php:71
210
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4279 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.849 ms 10 Yes /classes/SpecificPrice.php:576
811
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2539
AND image_shop.`cover` = 1 LIMIT 1
0.848 ms 1 /classes/Product.php:3570
491
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4267
ORDER BY f.position ASC
0.848 ms 5 Yes /classes/Product.php:6021
2736
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 9091 AND id_shop=1 LIMIT 1
0.847 ms 1 /classes/Product.php:6876
3199
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4267) AND (b.`id_shop` = 1) LIMIT 1
0.847 ms 1 /src/Adapter/EntityMapper.php:71
2389
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2491 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.845 ms 10 Yes /classes/SpecificPrice.php:576
442
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4274)
0.842 ms 1 /classes/Product.php:3860
3041
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 10853
AND image_shop.`cover` = 1 LIMIT 1
0.841 ms 1 /classes/Product.php:3570
2103
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 5331) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.841 ms 1 /classes/stock/StockAvailable.php:453
3028
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 10576 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 10576 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.840 ms 0 /classes/Cart.php:1430
762
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2548 AND id_shop=1 LIMIT 1
0.840 ms 1 /classes/Product.php:6876
243
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2554 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.839 ms 11 Yes /classes/SpecificPrice.php:576
2372
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 7962
ORDER BY f.position ASC
0.838 ms 5 Yes /classes/Product.php:6021
125
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2553 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2553 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.837 ms 0 /classes/Cart.php:1430
2092
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 5322 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 5322 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.837 ms 0 /classes/Cart.php:1430
1478
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4133 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.836 ms 10 Yes /classes/SpecificPrice.php:576
3068
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 10926 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.836 ms 11 Yes /classes/SpecificPrice.php:576
3235
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4327) AND (b.`id_shop` = 1) LIMIT 1
0.836 ms 1 /src/Adapter/EntityMapper.php:71
703
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2542 LIMIT 1
0.835 ms 10 /classes/SpecificPrice.php:435
588
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4329) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.835 ms 1 /classes/stock/StockAvailable.php:453
3404
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2474
ORDER BY `position`
0.835 ms 1 Yes /classes/Product.php:3545
2530
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 9068 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 9068 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.834 ms 0 /classes/Cart.php:1430
2654
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 228 LIMIT 1
0.834 ms 1 /classes/Product.php:5659
3931
SELECT SQL_NO_CACHE *
FROM `hgt78_currency` a
LEFT JOIN `hgt78_currency_shop` `c` ON a.`id_currency` = c.`id_currency` AND c.`id_shop` = 1
WHERE (a.`id_currency` = 2) LIMIT 1
0.833 ms 1 /src/Adapter/EntityMapper.php:71
760
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2548 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.833 ms 10 Yes /classes/SpecificPrice.php:576
1
SELECT SQL_NO_CACHE gs.*, s.*, gs.name AS group_name, s.name AS shop_name, s.active, su.domain, su.domain_ssl, su.physical_uri, su.virtual_uri
FROM hgt78_shop_group gs
LEFT JOIN hgt78_shop s
ON s.id_shop_group = gs.id_shop_group
LEFT JOIN hgt78_shop_url su
ON s.id_shop = su.id_shop AND su.main = 1
WHERE s.deleted = 0
AND gs.deleted = 0
ORDER BY gs.name, s.name
0.830 ms 1 Yes /classes/shop/Shop.php:715
1489
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4148 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.830 ms 10 Yes /classes/SpecificPrice.php:576
3307
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2941) AND (b.`id_shop` = 1) LIMIT 1
0.830 ms 1 /src/Adapter/EntityMapper.php:71
510
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4318 AND `id_group` = 1 LIMIT 1
0.827 ms 0 /classes/GroupReduction.php:156
532
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2529 AND `id_group` = 1 LIMIT 1
0.827 ms 0 /classes/GroupReduction.php:156
100
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 6017 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.827 ms 15 Yes /classes/SpecificPrice.php:576
2143
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 5472 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.827 ms 10 Yes /classes/SpecificPrice.php:576
1511
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4141 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.826 ms 10 Yes /classes/SpecificPrice.php:576
1632
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4306 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.826 ms 10 Yes /classes/SpecificPrice.php:576
2554
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 9071
AND image_shop.`cover` = 1 LIMIT 1
0.826 ms 1 /classes/Product.php:3570
1959
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 5056
AND image_shop.`cover` = 1 LIMIT 1
0.825 ms 2 /classes/Product.php:3570
3091
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 10999 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.825 ms 15 Yes /classes/SpecificPrice.php:576
265
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4315 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.822 ms 10 Yes /classes/SpecificPrice.php:576
2355
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 7959 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.821 ms 10 Yes /classes/SpecificPrice.php:576
3017
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 10469
ORDER BY f.position ASC
0.820 ms 5 Yes /classes/Product.php:6021
3079
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 10928 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.820 ms 11 Yes /classes/SpecificPrice.php:576
2904
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 9106 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 9106 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.819 ms 0 /classes/Cart.php:1430
1147
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2523 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.819 ms 10 Yes /classes/SpecificPrice.php:576
2542
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 9069
ORDER BY f.position ASC
0.819 ms 5 Yes /classes/Product.php:6021
138
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 12682 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 12682 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.818 ms 0 /classes/Cart.php:1430
1500
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4140 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.818 ms 10 Yes /classes/SpecificPrice.php:576
1754
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 5037 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.818 ms 10 Yes /classes/SpecificPrice.php:576
3310
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4216) AND (b.`id_shop` = 1) LIMIT 1
0.818 ms 1 /src/Adapter/EntityMapper.php:71
667
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4321
ORDER BY f.position ASC
0.817 ms 5 Yes /classes/Product.php:6021
3385
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2522) AND (b.`id_shop` = 1) LIMIT 1
0.817 ms 1 /src/Adapter/EntityMapper.php:71
600
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4328 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4328 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.817 ms 0 /classes/Cart.php:1430
3236
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4327
ORDER BY `position`
0.817 ms 1 Yes /classes/Product.php:3545
1914
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 5051
ORDER BY f.position ASC
0.816 ms 5 Yes /classes/Product.php:6021
2442
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 9057
AND image_shop.`cover` = 1 LIMIT 1
0.814 ms 1 /classes/Product.php:3570
526
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.814 ms 1 /classes/Product.php:5659
717
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2541)
0.814 ms 1 /classes/Product.php:3860
2519
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 9067
ORDER BY f.position ASC
0.814 ms 5 Yes /classes/Product.php:6021
2461
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 9058) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.813 ms 1 /classes/stock/StockAvailable.php:453
2484
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 9061 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 9061 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.813 ms 0 /classes/Cart.php:1430
1456
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4129 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.811 ms 10 Yes /classes/SpecificPrice.php:576
2321
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 7954 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.811 ms 10 Yes /classes/SpecificPrice.php:576
2424
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 8985 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.810 ms 18 Yes /classes/SpecificPrice.php:576
2934
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 9144 AND id_shop=1 LIMIT 1
0.810 ms 1 /classes/Product.php:6876
843
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2544
ORDER BY f.position ASC
0.809 ms 5 Yes /classes/Product.php:6021
2756
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 9093 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.809 ms 13 Yes /classes/SpecificPrice.php:576
2944
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 9262 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.809 ms 10 Yes /classes/SpecificPrice.php:576
379
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4259) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.808 ms 1 /classes/stock/StockAvailable.php:453
812
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.807 ms 1 /classes/Product.php:5659
3724
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 8984) AND (b.`id_shop` = 1) LIMIT 1
0.807 ms 1 /src/Adapter/EntityMapper.php:71
2785
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 9096
AND image_shop.`cover` = 1 LIMIT 1
0.806 ms 1 /classes/Product.php:3570
3364
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2608) AND (b.`id_shop` = 1) LIMIT 1
0.806 ms 1 /src/Adapter/EntityMapper.php:71
2332
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 7957 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.805 ms 10 Yes /classes/SpecificPrice.php:576
2942
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 9262 LIMIT 1
0.804 ms 10 /classes/SpecificPrice.php:435
1354
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4044 LIMIT 1
0.803 ms 10 /classes/SpecificPrice.php:435
392
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4248
ORDER BY f.position ASC
0.799 ms 5 Yes /classes/Product.php:6021
1434
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4064 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.799 ms 10 Yes /classes/SpecificPrice.php:576
1990
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 5058 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 5058 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.799 ms 0 /classes/Cart.php:1430
2188
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 6152)
0.799 ms 1 /classes/Product.php:3860
3376
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4088) AND (b.`id_shop` = 1) LIMIT 1
0.799 ms 1 /src/Adapter/EntityMapper.php:71
3916
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 12682) AND (b.`id_shop` = 1) LIMIT 1
0.799 ms 1 /src/Adapter/EntityMapper.php:71
2258
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 6158 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 6158 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.798 ms 0 /classes/Cart.php:1430
3391
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2476) AND (b.`id_shop` = 1) LIMIT 1
0.798 ms 1 /src/Adapter/EntityMapper.php:71
298
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4278 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.796 ms 10 Yes /classes/SpecificPrice.php:576
2547
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 9070 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.796 ms 10 Yes /classes/SpecificPrice.php:576
292
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4313 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4313 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.796 ms 0 /classes/Cart.php:1430
2115
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 5332 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 5332 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.794 ms 0 /classes/Cart.php:1430
431
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3183)
0.794 ms 1 /classes/Product.php:3860
2602
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 9075 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.794 ms 16 Yes /classes/SpecificPrice.php:576
2966
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 9733
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.793 ms 0 /classes/SpecificPrice.php:259
801
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.791 ms 1 /classes/Product.php:5659
919
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4210 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4210 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.791 ms 0 /classes/Cart.php:1430
1196
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2487 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2487 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.791 ms 0 /classes/Cart.php:1430
1506
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4140
ORDER BY f.position ASC
0.789 ms 5 Yes /classes/Product.php:6021
2533
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 229 LIMIT 1
0.788 ms 1 /classes/Product.php:5659
3811
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 9091) AND (b.`id_shop` = 1) LIMIT 1
0.787 ms 1 /src/Adapter/EntityMapper.php:71
2849
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 9101 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 9101 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.786 ms 0 /classes/Cart.php:1430
891
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4216
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.785 ms 0 /classes/SpecificPrice.php:259
3212
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2529
ORDER BY `position`
0.785 ms 1 Yes /classes/Product.php:3545
3829
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 9097) AND (b.`id_shop` = 1) LIMIT 1
0.785 ms 1 /src/Adapter/EntityMapper.php:71
2708
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 9089
AND image_shop.`cover` = 1 LIMIT 1
0.785 ms 1 /classes/Product.php:3570
1467
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4130 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.784 ms 10 Yes /classes/SpecificPrice.php:576
2957
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 9266)
0.784 ms 1 /classes/Product.php:3860
4343
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (9079) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.782 ms 1 Yes Yes /classes/Product.php:4524
2126
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 5334 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 5334 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.781 ms 0 /classes/Cart.php:1430
4146
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4270) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.780 ms 1 Yes Yes /classes/Product.php:4524
2034
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 5158 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 5158 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.780 ms 0 /classes/Cart.php:1430
2366
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 7962 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.778 ms 10 Yes /classes/SpecificPrice.php:576
2182
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 6151
ORDER BY f.position ASC
0.777 ms 5 Yes /classes/Product.php:6021
4342
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (9078) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.777 ms 1 Yes Yes /classes/Product.php:4524
2518
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 9067 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 9067 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.776 ms 0 /classes/Cart.php:1430
402
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4212 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4212 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.775 ms 0 /classes/Cart.php:1430
707
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2542 AND id_shop=1 LIMIT 1
0.774 ms 1 /classes/Product.php:6876
688
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2537 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2537 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.774 ms 0 /classes/Cart.php:1430
4202
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2845) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.774 ms 1 Yes Yes /classes/Product.php:4524
2994
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 10424 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 10424 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.773 ms 0 /classes/Cart.php:1430
3766
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 9072) AND (b.`id_shop` = 1) LIMIT 1
0.773 ms 1 /src/Adapter/EntityMapper.php:71
226
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4309 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4309 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.772 ms 0 /classes/Cart.php:1430
1913
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 5051 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 5051 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.772 ms 0 /classes/Cart.php:1430
2922
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 9108)
0.772 ms 1 /classes/Product.php:3860
3448
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4048) AND (b.`id_shop` = 1) LIMIT 1
0.772 ms 1 /src/Adapter/EntityMapper.php:71
1688
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4576 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.771 ms 10 Yes /classes/SpecificPrice.php:576
2940
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `hgt78_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 60 LIMIT 1
0.771 ms 1 /classes/Category.php:1378
410
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4266 AND id_shop=1 LIMIT 1
0.770 ms 1 /classes/Product.php:6876
2794
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 9096 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 9096 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.770 ms 0 /classes/Cart.php:1430
3203
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2547
ORDER BY `position`
0.770 ms 1 Yes /classes/Product.php:3545
2025
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 5158
AND image_shop.`cover` = 1 LIMIT 1
0.770 ms 1 /classes/Product.php:3570
1257
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2526 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.769 ms 10 Yes /classes/SpecificPrice.php:576
3050
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 10853 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 10853 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.768 ms 0 /classes/Cart.php:1430
204
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4280 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4280 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.767 ms 0 /classes/Cart.php:1430
1643
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4304 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.767 ms 10 Yes /classes/SpecificPrice.php:576
2628
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 9077) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.767 ms 1 /classes/stock/StockAvailable.php:453
3226
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4329) AND (b.`id_shop` = 1) LIMIT 1
0.767 ms 1 /src/Adapter/EntityMapper.php:71
3352
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3184) AND (b.`id_shop` = 1) LIMIT 1
0.767 ms 1 /src/Adapter/EntityMapper.php:71
2155
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 6043)
0.766 ms 1 /classes/Product.php:3860
819
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2539) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.765 ms 1 /classes/stock/StockAvailable.php:453
3823
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 9095) AND (b.`id_shop` = 1) LIMIT 1
0.765 ms 1 /src/Adapter/EntityMapper.php:71
1923
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 5052) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.765 ms 1 /classes/stock/StockAvailable.php:453
4319
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2515) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.765 ms 1 Yes Yes /classes/Product.php:4524
2104
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 5331 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 5331 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.764 ms 0 /classes/Cart.php:1430
1114
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2844 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.763 ms 10 Yes /classes/SpecificPrice.php:576
2871
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 9103 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 9103 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.761 ms 0 /classes/Cart.php:1430
3277
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2549) AND (b.`id_shop` = 1) LIMIT 1
0.761 ms 1 /src/Adapter/EntityMapper.php:71
3478
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4140) AND (b.`id_shop` = 1) LIMIT 1
0.761 ms 1 /src/Adapter/EntityMapper.php:71
3325
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4113) AND (b.`id_shop` = 1) LIMIT 1
0.760 ms 1 /src/Adapter/EntityMapper.php:71
3039
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 10852 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 10852 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.759 ms 0 /classes/Cart.php:1430
3868
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 9262) AND (b.`id_shop` = 1) LIMIT 1
0.759 ms 1 /src/Adapter/EntityMapper.php:71
1582
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4196 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4196 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.758 ms 0 /classes/Cart.php:1430
2047
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 5173
AND image_shop.`cover` = 1 LIMIT 1
0.758 ms 1 /classes/Product.php:3570
3274
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2548) AND (b.`id_shop` = 1) LIMIT 1
0.758 ms 1 /src/Adapter/EntityMapper.php:71
4289
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (5159) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.758 ms 1 Yes Yes /classes/Product.php:4524
375
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4259 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.757 ms 10 Yes /classes/SpecificPrice.php:576
2031
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 5158 AND id_shop=1 LIMIT 1
0.757 ms 1 /classes/Product.php:6876
1516
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4141 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4141 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.756 ms 0 /classes/Cart.php:1430
2636
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 9078)
0.756 ms 1 /classes/Product.php:3860
2669
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 9082)
0.756 ms 1 /classes/Product.php:3860
4173
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2548) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.756 ms 1 Yes Yes /classes/Product.php:4524
2895
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 9106
AND image_shop.`cover` = 1 LIMIT 1
0.755 ms 1 /classes/Product.php:3570
612
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2493
ORDER BY f.position ASC
0.755 ms 5 Yes /classes/Product.php:6021
1549
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4144 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4144 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.754 ms 0 /classes/Cart.php:1430
2657
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 9081 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.754 ms 17 Yes /classes/SpecificPrice.php:576
1677
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4573 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.753 ms 10 Yes /classes/SpecificPrice.php:576
1836
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 5044 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 5044 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.753 ms 0 /classes/Cart.php:1430
3763
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 9071) AND (b.`id_shop` = 1) LIMIT 1
0.753 ms 1 /src/Adapter/EntityMapper.php:71
2570
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 9072)
0.751 ms 1 /classes/Product.php:3860
193
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4282 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4282 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.751 ms 0 /classes/Cart.php:1430
4187
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4210) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.748 ms 1 Yes Yes /classes/Product.php:4524
3062
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 10891 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 10891 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.747 ms 0 /classes/Cart.php:1430
2394
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2491 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2491 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.746 ms 0 /classes/Cart.php:1430
3331
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4111) AND (b.`id_shop` = 1) LIMIT 1
0.746 ms 1 /src/Adapter/EntityMapper.php:71
382
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4248
AND image_shop.`cover` = 1 LIMIT 1
0.745 ms 1 /classes/Product.php:3570
3262
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2541) AND (b.`id_shop` = 1) LIMIT 1
0.745 ms 1 /src/Adapter/EntityMapper.php:71
2523
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 9068 LIMIT 1
0.744 ms 10 /classes/SpecificPrice.php:435
248
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2554 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2554 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.743 ms 0 /classes/Cart.php:1430
2664
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 9082
AND image_shop.`cover` = 1 LIMIT 1
0.743 ms 1 /classes/Product.php:3570
3238
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4324) AND (b.`id_shop` = 1) LIMIT 1
0.743 ms 1 /src/Adapter/EntityMapper.php:71
3442
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4046) AND (b.`id_shop` = 1) LIMIT 1
0.742 ms 1 /src/Adapter/EntityMapper.php:71
3769
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 9073) AND (b.`id_shop` = 1) LIMIT 1
0.741 ms 1 /src/Adapter/EntityMapper.php:71
2192
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 6152 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 6152 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.740 ms 0 /classes/Cart.php:1430
3526
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4573) AND (b.`id_shop` = 1) LIMIT 1
0.740 ms 1 /src/Adapter/EntityMapper.php:71
3358
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3041) AND (b.`id_shop` = 1) LIMIT 1
0.739 ms 1 /src/Adapter/EntityMapper.php:71
3628
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 5173) AND (b.`id_shop` = 1) LIMIT 1
0.737 ms 1 /src/Adapter/EntityMapper.php:71
112
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 6017 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 6017 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.737 ms 0 /classes/Cart.php:1430
2739
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 9091 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 9091 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.736 ms 0 /classes/Cart.php:1430
2773
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 9094
ORDER BY f.position ASC
0.736 ms 5 Yes /classes/Product.php:6021
3841
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 9101) AND (b.`id_shop` = 1) LIMIT 1
0.736 ms 1 /src/Adapter/EntityMapper.php:71
2212
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 6154 AND `id_group` = 1 LIMIT 1
0.735 ms 0 /classes/GroupReduction.php:156
3206
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4318
ORDER BY `position`
0.735 ms 1 Yes /classes/Product.php:3545
3254
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2537
ORDER BY `position`
0.735 ms 1 Yes /classes/Product.php:3545
3367
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2606) AND (b.`id_shop` = 1) LIMIT 1
0.735 ms 1 /src/Adapter/EntityMapper.php:71
872
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4218 AND id_shop=1 LIMIT 1
0.734 ms 1 /classes/Product.php:6876
1659
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4227 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4227 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.734 ms 0 /classes/Cart.php:1430
1671
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4572
ORDER BY f.position ASC
0.734 ms 5 Yes /classes/Product.php:6021
3084
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 10928 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 10928 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.734 ms 0 /classes/Cart.php:1430
2825
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 9099 AND `id_group` = 1 LIMIT 1
0.733 ms 0 /classes/GroupReduction.php:156
4221
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2558) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.733 ms 1 Yes Yes /classes/Product.php:4524
3853
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 9105) AND (b.`id_shop` = 1) LIMIT 1
0.732 ms 1 /src/Adapter/EntityMapper.php:71
1820
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 5043 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.732 ms 10 Yes /classes/SpecificPrice.php:576
2068
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 5174 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 5174 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.732 ms 0 /classes/Cart.php:1430
2326
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 7954 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 7954 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.732 ms 0 /classes/Cart.php:1430
700
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2543
ORDER BY f.position ASC
0.730 ms 5 Yes /classes/Product.php:6021
2026
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.730 ms 1 /classes/Product.php:5659
2044
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 5159) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.730 ms 1 /classes/stock/StockAvailable.php:453
2749
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 9092) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.730 ms 1 /classes/stock/StockAvailable.php:453
2659
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 9081 AND id_shop=1 LIMIT 1
0.729 ms 1 /classes/Product.php:6876
1792
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 5040 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 5040 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.729 ms 0 /classes/Cart.php:1430
2112
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 5332 AND id_shop=1 LIMIT 1
0.728 ms 1 /classes/Product.php:6876
2823
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 9099)
0.727 ms 1 /classes/Product.php:3860
342
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4263 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.726 ms 10 Yes /classes/SpecificPrice.php:576
1097
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2608
ORDER BY f.position ASC
0.726 ms 5 Yes /classes/Product.php:6021
2304
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 6664 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 6664 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.726 ms 0 /classes/Cart.php:1430
2860
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 9102 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 9102 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.726 ms 0 /classes/Cart.php:1430
4206
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4088) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.726 ms 1 Yes Yes /classes/Product.php:4524
3283
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2552) AND (b.`id_shop` = 1) LIMIT 1
0.725 ms 1 /src/Adapter/EntityMapper.php:71
4196
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4116) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.725 ms 1 Yes Yes /classes/Product.php:4524
3029
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 10576
ORDER BY f.position ASC
0.724 ms 5 Yes /classes/Product.php:6021
3924
SELECT SQL_NO_CACHE `id_module` FROM `hgt78_module_shop` WHERE `id_module` = 79 AND `id_shop` = 1 LIMIT 1
0.724 ms 1 /classes/module/Module.php:2137
3334
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4105) AND (b.`id_shop` = 1) LIMIT 1
0.723 ms 1 /src/Adapter/EntityMapper.php:71
3355
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3042) AND (b.`id_shop` = 1) LIMIT 1
0.723 ms 1 /src/Adapter/EntityMapper.php:71
4320
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2491) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.723 ms 1 Yes Yes /classes/Product.php:4524
400
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4212 AND `id_group` = 1 LIMIT 1
0.722 ms 0 /classes/GroupReduction.php:156
1958
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 5055
ORDER BY f.position ASC
0.722 ms 5 Yes /classes/Product.php:6021
2513
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 9067 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.722 ms 10 Yes /classes/SpecificPrice.php:576
908
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4214 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4214 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.721 ms 0 /classes/Cart.php:1430
2371
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 7962 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 7962 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.721 ms 0 /classes/Cart.php:1430
2514
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 9067)
0.721 ms 1 /classes/Product.php:3860
3042
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.721 ms 1 /classes/Product.php:5659
2668
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 9082 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.720 ms 18 Yes /classes/SpecificPrice.php:576
259
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4317 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4317 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.719 ms 0 /classes/Cart.php:1430
1748
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 5036 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 5036 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.719 ms 0 /classes/Cart.php:1430
2467
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 9059
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.719 ms 0 /classes/SpecificPrice.php:259
1483
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4133 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4133 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.718 ms 0 /classes/Cart.php:1430
3772
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 9074) AND (b.`id_shop` = 1) LIMIT 1
0.718 ms 1 /src/Adapter/EntityMapper.php:71
4281
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (5055) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.718 ms 1 Yes Yes /classes/Product.php:4524
2582
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 9073 AND id_shop=1 LIMIT 1
0.717 ms 1 /classes/Product.php:6876
1715
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4697 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4697 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.716 ms 0 /classes/Cart.php:1430
2160
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 6043
ORDER BY f.position ASC
0.716 ms 5 Yes /classes/Product.php:6021
182
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4285 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4285 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.715 ms 0 /classes/Cart.php:1430
683
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2537 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.715 ms 10 Yes /classes/SpecificPrice.php:576
2138
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 5470
ORDER BY f.position ASC
0.715 ms 5 Yes /classes/Product.php:6021
3151
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4277) AND (b.`id_shop` = 1) LIMIT 1
0.715 ms 1 /src/Adapter/EntityMapper.php:71
2429
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 8985 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 8985 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.715 ms 0 /classes/Cart.php:1430
1868
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 5047) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.714 ms 1 /classes/stock/StockAvailable.php:453
472
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4269 LIMIT 1
0.714 ms 10 /classes/SpecificPrice.php:435
3343
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4116) AND (b.`id_shop` = 1) LIMIT 1
0.713 ms 1 /src/Adapter/EntityMapper.php:71
4147
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4269) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.713 ms 1 Yes Yes /classes/Product.php:4524
446
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4274 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4274 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.713 ms 0 /classes/Cart.php:1430
3589
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 5051) AND (b.`id_shop` = 1) LIMIT 1
0.712 ms 1 /src/Adapter/EntityMapper.php:71
2144
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 5472)
0.711 ms 1 /classes/Product.php:3860
2658
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 9081)
0.711 ms 1 /classes/Product.php:3860
3271
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4281) AND (b.`id_shop` = 1) LIMIT 1
0.711 ms 1 /src/Adapter/EntityMapper.php:71
4214
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2516) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.711 ms 1 Yes Yes /classes/Product.php:4524
1968
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 5056 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 5056 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.710 ms 0 /classes/Cart.php:1430
2237
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 6156
ORDER BY f.position ASC
0.710 ms 5 Yes /classes/Product.php:6021
2933
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 9144)
0.710 ms 1 /classes/Product.php:3860
425
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4275
ORDER BY f.position ASC
0.709 ms 5 Yes /classes/Product.php:6021
2641
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 9078
ORDER BY f.position ASC
0.709 ms 5 Yes /classes/Product.php:6021
3712
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 7962) AND (b.`id_shop` = 1) LIMIT 1
0.709 ms 1 /src/Adapter/EntityMapper.php:71
3016
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 10469 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 10469 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.709 ms 0 /classes/Cart.php:1430
771
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2549 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.708 ms 10 Yes /classes/SpecificPrice.php:576
1494
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4148 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4148 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.708 ms 0 /classes/Cart.php:1430
3535
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4697) AND (b.`id_shop` = 1) LIMIT 1
0.708 ms 1 /src/Adapter/EntityMapper.php:71
3859
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 9107) AND (b.`id_shop` = 1) LIMIT 1
0.708 ms 1 /src/Adapter/EntityMapper.php:71
303
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4278 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4278 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.708 ms 0 /classes/Cart.php:1430
2215
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 6154
ORDER BY f.position ASC
0.707 ms 5 Yes /classes/Product.php:6021
3415
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2599) AND (b.`id_shop` = 1) LIMIT 1
0.707 ms 1 /src/Adapter/EntityMapper.php:71
85
SELECT SQL_NO_CACHE ag.id_attribute_group, agl.public_name as attribute_group_name, is_color_group, IF(liaglv.`url_name` IS NULL OR liaglv.`url_name` = "", NULL, liaglv.`url_name`) AS url_name, IF(liaglv.`meta_title` IS NULL OR liaglv.`meta_title` = "", NULL, liaglv.`meta_title`) AS meta_title, IFNULL(liag.indexable, TRUE) AS indexable FROM `hgt78_attribute_group` ag  INNER JOIN hgt78_attribute_group_shop attribute_group_shop
ON (attribute_group_shop.id_attribute_group = ag.id_attribute_group AND attribute_group_shop.id_shop = 1) LEFT JOIN `hgt78_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1) LEFT JOIN `hgt78_layered_indexable_attribute_group` liag ON (ag.`id_attribute_group` = liag.`id_attribute_group`) LEFT JOIN `hgt78_layered_indexable_attribute_group_lang_value` AS liaglv ON (ag.`id_attribute_group` = liaglv.`id_attribute_group` AND agl.`id_lang` = 1) GROUP BY ag.id_attribute_group ORDER BY ag.`position` ASC
0.707 ms 1 Yes Yes /modules/ps_facetedsearch/src/Filters/DataAccessor.php:137
1538
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4142 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4142 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.707 ms 0 /classes/Cart.php:1430
1810
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 5042)
0.706 ms 1 /classes/Product.php:3860
2983
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 10423 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 10423 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.706 ms 0 /classes/Cart.php:1430
3634
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 5308) AND (b.`id_shop` = 1) LIMIT 1
0.706 ms 1 /src/Adapter/EntityMapper.php:71
4361
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (9101) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.706 ms 1 Yes Yes /classes/Product.php:4524
270
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4315 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4315 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.704 ms 0 /classes/Cart.php:1430
1593
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4206 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4206 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.704 ms 0 /classes/Cart.php:1430
2378
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2515 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.704 ms 10 Yes /classes/SpecificPrice.php:576
3505
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4207) AND (b.`id_shop` = 1) LIMIT 1
0.704 ms 1 /src/Adapter/EntityMapper.php:71
3541
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 5033) AND (b.`id_shop` = 1) LIMIT 1
0.704 ms 1 /src/Adapter/EntityMapper.php:71
3409
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2525) AND (b.`id_shop` = 1) LIMIT 1
0.704 ms 1 /src/Adapter/EntityMapper.php:71
3538
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4696) AND (b.`id_shop` = 1) LIMIT 1
0.703 ms 1 /src/Adapter/EntityMapper.php:71
3586
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 5050) AND (b.`id_shop` = 1) LIMIT 1
0.703 ms 1 /src/Adapter/EntityMapper.php:71
1019
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4116 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4116 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.702 ms 0 /classes/Cart.php:1430
2501
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 9063 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.702 ms 18 Yes /classes/SpecificPrice.php:576
2730
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 9091
AND image_shop.`cover` = 1 LIMIT 1
0.702 ms 1 /classes/Product.php:3570
3547
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 5037) AND (b.`id_shop` = 1) LIMIT 1
0.701 ms 1 /src/Adapter/EntityMapper.php:71
1560
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4183 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4183 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.701 ms 0 /classes/Cart.php:1430
2485
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 9061
ORDER BY f.position ASC
0.701 ms 5 Yes /classes/Product.php:6021
2696
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 9085
ORDER BY f.position ASC
0.701 ms 5 Yes /classes/Product.php:6021
2758
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 9093 AND id_shop=1 LIMIT 1
0.701 ms 1 /classes/Product.php:6876
1339
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3056 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3056 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.700 ms 0 /classes/Cart.php:1430
1903
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 5050
ORDER BY f.position ASC
0.700 ms 5 Yes /classes/Product.php:6021
2148
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 5472 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 5472 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.700 ms 0 /classes/Cart.php:1430
3259
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2542) AND (b.`id_shop` = 1) LIMIT 1
0.700 ms 1 /src/Adapter/EntityMapper.php:71
3346
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4069) AND (b.`id_shop` = 1) LIMIT 1
0.700 ms 1 /src/Adapter/EntityMapper.php:71
4224
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2430) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.700 ms 1 Yes Yes /classes/Product.php:4524
408
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4266 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.699 ms 10 Yes /classes/SpecificPrice.php:576
2269
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 6159 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 6159 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.698 ms 0 /classes/Cart.php:1430
3394
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2487) AND (b.`id_shop` = 1) LIMIT 1
0.698 ms 1 /src/Adapter/EntityMapper.php:71
4201
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3041) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.698 ms 1 Yes Yes /classes/Product.php:4524
1394
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4048 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4048 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.698 ms 0 /classes/Cart.php:1430
3280
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2550) AND (b.`id_shop` = 1) LIMIT 1
0.698 ms 1 /src/Adapter/EntityMapper.php:71
253
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4317
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.697 ms 0 /classes/SpecificPrice.php:259
3361
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2845) AND (b.`id_shop` = 1) LIMIT 1
0.697 ms 1 /src/Adapter/EntityMapper.php:71
3289
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2539) AND (b.`id_shop` = 1) LIMIT 1
0.697 ms 1 /src/Adapter/EntityMapper.php:71
332
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4264)
0.696 ms 1 /classes/Product.php:3860
4369
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (9144) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.696 ms 1 Yes Yes /classes/Product.php:4524
4200
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3042) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.695 ms 1 Yes Yes /classes/Product.php:4524
4176
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2552) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.694 ms 1 Yes Yes /classes/Product.php:4524
3328
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4112) AND (b.`id_shop` = 1) LIMIT 1
0.693 ms 1 /src/Adapter/EntityMapper.php:71
3337
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4109) AND (b.`id_shop` = 1) LIMIT 1
0.693 ms 1 /src/Adapter/EntityMapper.php:71
3475
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4148) AND (b.`id_shop` = 1) LIMIT 1
0.692 ms 1 /src/Adapter/EntityMapper.php:71
4177
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2538) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.691 ms 1 Yes Yes /classes/Product.php:4524
1604
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4207 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4207 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.691 ms 0 /classes/Cart.php:1430
1615
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4303 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4303 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.691 ms 0 /classes/Cart.php:1430
2712
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 9089 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.691 ms 14 Yes /classes/SpecificPrice.php:576
3862
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 9108) AND (b.`id_shop` = 1) LIMIT 1
0.691 ms 1 /src/Adapter/EntityMapper.php:71
781
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2550
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.690 ms 0 /classes/SpecificPrice.php:259
3808
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 9090) AND (b.`id_shop` = 1) LIMIT 1
0.690 ms 1 /src/Adapter/EntityMapper.php:71
4145
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4271) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.690 ms 1 Yes Yes /classes/Product.php:4524
3562
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 5042) AND (b.`id_shop` = 1) LIMIT 1
0.689 ms 1 /src/Adapter/EntityMapper.php:71
874
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4218) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.688 ms 1 /classes/stock/StockAvailable.php:453
3511
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4307) AND (b.`id_shop` = 1) LIMIT 1
0.688 ms 1 /src/Adapter/EntityMapper.php:71
3856
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 9106) AND (b.`id_shop` = 1) LIMIT 1
0.688 ms 1 /src/Adapter/EntityMapper.php:71
4171
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2546) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.688 ms 1 Yes Yes /classes/Product.php:4524
4208
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2523) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.688 ms 1 Yes Yes /classes/Product.php:4524
884
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2941 AND `id_group` = 1 LIMIT 1
0.687 ms 0 /classes/GroupReduction.php:156
3607
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 5057) AND (b.`id_shop` = 1) LIMIT 1
0.687 ms 1 /src/Adapter/EntityMapper.php:71
3286
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2538) AND (b.`id_shop` = 1) LIMIT 1
0.686 ms 1 /src/Adapter/EntityMapper.php:71
4189
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4114) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.686 ms 1 Yes Yes /classes/Product.php:4524
2035
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 5158
ORDER BY f.position ASC
0.686 ms 5 Yes /classes/Product.php:6021
651
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4322)
0.685 ms 1 /classes/Product.php:3860
237
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4310 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4310 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.685 ms 0 /classes/Cart.php:1430
2005
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 5078 LIMIT 1
0.685 ms 10 /classes/SpecificPrice.php:435
1803
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 5041 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 5041 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.684 ms 0 /classes/Cart.php:1430
2116
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 5332
ORDER BY f.position ASC
0.684 ms 5 Yes /classes/Product.php:6021
2706
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 9086 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 9086 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.684 ms 0 /classes/Cart.php:1430
3460
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4064) AND (b.`id_shop` = 1) LIMIT 1
0.684 ms 1 /src/Adapter/EntityMapper.php:71
733
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2545
ORDER BY f.position ASC
0.683 ms 5 Yes /classes/Product.php:6021
865
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3553
ORDER BY f.position ASC
0.683 ms 5 Yes /classes/Product.php:6021
1163
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2522 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2522 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.683 ms 0 /classes/Cart.php:1430
2885
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 228 LIMIT 1
0.683 ms 1 /classes/Product.php:5659
2949
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 9262 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 9262 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.683 ms 0 /classes/Cart.php:1430
4158
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4328) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.683 ms 1 Yes Yes /classes/Product.php:4524
3754
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 9068) AND (b.`id_shop` = 1) LIMIT 1
0.682 ms 1 /src/Adapter/EntityMapper.php:71
4175
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2550) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.681 ms 1 Yes Yes /classes/Product.php:4524
2406
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 8978 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 8978 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.681 ms 0 /classes/Cart.php:1430
3472
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4133) AND (b.`id_shop` = 1) LIMIT 1
0.681 ms 1 /src/Adapter/EntityMapper.php:71
2430
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 8985
ORDER BY f.position ASC
0.680 ms 5 Yes /classes/Product.php:6021
4198
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4074) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.680 ms 1 Yes Yes /classes/Product.php:4524
172
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4286
ORDER BY f.position ASC
0.680 ms 5 Yes /classes/Product.php:6021
947
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4113 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.680 ms 10 Yes /classes/SpecificPrice.php:576
952
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4113 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4113 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.680 ms 0 /classes/Cart.php:1430
3397
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2517) AND (b.`id_shop` = 1) LIMIT 1
0.680 ms 1 /src/Adapter/EntityMapper.php:71
4121
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4282) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.680 ms 1 Yes Yes /classes/Product.php:4524
19
SELECT SQL_NO_CACHE m.page, ml.url_rewrite, ml.id_lang
FROM `hgt78_meta` m
LEFT JOIN `hgt78_meta_lang` ml ON (m.id_meta = ml.id_meta AND ml.id_shop = 1 )
ORDER BY LENGTH(ml.url_rewrite) DESC
0.679 ms 129 Yes /classes/Dispatcher.php:654
1240
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2524 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2524 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.678 ms 0 /classes/Cart.php:1430
3322
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4114) AND (b.`id_shop` = 1) LIMIT 1
0.678 ms 1 /src/Adapter/EntityMapper.php:71
787
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2550 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2550 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.678 ms 0 /classes/Cart.php:1430
2280
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 6198 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 6198 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.678 ms 0 /classes/Cart.php:1430
4199
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3184) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.678 ms 1 Yes Yes /classes/Product.php:4524
2454
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 228 LIMIT 1
0.677 ms 1 /classes/Product.php:5659
2941
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 60 LIMIT 1
0.677 ms 1 /classes/Product.php:5659
3268
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2546) AND (b.`id_shop` = 1) LIMIT 1
0.677 ms 1 /src/Adapter/EntityMapper.php:71
3484
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4146) AND (b.`id_shop` = 1) LIMIT 1
0.677 ms 1 /src/Adapter/EntityMapper.php:71
4220
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2597) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.677 ms 1 Yes Yes /classes/Product.php:4524
2360
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 7959 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 7959 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.676 ms 0 /classes/Cart.php:1430
2845
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 9101)
0.676 ms 1 /classes/Product.php:3860
3559
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 5041) AND (b.`id_shop` = 1) LIMIT 1
0.676 ms 1 /src/Adapter/EntityMapper.php:71
4116
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (12682) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.676 ms 1 Yes Yes /classes/Product.php:4524
1058
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3042 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.675 ms 10 Yes /classes/SpecificPrice.php:576
2765
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 9094 LIMIT 1
0.675 ms 18 /classes/SpecificPrice.php:435
2824
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 9099 AND id_shop=1 LIMIT 1
0.675 ms 1 /classes/Product.php:6876
3817
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 9093) AND (b.`id_shop` = 1) LIMIT 1
0.675 ms 1 /src/Adapter/EntityMapper.php:71
4182
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3553) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.675 ms 1 Yes Yes /classes/Product.php:4524
1951
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 5055
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.674 ms 0 /classes/SpecificPrice.php:259
2067
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 5174) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.673 ms 1 /classes/stock/StockAvailable.php:453
3433
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3056) AND (b.`id_shop` = 1) LIMIT 1
0.673 ms 1 /src/Adapter/EntityMapper.php:71
3454
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4061) AND (b.`id_shop` = 1) LIMIT 1
0.672 ms 1 /src/Adapter/EntityMapper.php:71
3915
SELECT SQL_NO_CACHE c.id_elementor FROM hgt78_iqit_elementor_category c WHERE c.id_category = 2 LIMIT 1
0.672 ms 1 /modules/iqitelementor/src/IqitElementorCategory.php:87
2967
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 9733 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.672 ms 11 Yes /classes/SpecificPrice.php:576
3246
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4322
0.672 ms 1 /classes/Product.php:2902
3658
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 6044) AND (b.`id_shop` = 1) LIMIT 1
0.672 ms 1 /src/Adapter/EntityMapper.php:71
4194
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4109) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.671 ms 1 Yes Yes /classes/Product.php:4524
3445
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4047) AND (b.`id_shop` = 1) LIMIT 1
0.670 ms 1 /src/Adapter/EntityMapper.php:71
4219
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2599) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.670 ms 1 Yes Yes /classes/Product.php:4524
4227
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4044) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.670 ms 1 Yes Yes /classes/Product.php:4524
1383
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4047 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4047 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.669 ms 0 /classes/Cart.php:1430
1400
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4060 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.669 ms 10 Yes /classes/SpecificPrice.php:576
1787
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 5040 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.669 ms 10 Yes /classes/SpecificPrice.php:576
1865
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 5047)
0.669 ms 1 /classes/Product.php:3860
2625
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 9077)
0.669 ms 1 /classes/Product.php:3860
3775
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 9075) AND (b.`id_shop` = 1) LIMIT 1
0.669 ms 1 /src/Adapter/EntityMapper.php:71
4215
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2474) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.669 ms 1 Yes Yes /classes/Product.php:4524
864
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3553 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3553 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.668 ms 0 /classes/Cart.php:1430
2315
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 7952 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 7952 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.668 ms 0 /classes/Cart.php:1430
1273
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2599 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2599 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.667 ms 0 /classes/Cart.php:1430
3316
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4210) AND (b.`id_shop` = 1) LIMIT 1
0.667 ms 1 /src/Adapter/EntityMapper.php:71
3379
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4080) AND (b.`id_shop` = 1) LIMIT 1
0.667 ms 1 /src/Adapter/EntityMapper.php:71
541
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2531)
0.667 ms 1 /classes/Product.php:3860
4129
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4314) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.666 ms 1 Yes Yes /classes/Product.php:4524
4222
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2916) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.666 ms 1 Yes Yes /classes/Product.php:4524
1842
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 5045 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.666 ms 10 Yes /classes/SpecificPrice.php:576
3451
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4060) AND (b.`id_shop` = 1) LIMIT 1
0.666 ms 1 /src/Adapter/EntityMapper.php:71
3430
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2430) AND (b.`id_shop` = 1) LIMIT 1
0.665 ms 1 /src/Adapter/EntityMapper.php:71
4371
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (9266) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.665 ms 1 Yes Yes /classes/Product.php:4524
281
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4314 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4314 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.664 ms 0 /classes/Cart.php:1430
3601
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 5055) AND (b.`id_shop` = 1) LIMIT 1
0.664 ms 1 /src/Adapter/EntityMapper.php:71
346
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4263) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.663 ms 1 /classes/stock/StockAvailable.php:453
1025
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4069 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.663 ms 10 Yes /classes/SpecificPrice.php:576
4178
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2539) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.663 ms 1 Yes Yes /classes/Product.php:4524
1422
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4062 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.662 ms 10 Yes /classes/SpecificPrice.php:576
2146
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 5472 AND `id_group` = 1 LIMIT 1
0.662 ms 0 /classes/GroupReduction.php:156
4257
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4576) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.662 ms 1 Yes Yes /classes/Product.php:4524
421
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4275 AND id_shop=1 LIMIT 1
0.662 ms 1 /classes/Product.php:6876
4238
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4133) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.662 ms 1 Yes Yes /classes/Product.php:4524
2451
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 9057 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 9057 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.661 ms 0 /classes/Cart.php:1430
2555
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 229 LIMIT 1
0.661 ms 1 /classes/Product.php:5659
4223
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2801) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.661 ms 1 Yes Yes /classes/Product.php:4524
113
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 6017
ORDER BY f.position ASC
0.660 ms 5 Yes /classes/Product.php:6021
480
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4269
ORDER BY f.position ASC
0.660 ms 5 Yes /classes/Product.php:6021
861
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3553 AND id_shop=1 LIMIT 1
0.660 ms 1 /classes/Product.php:6876
2502
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 9063)
0.660 ms 1 /classes/Product.php:3860
3889
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 10576) AND (b.`id_shop` = 1) LIMIT 1
0.659 ms 1 /src/Adapter/EntityMapper.php:71
4347
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (9085) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.659 ms 1 Yes Yes /classes/Product.php:4524
1693
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4576 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4576 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.658 ms 0 /classes/Cart.php:1430
3181
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4275) AND (b.`id_shop` = 1) LIMIT 1
0.658 ms 1 /src/Adapter/EntityMapper.php:71
4148
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4267) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.658 ms 1 Yes Yes /classes/Product.php:4524
2349
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 7958 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 7958 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.657 ms 0 /classes/Cart.php:1430
2568
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 9072
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.657 ms 0 /classes/SpecificPrice.php:259
4249
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4207) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.657 ms 1 Yes Yes /classes/Product.php:4524
1461
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4129 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4129 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.657 ms 0 /classes/Cart.php:1430
1669
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4572) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.657 ms 1 /classes/stock/StockAvailable.php:453
798
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2552 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2552 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.656 ms 0 /classes/Cart.php:1430
1207
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2517 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2517 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.656 ms 0 /classes/Cart.php:1430
3370
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2844) AND (b.`id_shop` = 1) LIMIT 1
0.656 ms 1 /src/Adapter/EntityMapper.php:71
4229
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4047) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.656 ms 1 Yes Yes /classes/Product.php:4524
1052
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3184 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3184 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.656 ms 0 /classes/Cart.php:1430
2814
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 9098 AND `id_group` = 1 LIMIT 1
0.656 ms 0 /classes/GroupReduction.php:156
3265
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2545) AND (b.`id_shop` = 1) LIMIT 1
0.656 ms 1 /src/Adapter/EntityMapper.php:71
3340
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4106) AND (b.`id_shop` = 1) LIMIT 1
0.656 ms 1 /src/Adapter/EntityMapper.php:71
3700
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 7954) AND (b.`id_shop` = 1) LIMIT 1
0.656 ms 1 /src/Adapter/EntityMapper.php:71
3706
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 7958) AND (b.`id_shop` = 1) LIMIT 1
0.656 ms 1 /src/Adapter/EntityMapper.php:71
1704
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4577 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4577 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.655 ms 0 /classes/Cart.php:1430
2525
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 9068 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.655 ms 10 Yes /classes/SpecificPrice.php:576
2063
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 5174 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.654 ms 10 Yes /classes/SpecificPrice.php:576
2292
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 6435 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 6435 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.652 ms 0 /classes/Cart.php:1430
3751
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 9067) AND (b.`id_shop` = 1) LIMIT 1
0.652 ms 1 /src/Adapter/EntityMapper.php:71
4266
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (5040) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.652 ms 1 Yes Yes /classes/Product.php:4524
4284
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (5058) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.652 ms 1 Yes Yes /classes/Product.php:4524
215
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4279 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4279 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.652 ms 0 /classes/Cart.php:1430
4126
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2554) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.651 ms 1 Yes Yes /classes/Product.php:4524
2085
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 5322 LIMIT 1
0.651 ms 11 /classes/SpecificPrice.php:435
4188
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4213) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.651 ms 1 Yes Yes /classes/Product.php:4524
4375
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (10467) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.651 ms 1 Yes Yes /classes/Product.php:4524
1008
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4106 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4106 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.650 ms 0 /classes/Cart.php:1430
1527
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4146 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4146 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.650 ms 0 /classes/Cart.php:1430
2549
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 9070 AND id_shop=1 LIMIT 1
0.650 ms 1 /classes/Product.php:6876
4216
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2524) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.650 ms 1 Yes Yes /classes/Product.php:4524
1857
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 5046) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.649 ms 1 /classes/stock/StockAvailable.php:453
2033
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 5158) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.649 ms 1 /classes/stock/StockAvailable.php:453
4141
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4266) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.649 ms 1 Yes Yes /classes/Product.php:4524
314
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4277 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4277 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.648 ms 0 /classes/Cart.php:1430
552
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2532)
0.648 ms 1 /classes/Product.php:3860
1826
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 5043
ORDER BY f.position ASC
0.648 ms 5 Yes /classes/Product.php:6021
3793
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 9082) AND (b.`id_shop` = 1) LIMIT 1
0.648 ms 1 /src/Adapter/EntityMapper.php:71
1030
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4069 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4069 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.647 ms 0 /classes/Cart.php:1430
1295
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2558 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2558 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.647 ms 0 /classes/Cart.php:1430
1439
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4064 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4064 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.646 ms 0 /classes/Cart.php:1430
3820
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 9094) AND (b.`id_shop` = 1) LIMIT 1
0.646 ms 1 /src/Adapter/EntityMapper.php:71
4162
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4323) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.646 ms 1 Yes Yes /classes/Product.php:4524
4179
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2540) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.646 ms 1 Yes Yes /classes/Product.php:4524
4260
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4696) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.646 ms 1 Yes Yes /classes/Product.php:4524
2937
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 9144 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 9144 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.645 ms 0 /classes/Cart.php:1430
4137
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4260) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.645 ms 1 Yes Yes /classes/Product.php:4524
2847
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 9101 AND `id_group` = 1 LIMIT 1
0.645 ms 0 /classes/GroupReduction.php:156
4263
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (5037) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.645 ms 1 Yes Yes /classes/Product.php:4524
826
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2540 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.644 ms 10 Yes /classes/SpecificPrice.php:576
3184
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3183) AND (b.`id_shop` = 1) LIMIT 1
0.644 ms 1 /src/Adapter/EntityMapper.php:71
2950
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 9262
ORDER BY f.position ASC
0.643 ms 5 Yes /classes/Product.php:6021
4174
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2549) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.643 ms 1 Yes Yes /classes/Product.php:4524
4180
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2544) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.643 ms 1 Yes Yes /classes/Product.php:4524
4333
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (9069) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.643 ms 1 Yes Yes /classes/Product.php:4524
3154
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4276) AND (b.`id_shop` = 1) LIMIT 1
0.642 ms 1 /src/Adapter/EntityMapper.php:71
3313
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4214) AND (b.`id_shop` = 1) LIMIT 1
0.642 ms 1 /src/Adapter/EntityMapper.php:71
3187
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4274) AND (b.`id_shop` = 1) LIMIT 1
0.641 ms 1 /src/Adapter/EntityMapper.php:71
2579
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 9073
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.641 ms 0 /classes/SpecificPrice.php:259
4235
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4090) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.641 ms 1 Yes Yes /classes/Product.php:4524
881
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2941 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.640 ms 10 Yes /classes/SpecificPrice.php:576
2717
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 9089 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 9089 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.639 ms 0 /classes/Cart.php:1430
3814
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 9092) AND (b.`id_shop` = 1) LIMIT 1
0.639 ms 1 /src/Adapter/EntityMapper.php:71
4270
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (5044) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.639 ms 1 Yes Yes /classes/Product.php:4524
1626
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4307 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4307 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.638 ms 0 /classes/Cart.php:1430
3098
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 6017) AND (b.`id_shop` = 1) LIMIT 1
0.638 ms 1 /src/Adapter/EntityMapper.php:71
767
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2549
AND image_shop.`cover` = 1 LIMIT 1
0.637 ms 1 /classes/Product.php:3570
920
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4210
ORDER BY f.position ASC
0.637 ms 5 Yes /classes/Product.php:6021
2123
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 5334 AND id_shop=1 LIMIT 1
0.637 ms 1 /classes/Product.php:6876
3224
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2534
ORDER BY `position`
0.637 ms 1 Yes /classes/Product.php:3545
4226
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4043) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.636 ms 1 Yes Yes /classes/Product.php:4524
386
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4248 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.636 ms 10 Yes /classes/SpecificPrice.php:576
668
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2536
AND image_shop.`cover` = 1 LIMIT 1
0.636 ms 1 /classes/Product.php:3570
4133
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4276) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.635 ms 1 Yes Yes /classes/Product.php:4524
1450
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4090 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4090 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.635 ms 0 /classes/Cart.php:1430
4191
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4112) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.635 ms 1 Yes Yes /classes/Product.php:4524
3145
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4313) AND (b.`id_shop` = 1) LIMIT 1
0.634 ms 1 /src/Adapter/EntityMapper.php:71
4185
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4216) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.634 ms 1 Yes Yes /classes/Product.php:4524
4250
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4303) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.634 ms 1 Yes Yes /classes/Product.php:4524
880
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2941
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.633 ms 0 /classes/SpecificPrice.php:259
2383
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2515 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2515 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.633 ms 0 /classes/Cart.php:1430
3193
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4270) AND (b.`id_shop` = 1) LIMIT 1
0.633 ms 1 /src/Adapter/EntityMapper.php:71
3655
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 6043) AND (b.`id_shop` = 1) LIMIT 1
0.633 ms 1 /src/Adapter/EntityMapper.php:71
4159
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2493) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.633 ms 1 Yes Yes /classes/Product.php:4524
4228
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4046) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.633 ms 1 Yes Yes /classes/Product.php:4524
4236
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4129) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.633 ms 1 Yes Yes /classes/Product.php:4524
4306
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (6156) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.633 ms 1 Yes Yes /classes/Product.php:4524
2813
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 9098 AND id_shop=1 LIMIT 1
0.632 ms 1 /classes/Product.php:6876
3533
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4577
ORDER BY `position`
0.632 ms 1 Yes /classes/Product.php:3545
4161
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4324) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.632 ms 1 Yes Yes /classes/Product.php:4524
4265
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (5039) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.632 ms 1 Yes Yes /classes/Product.php:4524
4280
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (5054) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.632 ms 1 Yes Yes /classes/Product.php:4524
3096
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 10999 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 10999 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.631 ms 0 /classes/Cart.php:1430
4163
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4322) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.631 ms 1 Yes Yes /classes/Product.php:4524
4210
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2518) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.631 ms 1 Yes Yes /classes/Product.php:4524
3874
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 9733) AND (b.`id_shop` = 1) LIMIT 1
0.631 ms 1 /src/Adapter/EntityMapper.php:71
1637
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4306 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4306 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.630 ms 0 /classes/Cart.php:1430
2196
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 6153 LIMIT 1
0.630 ms 11 /classes/SpecificPrice.php:435
2114
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 5332) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.630 ms 1 /classes/stock/StockAvailable.php:453
3715
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2515) AND (b.`id_shop` = 1) LIMIT 1
0.630 ms 1 /src/Adapter/EntityMapper.php:71
4230
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4048) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.630 ms 1 Yes Yes /classes/Product.php:4524
4267
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (5041) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.630 ms 1 Yes Yes /classes/Product.php:4524
4296
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (5334) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.630 ms 1 Yes Yes /classes/Product.php:4524
2984
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 10423
ORDER BY f.position ASC
0.629 ms 5 Yes /classes/Product.php:6021
3301
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3553) AND (b.`id_shop` = 1) LIMIT 1
0.629 ms 1 /src/Adapter/EntityMapper.php:71
4134
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4264) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.629 ms 1 Yes Yes /classes/Product.php:4524
452
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4271 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.628 ms 10 Yes /classes/SpecificPrice.php:576
3012
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 10469)
0.628 ms 1 /classes/Product.php:3860
3101
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2553) AND (b.`id_shop` = 1) LIMIT 1
0.628 ms 1 /src/Adapter/EntityMapper.php:71
4132
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4277) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.628 ms 1 Yes Yes /classes/Product.php:4524
4209
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2522) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.628 ms 1 Yes Yes /classes/Product.php:4524
3848
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 9103
ORDER BY `position`
0.627 ms 1 Yes /classes/Product.php:3545
4166
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2537) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.627 ms 1 Yes Yes /classes/Product.php:4524
4169
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2541) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.627 ms 1 Yes Yes /classes/Product.php:4524
4131
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4278) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.626 ms 1 Yes Yes /classes/Product.php:4524
86
SELECT SQL_NO_CACHE DISTINCT f.id_feature, f.*, fl.*, IF(liflv.`url_name` IS NULL OR liflv.`url_name` = "", NULL, liflv.`url_name`) AS url_name, IF(liflv.`meta_title` IS NULL OR liflv.`meta_title` = "", NULL, liflv.`meta_title`) AS meta_title, lif.indexable FROM `hgt78_feature` f  INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1) LEFT JOIN `hgt78_feature_lang` fl ON (f.`id_feature` = fl.`id_feature` AND fl.`id_lang` = 1) LEFT JOIN `hgt78_layered_indexable_feature` lif ON (f.`id_feature` = lif.`id_feature`) LEFT JOIN `hgt78_layered_indexable_feature_lang_value` liflv ON (f.`id_feature` = liflv.`id_feature` AND liflv.`id_lang` = 1) ORDER BY f.`position` ASC
0.626 ms 25 Yes /modules/ps_facetedsearch/src/Filters/DataAccessor.php:171
3109
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4224) AND (b.`id_shop` = 1) LIMIT 1
0.626 ms 1 /src/Adapter/EntityMapper.php:71
3130
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4310) AND (b.`id_shop` = 1) LIMIT 1
0.626 ms 1 /src/Adapter/EntityMapper.php:71
3610
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 5058) AND (b.`id_shop` = 1) LIMIT 1
0.626 ms 1 /src/Adapter/EntityMapper.php:71
4156
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2534) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.626 ms 1 Yes Yes /classes/Product.php:4524
4205
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2844) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.626 ms 1 Yes Yes /classes/Product.php:4524
4218
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2526) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.626 ms 1 Yes Yes /classes/Product.php:4524
4128
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4315) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.625 ms 1 Yes Yes /classes/Product.php:4524
3237
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4327
0.625 ms 1 /classes/Product.php:2902
1191
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2487 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.624 ms 10 Yes /classes/SpecificPrice.php:576
1682
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4573 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4573 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.624 ms 0 /classes/Cart.php:1430
2906
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 9107
AND image_shop.`cover` = 1 LIMIT 1
0.624 ms 1 /classes/Product.php:3570
3073
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 10926 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 10926 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.624 ms 0 /classes/Cart.php:1430
3169
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4259) AND (b.`id_shop` = 1) LIMIT 1
0.624 ms 1 /src/Adapter/EntityMapper.php:71
3584
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5049
ORDER BY `position`
0.623 ms 2 Yes /classes/Product.php:3545
3844
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 9102) AND (b.`id_shop` = 1) LIMIT 1
0.623 ms 1 /src/Adapter/EntityMapper.php:71
4204
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2606) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.623 ms 1 Yes Yes /classes/Product.php:4524
4315
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (7957) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.623 ms 1 Yes Yes /classes/Product.php:4524
1063
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3042 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3042 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.622 ms 0 /classes/Cart.php:1430
2094
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 5331
AND image_shop.`cover` = 1 LIMIT 1
0.622 ms 1 /classes/Product.php:3570
2226
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 6155
ORDER BY f.position ASC
0.622 ms 5 Yes /classes/Product.php:6021
4150
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4318) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.622 ms 1 Yes Yes /classes/Product.php:4524
4164
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4321) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.622 ms 1 Yes Yes /classes/Product.php:4524
4225
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3056) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.622 ms 1 Yes Yes /classes/Product.php:4524
4240
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4140) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.622 ms 1 Yes Yes /classes/Product.php:4524
4258
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4577) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.622 ms 1 Yes Yes /classes/Product.php:4524
1887
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 5049)
0.621 ms 1 /classes/Product.php:3860
3837
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 9099
0.621 ms 1 /classes/Product.php:2902
4114
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (6017) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.621 ms 1 Yes Yes /classes/Product.php:4524
3121
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4280) AND (b.`id_shop` = 1) LIMIT 1
0.621 ms 1 /src/Adapter/EntityMapper.php:71
4172
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4281) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.621 ms 1 Yes Yes /classes/Product.php:4524
2665
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 228 LIMIT 1
0.620 ms 1 /classes/Product.php:5659
3106
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4225) AND (b.`id_shop` = 1) LIMIT 1
0.620 ms 1 /src/Adapter/EntityMapper.php:71
4192
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4111) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.620 ms 1 Yes Yes /classes/Product.php:4524
388
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4248 AND id_shop=1 LIMIT 1
0.619 ms 1 /classes/Product.php:6876
4193
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4105) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.619 ms 1 Yes Yes /classes/Product.php:4524
2527
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 9068 AND id_shop=1 LIMIT 1
0.618 ms 1 /classes/Product.php:6876
403
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4212
ORDER BY f.position ASC
0.617 ms 5 Yes /classes/Product.php:6021
2222
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 6155 AND id_shop=1 LIMIT 1
0.617 ms 1 /classes/Product.php:6876
4269
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (5043) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.617 ms 1 Yes Yes /classes/Product.php:4524
361
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.616 ms 1 /classes/Product.php:5659
4259
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4697) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.616 ms 1 Yes Yes /classes/Product.php:4524
1427
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4062 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4062 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.616 ms 0 /classes/Cart.php:1430
4138
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4259) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.615 ms 1 Yes Yes /classes/Product.php:4524
3178
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4266) AND (b.`id_shop` = 1) LIMIT 1
0.615 ms 1 /src/Adapter/EntityMapper.php:71
3190
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4271) AND (b.`id_shop` = 1) LIMIT 1
0.615 ms 1 /src/Adapter/EntityMapper.php:71
4383
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (10999) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.614 ms 1 Yes Yes /classes/Product.php:4524
1976
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 5057 AND id_shop=1 LIMIT 1
0.614 ms 1 /classes/Product.php:6876
2229
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 6156 LIMIT 1
0.614 ms 11 /classes/SpecificPrice.php:435
3718
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2491) AND (b.`id_shop` = 1) LIMIT 1
0.614 ms 1 /src/Adapter/EntityMapper.php:71
1648
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4304 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4304 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.613 ms 0 /classes/Cart.php:1430
3616
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 5078) AND (b.`id_shop` = 1) LIMIT 1
0.613 ms 1 /src/Adapter/EntityMapper.php:71
4308
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (6158) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.613 ms 1 Yes Yes /classes/Product.php:4524
4346
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (9084) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.613 ms 1 Yes Yes /classes/Product.php:4524
546
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2531
ORDER BY f.position ASC
0.612 ms 5 Yes /classes/Product.php:6021
2465
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 228 LIMIT 1
0.612 ms 1 /classes/Product.php:5659
2884
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 9105
AND image_shop.`cover` = 1 LIMIT 1
0.612 ms 1 /classes/Product.php:3570
4165
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2536) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.612 ms 1 Yes Yes /classes/Product.php:4524
4307
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (6157) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.612 ms 1 Yes Yes /classes/Product.php:4524
3136
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4317) AND (b.`id_shop` = 1) LIMIT 1
0.612 ms 1 /src/Adapter/EntityMapper.php:71
4323
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (8985) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.611 ms 1 Yes Yes /classes/Product.php:4524
1815
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 5042
ORDER BY f.position ASC
0.611 ms 5 Yes /classes/Product.php:6021
4358
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (9098) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.611 ms 1 Yes Yes /classes/Product.php:4524
471
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.610 ms 1 /classes/Product.php:5659
1699
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4577 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.610 ms 10 Yes /classes/SpecificPrice.php:576
4184
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2941) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.610 ms 1 Yes Yes /classes/Product.php:4524
1873
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 5048 LIMIT 1
0.610 ms 10 /classes/SpecificPrice.php:435
2695
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 9085 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 9085 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.610 ms 0 /classes/Cart.php:1430
2872
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 9103
ORDER BY f.position ASC
0.610 ms 5 Yes /classes/Product.php:6021
3160
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4263) AND (b.`id_shop` = 1) LIMIT 1
0.610 ms 1 /src/Adapter/EntityMapper.php:71
3172
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4248) AND (b.`id_shop` = 1) LIMIT 1
0.610 ms 1 /src/Adapter/EntityMapper.php:71
4268
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (5042) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.610 ms 1 Yes Yes /classes/Product.php:4524
4195
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4106) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.609 ms 1 Yes Yes /classes/Product.php:4524
299
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4278)
0.609 ms 1 /classes/Product.php:3860
3553
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 5039) AND (b.`id_shop` = 1) LIMIT 1
0.609 ms 1 /src/Adapter/EntityMapper.php:71
4212
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2487) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.609 ms 1 Yes Yes /classes/Product.php:4524
161
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4224
ORDER BY f.position ASC
0.608 ms 5 Yes /classes/Product.php:6021
4272
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (5046) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.608 ms 1 Yes Yes /classes/Product.php:4524
407
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4266
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.607 ms 0 /classes/SpecificPrice.php:259
515
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.607 ms 1 /classes/Product.php:5659
2761
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 9093 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 9093 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.607 ms 0 /classes/Cart.php:1430
3163
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4262) AND (b.`id_shop` = 1) LIMIT 1
0.607 ms 1 /src/Adapter/EntityMapper.php:71
3202
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2547) AND (b.`id_shop` = 1) LIMIT 1
0.607 ms 1 /src/Adapter/EntityMapper.php:71
4124
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4309) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.607 ms 1 Yes Yes /classes/Product.php:4524
3592
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 5052) AND (b.`id_shop` = 1) LIMIT 1
0.606 ms 1 /src/Adapter/EntityMapper.php:71
4170
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2545) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.606 ms 1 Yes Yes /classes/Product.php:4524
4239
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4148) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.606 ms 1 Yes Yes /classes/Product.php:4524
2931
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 9144
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.605 ms 0 /classes/SpecificPrice.php:259
4127
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4317) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.605 ms 1 Yes Yes /classes/Product.php:4524
3118
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4282) AND (b.`id_shop` = 1) LIMIT 1
0.605 ms 1 /src/Adapter/EntityMapper.php:71
2577
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 229 LIMIT 1
0.603 ms 1 /classes/Product.php:5659
3157
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4264) AND (b.`id_shop` = 1) LIMIT 1
0.603 ms 1 /src/Adapter/EntityMapper.php:71
896
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4216) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.602 ms 1 /classes/stock/StockAvailable.php:453
3865
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 9144) AND (b.`id_shop` = 1) LIMIT 1
0.602 ms 1 /src/Adapter/EntityMapper.php:71
4183
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4218) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.602 ms 1 Yes Yes /classes/Product.php:4524
2058
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 5173
ORDER BY f.position ASC
0.601 ms 5 Yes /classes/Product.php:6021
3054
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 10891) AND (b.`id_shop` = 1) LIMIT 1
0.601 ms 1 /src/Adapter/EntityMapper.php:71
3380
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4080
ORDER BY `position`
0.601 ms 1 Yes /classes/Product.php:3545
4186
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4214) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.601 ms 1 Yes Yes /classes/Product.php:4524
4197
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4069) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.601 ms 1 Yes Yes /classes/Product.php:4524
1710
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4697 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.600 ms 10 Yes /classes/SpecificPrice.php:576
3175
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4212) AND (b.`id_shop` = 1) LIMIT 1
0.600 ms 1 /src/Adapter/EntityMapper.php:71
3220
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2533) AND (b.`id_shop` = 1) LIMIT 1
0.600 ms 1 /src/Adapter/EntityMapper.php:71
4125
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4310) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.600 ms 1 Yes Yes /classes/Product.php:4524
4115
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2553) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.600 ms 1 Yes Yes /classes/Product.php:4524
4135
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4263) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.600 ms 1 Yes Yes /classes/Product.php:4524
4181
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3554) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.599 ms 1 Yes Yes /classes/Product.php:4524
4203
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2608) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.599 ms 1 Yes Yes /classes/Product.php:4524
4211
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2476) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.599 ms 1 Yes Yes /classes/Product.php:4524
875
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4218 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4218 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.598 ms 0 /classes/Cart.php:1430
2729
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 9090
ORDER BY f.position ASC
0.598 ms 5 Yes /classes/Product.php:6021
2903
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 9106) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.598 ms 1 /classes/stock/StockAvailable.php:453
3249
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4321
0.598 ms 1 /classes/Product.php:2902
4123
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4279) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.598 ms 1 Yes Yes /classes/Product.php:4524
4264
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (5038) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.598 ms 1 Yes Yes /classes/Product.php:4524
2709
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 228 LIMIT 1
0.597 ms 1 /classes/Product.php:5659
3733
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 9057) AND (b.`id_shop` = 1) LIMIT 1
0.597 ms 1 /src/Adapter/EntityMapper.php:71
4139
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4248) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.597 ms 1 Yes Yes /classes/Product.php:4524
4277
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (5051) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.597 ms 1 Yes Yes /classes/Product.php:4524
1251
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2525 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2525 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.596 ms 0 /classes/Cart.php:1430
2166
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 6044)
0.596 ms 1 /classes/Product.php:3860
2673
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 9082 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 9082 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.596 ms 0 /classes/Cart.php:1430
2902
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 9106 AND `id_group` = 1 LIMIT 1
0.596 ms 0 /classes/GroupReduction.php:156
3893
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 10852
ORDER BY `position`
0.596 ms 1 Yes /classes/Product.php:3545
3115
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4285) AND (b.`id_shop` = 1) LIMIT 1
0.595 ms 1 /src/Adapter/EntityMapper.php:71
1262
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2526 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2526 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.595 ms 0 /classes/Cart.php:1430
1855
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 5046 AND id_shop=1 LIMIT 1
0.595 ms 1 /classes/Product.php:6876
2337
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 7957 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 7957 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.595 ms 0 /classes/Cart.php:1430
4190
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4113) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.594 ms 1 Yes Yes /classes/Product.php:4524
4251
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4307) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.594 ms 1 Yes Yes /classes/Product.php:4524
876
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4218
ORDER BY f.position ASC
0.594 ms 5 Yes /classes/Product.php:6021
1979
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 5057 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 5057 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.594 ms 0 /classes/Cart.php:1430
3142
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4314) AND (b.`id_shop` = 1) LIMIT 1
0.594 ms 1 /src/Adapter/EntityMapper.php:71
3148
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4278) AND (b.`id_shop` = 1) LIMIT 1
0.594 ms 1 /src/Adapter/EntityMapper.php:71
3577
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 5047) AND (b.`id_shop` = 1) LIMIT 1
0.593 ms 1 /src/Adapter/EntityMapper.php:71
2563
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 9071 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 9071 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.593 ms 0 /classes/Cart.php:1430
3112
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4286) AND (b.`id_shop` = 1) LIMIT 1
0.592 ms 1 /src/Adapter/EntityMapper.php:71
4322
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (8984) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.592 ms 1 Yes Yes /classes/Product.php:4524
1268
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2599 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.591 ms 3 Yes /classes/SpecificPrice.php:576
3155
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4276
ORDER BY `position`
0.591 ms 1 Yes /classes/Product.php:3545
4234
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4064) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.591 ms 1 Yes Yes /classes/Product.php:4524
1069
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3041 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.591 ms 10 Yes /classes/SpecificPrice.php:576
3124
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4279) AND (b.`id_shop` = 1) LIMIT 1
0.591 ms 1 /src/Adapter/EntityMapper.php:71
4255
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4572) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.590 ms 1 Yes Yes /classes/Product.php:4524
3133
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2554) AND (b.`id_shop` = 1) LIMIT 1
0.589 ms 1 /src/Adapter/EntityMapper.php:71
1771
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 5038
ORDER BY f.position ASC
0.589 ms 5 Yes /classes/Product.php:6021
563
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2533)
0.588 ms 1 /classes/Product.php:3860
481
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4267
AND image_shop.`cover` = 1 LIMIT 1
0.587 ms 1 /classes/Product.php:3570
893
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4216)
0.587 ms 1 /classes/Product.php:3860
4242
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4146) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.587 ms 1 Yes Yes /classes/Product.php:4524
1279
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2597 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.586 ms 10 Yes /classes/SpecificPrice.php:576
2907
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 228 LIMIT 1
0.586 ms 1 /classes/Product.php:5659
494
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2547 LIMIT 1
0.585 ms 10 /classes/SpecificPrice.php:435
4217
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2525) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.585 ms 1 Yes Yes /classes/Product.php:4524
1169
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2518 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.585 ms 10 Yes /classes/SpecificPrice.php:576
832
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2540
ORDER BY f.position ASC
0.584 ms 5 Yes /classes/Product.php:6021
888
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4216
AND image_shop.`cover` = 1 LIMIT 1
0.584 ms 1 /classes/Product.php:3570
1317
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2801 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2801 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.584 ms 0 /classes/Cart.php:1430
3088
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 10999) AND (b.`id_shop` = 1) LIMIT 1
0.583 ms 1 /src/Adapter/EntityMapper.php:71
3139
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4315) AND (b.`id_shop` = 1) LIMIT 1
0.583 ms 1 /src/Adapter/EntityMapper.php:71
3194
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4270
ORDER BY `position`
0.583 ms 1 Yes /classes/Product.php:3545
337
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4264
ORDER BY f.position ASC
0.582 ms 5 Yes /classes/Product.php:6021
1036
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4074 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.582 ms 10 Yes /classes/SpecificPrice.php:576
1107
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2606 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2606 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.582 ms 0 /classes/Cart.php:1430
2544
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 229 LIMIT 1
0.582 ms 1 /classes/Product.php:5659
851
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3554 AND `id_group` = 1 LIMIT 1
0.581 ms 0 /classes/GroupReduction.php:156
2779
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 9095)
0.581 ms 1 /classes/Product.php:3860
2908
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 9107 LIMIT 1
0.581 ms 14 /classes/SpecificPrice.php:435
1086
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2845
ORDER BY f.position ASC
0.579 ms 5 Yes /classes/Product.php:6021
1555
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4183 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.579 ms 10 Yes /classes/SpecificPrice.php:576
3748
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 9063) AND (b.`id_shop` = 1) LIMIT 1
0.579 ms 1 /src/Adapter/EntityMapper.php:71
4271
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (5045) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.579 ms 1 Yes Yes /classes/Product.php:4524
3424
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2916) AND (b.`id_shop` = 1) LIMIT 1
0.577 ms 1 /src/Adapter/EntityMapper.php:71
1197
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2487
ORDER BY f.position ASC
0.574 ms 5 Yes /classes/Product.php:6021
2015
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.574 ms 1 /classes/Product.php:5659
2177
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 6151)
0.574 ms 1 /classes/Product.php:3860
4339
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (9075) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.574 ms 1 Yes Yes /classes/Product.php:4524
3892
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 10852) AND (b.`id_shop` = 1) LIMIT 1
0.573 ms 1 /src/Adapter/EntityMapper.php:71
1955
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 5055 AND `id_group` = 1 LIMIT 1
0.573 ms 0 /classes/GroupReduction.php:156
878
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.572 ms 1 /classes/Product.php:5659
4117
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4225) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.572 ms 1 Yes Yes /classes/Product.php:4524
2109
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 5332
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.571 ms 0 /classes/SpecificPrice.php:259
3188
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4274
ORDER BY `position`
0.571 ms 1 Yes /classes/Product.php:3545
4149
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2547) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.570 ms 1 Yes Yes /classes/Product.php:4524
4327
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (9059) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.569 ms 1 Yes Yes /classes/Product.php:4524
2441
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 8986
ORDER BY f.position ASC
0.568 ms 5 Yes /classes/Product.php:6021
2812
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 9098)
0.568 ms 1 /classes/Product.php:3860
3392
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2476
ORDER BY `position`
0.568 ms 1 Yes /classes/Product.php:3545
4120
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4285) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.568 ms 1 Yes Yes /classes/Product.php:4524
2248
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 6157
ORDER BY f.position ASC
0.567 ms 5 Yes /classes/Product.php:6021
2181
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 6151 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 6151 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.566 ms 0 /classes/Cart.php:1430
2740
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 9091
ORDER BY f.position ASC
0.566 ms 5 Yes /classes/Product.php:6021
3051
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 10853
ORDER BY f.position ASC
0.566 ms 5 Yes /classes/Product.php:6021
3847
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 9103) AND (b.`id_shop` = 1) LIMIT 1
0.566 ms 1 /src/Adapter/EntityMapper.php:71
3886
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 10469) AND (b.`id_shop` = 1) LIMIT 1
0.566 ms 1 /src/Adapter/EntityMapper.php:71
1832
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 5044)
0.565 ms 1 /classes/Product.php:3860
2135
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 5470 AND `id_group` = 1 LIMIT 1
0.565 ms 0 /classes/GroupReduction.php:156
357
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4262) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.564 ms 1 /classes/stock/StockAvailable.php:453
2152
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 6043 LIMIT 1
0.564 ms 10 /classes/SpecificPrice.php:435
2171
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 6044
ORDER BY f.position ASC
0.564 ms 5 Yes /classes/Product.php:6021
2566
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 229 LIMIT 1
0.564 ms 1 /classes/Product.php:5659
3362
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2845
ORDER BY `position`
0.564 ms 1 Yes /classes/Product.php:3545
1102
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2606 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.563 ms 10 Yes /classes/SpecificPrice.php:576
2019
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 5081)
0.563 ms 1 /classes/Product.php:3860
1224
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2474 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.562 ms 10 Yes /classes/SpecificPrice.php:576
326
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4276
ORDER BY f.position ASC
0.562 ms 5 Yes /classes/Product.php:6021
847
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3554
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.562 ms 0 /classes/SpecificPrice.php:259
2413
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 8984 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.562 ms 18 Yes /classes/SpecificPrice.php:576
557
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2532
ORDER BY f.position ASC
0.561 ms 5 Yes /classes/Product.php:6021
1605
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4207
ORDER BY f.position ASC
0.561 ms 5 Yes /classes/Product.php:6021
2701
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 9086 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.561 ms 10 Yes /classes/SpecificPrice.php:576
3598
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 5054) AND (b.`id_shop` = 1) LIMIT 1
0.561 ms 1 /src/Adapter/EntityMapper.php:71
3883
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 10467) AND (b.`id_shop` = 1) LIMIT 1
0.561 ms 1 /src/Adapter/EntityMapper.php:71
679
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2537
AND image_shop.`cover` = 1 LIMIT 1
0.560 ms 1 /classes/Product.php:3570
1594
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4206
ORDER BY f.position ASC
0.560 ms 5 Yes /classes/Product.php:6021
3127
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4309) AND (b.`id_shop` = 1) LIMIT 1
0.560 ms 1 /src/Adapter/EntityMapper.php:71
2228
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.560 ms 1 /classes/Product.php:5659
3102
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2553
ORDER BY `position`
0.559 ms 1 Yes /classes/Product.php:3545
156
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4224)
0.559 ms 1 /classes/Product.php:3860
2161
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 6044
AND image_shop.`cover` = 1 LIMIT 1
0.559 ms 1 /classes/Product.php:3570
1378
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4047 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.558 ms 10 Yes /classes/SpecificPrice.php:576
4379
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (10853) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.557 ms 1 Yes Yes /classes/Product.php:4524
1131
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4088
ORDER BY f.position ASC
0.557 ms 5 Yes /classes/Product.php:6021
1927
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.557 ms 1 /classes/Product.php:5659
2142
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 5472
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.557 ms 0 /classes/SpecificPrice.php:259
2191
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 6152) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.557 ms 1 /classes/stock/StockAvailable.php:453
852
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3554) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.556 ms 1 /classes/stock/StockAvailable.php:453
1367
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4046 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.555 ms 10 Yes /classes/SpecificPrice.php:576
2061
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 5174 LIMIT 1
0.555 ms 10 /classes/SpecificPrice.php:435
2010
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 5078 AND `id_group` = 1 LIMIT 1
0.554 ms 0 /classes/GroupReduction.php:156
2911
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 9107)
0.554 ms 1 /classes/Product.php:3860
766
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2548
ORDER BY f.position ASC
0.554 ms 5 Yes /classes/Product.php:6021
778
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2550
AND image_shop.`cover` = 1 LIMIT 1
0.552 ms 1 /classes/Product.php:3570
992
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4109 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.552 ms 10 Yes /classes/SpecificPrice.php:576
2060
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 128 LIMIT 1
0.552 ms 1 /classes/Product.php:5659
3204
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2547
0.552 ms 1 /classes/Product.php:2902
3529
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4576) AND (b.`id_shop` = 1) LIMIT 1
0.551 ms 1 /src/Adapter/EntityMapper.php:71
4338
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (9074) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.551 ms 1 Yes Yes /classes/Product.php:4524
535
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2529
ORDER BY f.position ASC
0.550 ms 5 Yes /classes/Product.php:6021
4337
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (9073) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.549 ms 1 Yes Yes /classes/Product.php:4524
4380
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (10891) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.549 ms 1 Yes Yes /classes/Product.php:4524
590
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4329
ORDER BY f.position ASC
0.548 ms 5 Yes /classes/Product.php:6021
2784
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 9095
ORDER BY f.position ASC
0.548 ms 5 Yes /classes/Product.php:6021
2861
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 9102
ORDER BY f.position ASC
0.548 ms 5 Yes /classes/Product.php:6021
761
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2548)
0.548 ms 1 /classes/Product.php:3860
2538
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 9069 AND id_shop=1 LIMIT 1
0.547 ms 1 /classes/Product.php:6876
4160
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4327) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.547 ms 1 Yes Yes /classes/Product.php:4524
850
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3554 AND id_shop=1 LIMIT 1
0.546 ms 1 /classes/Product.php:6876
2045
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 5159 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 5159 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.546 ms 0 /classes/Cart.php:1430
2450
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 9057) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.546 ms 1 /classes/stock/StockAvailable.php:453
2246
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 6157) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.545 ms 1 /classes/stock/StockAvailable.php:453
2867
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 9103)
0.544 ms 1 /classes/Product.php:3860
2914
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 9107) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.544 ms 1 /classes/stock/StockAvailable.php:453
4356
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (9096) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.544 ms 1 Yes Yes /classes/Product.php:4524
1031
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4069
ORDER BY f.position ASC
0.544 ms 5 Yes /classes/Product.php:6021
1306
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2916 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2916 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.543 ms 0 /classes/Cart.php:1430
151
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4224
AND image_shop.`cover` = 1 LIMIT 1
0.542 ms 1 /classes/Product.php:3570
1428
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4062
ORDER BY f.position ASC
0.542 ms 5 Yes /classes/Product.php:6021
1862
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 5047 LIMIT 1
0.542 ms 10 /classes/SpecificPrice.php:435
2014
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 5081
AND image_shop.`cover` = 1 LIMIT 1
0.542 ms 1 /classes/Product.php:3570
3767
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 9072
ORDER BY `position`
0.542 ms 1 Yes /classes/Product.php:3545
736
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2546 LIMIT 1
0.541 ms 10 /classes/SpecificPrice.php:435
744
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2546
ORDER BY f.position ASC
0.541 ms 5 Yes /classes/Product.php:6021
2316
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 7952
ORDER BY f.position ASC
0.541 ms 5 Yes /classes/Product.php:6021
2684
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 9084 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 9084 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.541 ms 0 /classes/Cart.php:1430
2850
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 9101
ORDER BY f.position ASC
0.541 ms 5 Yes /classes/Product.php:6021
3196
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4269) AND (b.`id_shop` = 1) LIMIT 1
0.541 ms 1 /src/Adapter/EntityMapper.php:71
4122
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4280) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.541 ms 1 Yes Yes /classes/Product.php:4524
436
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3183
ORDER BY f.position ASC
0.540 ms 5 Yes /classes/Product.php:6021
591
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4328
AND image_shop.`cover` = 1 LIMIT 1
0.540 ms 1 /classes/Product.php:3570
316
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4276
AND image_shop.`cover` = 1 LIMIT 1
0.539 ms 1 /classes/Product.php:3570
1074
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3041 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3041 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.539 ms 0 /classes/Cart.php:1430
2938
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 9144
ORDER BY f.position ASC
0.539 ms 5 Yes /classes/Product.php:6021
2995
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 10424
ORDER BY f.position ASC
0.539 ms 5 Yes /classes/Product.php:6021
0
SELECT SQL_NO_CACHE s.id_shop, CONCAT(su.physical_uri, su.virtual_uri) AS uri, su.domain, su.main
FROM hgt78_shop_url su
LEFT JOIN hgt78_shop s ON (s.id_shop = su.id_shop)
WHERE (su.domain = 'www.encens.fr' OR su.domain_ssl = 'www.encens.fr')
AND s.active = 1
AND s.deleted = 0
ORDER BY LENGTH(CONCAT(su.physical_uri, su.virtual_uri)) DESC
0.539 ms 1 Yes /classes/shop/Shop.php:1364
1080
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2845 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.538 ms 10 Yes /classes/SpecificPrice.php:576
1235
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2524 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.538 ms 10 Yes /classes/SpecificPrice.php:576
629
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4324)
0.538 ms 1 /classes/Product.php:3860
701
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2542
AND image_shop.`cover` = 1 LIMIT 1
0.538 ms 2 /classes/Product.php:3570
2073
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 5308 LIMIT 1
0.538 ms 10 /classes/SpecificPrice.php:435
439
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4274 LIMIT 1
0.537 ms 10 /classes/SpecificPrice.php:435
1583
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4196
ORDER BY f.position ASC
0.537 ms 5 Yes /classes/Product.php:6021
2327
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 7954
ORDER BY f.position ASC
0.537 ms 5 Yes /classes/Product.php:6021
2350
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 7958
ORDER BY f.position ASC
0.536 ms 5 Yes /classes/Product.php:6021
806
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2538 AND id_shop=1 LIMIT 1
0.536 ms 1 /classes/Product.php:6876
909
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4214
ORDER BY f.position ASC
0.536 ms 5 Yes /classes/Product.php:6021
1759
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 5037 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 5037 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.536 ms 0 /classes/Cart.php:1430
3481
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4141) AND (b.`id_shop` = 1) LIMIT 1
0.536 ms 1 /src/Adapter/EntityMapper.php:71
3901
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 10926) AND (b.`id_shop` = 1) LIMIT 1
0.536 ms 1 /src/Adapter/EntityMapper.php:71
4118
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4224) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.536 ms 1 Yes Yes /classes/Product.php:4524
1136
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4080 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.535 ms 10 Yes /classes/SpecificPrice.php:576
1296
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2558
ORDER BY f.position ASC
0.535 ms 5 Yes /classes/Product.php:6021
238
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4310
ORDER BY f.position ASC
0.534 ms 5 Yes /classes/Product.php:6021
2204
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 6153
ORDER BY f.position ASC
0.534 ms 5 Yes /classes/Product.php:6021
2913
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 9107 AND `id_group` = 1 LIMIT 1
0.534 ms 0 /classes/GroupReduction.php:156
3760
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 9070) AND (b.`id_shop` = 1) LIMIT 1
0.534 ms 1 /src/Adapter/EntityMapper.php:71
2890
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 9105 AND id_shop=1 LIMIT 1
0.533 ms 1 /classes/Product.php:6876
981
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4105 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.533 ms 10 Yes /classes/SpecificPrice.php:576
936
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 4114 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.532 ms 10 Yes /classes/SpecificPrice.php:576
1925
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 5052
ORDER BY f.position ASC
0.532 ms 5 Yes /classes/Product.php:6021
1898
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 5050)
0.531 ms 1 /classes/Product.php:3860
3272
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4281
ORDER BY `position`
0.531 ms 1 Yes /classes/Product.php:3545
585
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4329)
0.530 ms 1 /classes/Product.php:3860
1180
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2476 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.530 ms 12 Yes /classes/SpecificPrice.php:576
2041
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 5159)
0.530 ms 1 /classes/Product.php:3860
3878
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 10423
ORDER BY `position`
0.530 ms 1 Yes /classes/Product.php:3545
2832
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 9100
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.529 ms 0 /classes/SpecificPrice.php:259
132
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 12682
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.528 ms 1 /classes/SpecificPrice.php:259
227
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4309
ORDER BY f.position ASC
0.528 ms 5 Yes /classes/Product.php:6021
4119
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4286) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.528 ms 1 Yes Yes /classes/Product.php:4524
567
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2533 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2533 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.527 ms 0 /classes/Cart.php:1430
678
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2536
ORDER BY f.position ASC
0.527 ms 5 Yes /classes/Product.php:6021
2592
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 9074)
0.526 ms 1 /classes/Product.php:3860
3063
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 10891
ORDER BY f.position ASC
0.526 ms 5 Yes /classes/Product.php:6021
3074
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 10926
ORDER BY f.position ASC
0.525 ms 5 Yes /classes/Product.php:6021
372
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.524 ms 1 /classes/Product.php:5659
544
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2531) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.524 ms 1 /classes/stock/StockAvailable.php:453
3721
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 8978) AND (b.`id_shop` = 1) LIMIT 1
0.524 ms 1 /src/Adapter/EntityMapper.php:71
1879
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 5048) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.523 ms 1 /classes/stock/StockAvailable.php:453
2081
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 5308
ORDER BY f.position ASC
0.523 ms 5 Yes /classes/Product.php:6021
321
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4276)
0.522 ms 1 /classes/Product.php:3860
3284
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2552
ORDER BY `position`
0.522 ms 1 Yes /classes/Product.php:3545
3509
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4303
ORDER BY `position`
0.522 ms 1 Yes /classes/Product.php:3545
3517
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4304) AND (b.`id_shop` = 1) LIMIT 1
0.521 ms 1 /src/Adapter/EntityMapper.php:71
2817
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 9098
ORDER BY f.position ASC
0.520 ms 5 Yes /classes/Product.php:6021
3745
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 9062) AND (b.`id_shop` = 1) LIMIT 1
0.520 ms 1 /src/Adapter/EntityMapper.php:71
4152
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2529) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.520 ms 1 Yes Yes /classes/Product.php:4524
2305
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 6664
ORDER BY f.position ASC
0.519 ms 5 Yes /classes/Product.php:6021
205
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4280
ORDER BY f.position ASC
0.518 ms 5 Yes /classes/Product.php:6021
2508
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 9067
AND image_shop.`cover` = 1 LIMIT 1
0.518 ms 1 /classes/Product.php:3570
4297
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (5470) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.518 ms 1 Yes Yes /classes/Product.php:4524
4344
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (9081) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.518 ms 1 Yes Yes /classes/Product.php:4524
370
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4260
ORDER BY f.position ASC
0.517 ms 5 Yes /classes/Product.php:6021
3104
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 12682
ORDER BY `position`
0.516 ms 2 Yes /classes/Product.php:3545
2607
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 9075 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 9075 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.516 ms 0 /classes/Cart.php:1430
167
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4286)
0.515 ms 1 /classes/Product.php:3860
2259
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 6158
ORDER BY f.position ASC
0.514 ms 5 Yes /classes/Product.php:6021
2281
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 6198
ORDER BY f.position ASC
0.514 ms 5 Yes /classes/Product.php:6021
3667
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 6153) AND (b.`id_shop` = 1) LIMIT 1
0.514 ms 1 /src/Adapter/EntityMapper.php:71
706
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2542)
0.513 ms 1 /classes/Product.php:3860
1229
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2474 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2474 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.513 ms 0 /classes/Cart.php:1430
4253
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4304) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.513 ms 1 Yes Yes /classes/Product.php:4524
1120
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2844
ORDER BY f.position ASC
0.512 ms 5 Yes /classes/Product.php:6021
1473
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4130
ORDER BY f.position ASC
0.512 ms 5 Yes /classes/Product.php:6021
2453
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 9058
AND image_shop.`cover` = 1 LIMIT 1
0.512 ms 1 /classes/Product.php:3570
4367
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (9107) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.512 ms 1 Yes Yes /classes/Product.php:4524
413
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4266 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4266 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.512 ms 0 /classes/Cart.php:1430
624
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4324
AND image_shop.`cover` = 1 LIMIT 1
0.512 ms 1 /classes/Product.php:3570
516
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2528 LIMIT 1
0.511 ms 10 /classes/SpecificPrice.php:435
662
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4321)
0.511 ms 1 /classes/Product.php:3860
3085
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 10928
ORDER BY f.position ASC
0.511 ms 5 Yes /classes/Product.php:6021
3755
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 9068
ORDER BY `position`
0.511 ms 1 Yes /classes/Product.php:3545
4325
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (9057) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.511 ms 1 Yes Yes /classes/Product.php:4524
4351
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (9091) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.511 ms 1 Yes Yes /classes/Product.php:4524
1405
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4060 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4060 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.510 ms 0 /classes/Cart.php:1430
1804
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 5041
ORDER BY f.position ASC
0.510 ms 5 Yes /classes/Product.php:6021
2548
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 9070)
0.510 ms 1 /classes/Product.php:3860
3266
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2545
ORDER BY `position`
0.510 ms 1 Yes /classes/Product.php:3545
335
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4264) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.509 ms 1 /classes/stock/StockAvailable.php:453
1218
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2516 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2516 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.509 ms 0 /classes/Cart.php:1430
2634
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 9078
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.509 ms 0 /classes/SpecificPrice.php:259
3790
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 9081) AND (b.`id_shop` = 1) LIMIT 1
0.509 ms 1 /src/Adapter/EntityMapper.php:71
4331
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (9067) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.509 ms 1 Yes Yes /classes/Product.php:4524
105
SELECT SQL_NO_CACHE tr.*
FROM `hgt78_tax_rule` tr
JOIN `hgt78_tax_rules_group` trg ON (tr.`id_tax_rules_group` = trg.`id_tax_rules_group`)
WHERE trg.`active` = 1
AND tr.`id_country` = 8
AND tr.`id_tax_rules_group` = 28
AND tr.`id_state` IN (0, 0)
AND ('04510' BETWEEN tr.`zipcode_from` AND tr.`zipcode_to`
OR (tr.`zipcode_to` = 0 AND tr.`zipcode_from` IN(0, '04510')))
ORDER BY tr.`zipcode_from` DESC, tr.`zipcode_to` DESC, tr.`id_state` DESC, tr.`id_country` DESC
0.507 ms 1 /classes/tax/TaxRulesTaxManager.php:109
1323
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 2430 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.507 ms 10 Yes /classes/SpecificPrice.php:576
1528
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4146
ORDER BY f.position ASC
0.507 ms 5 Yes /classes/Product.php:6021
2105
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 5331
ORDER BY f.position ASC
0.507 ms 5 Yes /classes/Product.php:6021
941
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4114 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4114 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.507 ms 0 /classes/Cart.php:1430
4256
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4573) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.506 ms 1 Yes Yes /classes/Product.php:4524
447
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4274
ORDER BY f.position ASC
0.506 ms 5 Yes /classes/Product.php:6021
1660
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4227
ORDER BY f.position ASC
0.506 ms 5 Yes /classes/Product.php:6021
1863
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 5047
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.506 ms 0 /classes/SpecificPrice.php:259
3146
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4313
ORDER BY `position`
0.506 ms 1 Yes /classes/Product.php:3545
1047
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 8, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `hgt78_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 8) AND
`id_group` IN (0, 1) AND `id_product` = 3184 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-05-01 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.505 ms 10 Yes /classes/SpecificPrice.php:576
1727
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4696
ORDER BY f.position ASC
0.505 ms 5 Yes /classes/Product.php:6021
2207
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 6154 LIMIT 1
0.505 ms 11 /classes/SpecificPrice.php:435
3863
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 9108
ORDER BY `position`
0.505 ms 1 Yes /classes/Product.php:3545
2759
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 9093 AND `id_group` = 1 LIMIT 1
0.504 ms 0 /classes/GroupReduction.php:156
194
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4282
ORDER BY f.position ASC
0.504 ms 5 Yes /classes/Product.php:6021
282
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4314
ORDER BY f.position ASC
0.503 ms 5 Yes /classes/Product.php:6021
602
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2493
AND image_shop.`cover` = 1 LIMIT 1
0.503 ms 1 /classes/Product.php:3570
4276
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (5050) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.503 ms 1 Yes Yes /classes/Product.php:4524
3815
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 9092
ORDER BY `position`
0.503 ms 1 Yes /classes/Product.php:3545
684
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2537)
0.502 ms 1 /classes/Product.php:3860
315
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4277
ORDER BY f.position ASC
0.502 ms 5 Yes /classes/Product.php:6021
2240
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 6157 LIMIT 1
0.502 ms 11 /classes/SpecificPrice.php:435
2962
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 9266
ORDER BY f.position ASC
0.501 ms 5 Yes /classes/Product.php:6021
1738
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 5033
ORDER BY f.position ASC
0.501 ms 5 Yes /classes/Product.php:6021
3308
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2941
ORDER BY `position`
0.501 ms 1 Yes /classes/Product.php:3545
3818
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 9093
ORDER BY `position`
0.501 ms 1 Yes /classes/Product.php:3545
2193
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 6152
ORDER BY f.position ASC
0.500 ms 5 Yes /classes/Product.php:6021
183
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4285
ORDER BY f.position ASC
0.500 ms 5 Yes /classes/Product.php:6021
2239
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.500 ms 1 /classes/Product.php:5659
2652
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 9079
ORDER BY f.position ASC
0.500 ms 5 Yes /classes/Product.php:6021
3773
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 9074
ORDER BY `position`
0.500 ms 1 Yes /classes/Product.php:3545
3877
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 10423) AND (b.`id_shop` = 1) LIMIT 1
0.500 ms 1 /src/Adapter/EntityMapper.php:71
126
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2553
ORDER BY f.position ASC
0.499 ms 5 Yes /classes/Product.php:6021
478
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4269) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.499 ms 1 /classes/stock/StockAvailable.php:453
1328
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2430 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2430 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.499 ms 0 /classes/Cart.php:1430
1829
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 5044 LIMIT 1
0.499 ms 10 /classes/SpecificPrice.php:435
2436
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 8986)
0.499 ms 1 /classes/Product.php:3860
589
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4329 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4329 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.498 ms 0 /classes/Cart.php:1430
3326
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4113
ORDER BY `position`
0.498 ms 1 Yes /classes/Product.php:3545
4136
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4262) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.498 ms 1 Yes Yes /classes/Product.php:4524
3872
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 9266
ORDER BY `position`
0.498 ms 1 Yes /classes/Product.php:3545
1956
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 5055) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.497 ms 1 /classes/stock/StockAvailable.php:453
2470
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 9059 AND id_shop=1 LIMIT 1
0.497 ms 1 /classes/Product.php:6876
17
SELECT SQL_NO_CACHE m.`id_module`, m.`name`, ms.`id_module`as `mshop`
FROM `hgt78_module` m
LEFT JOIN `hgt78_module_shop` ms
ON m.`id_module` = ms.`id_module`
AND ms.`id_shop` = 1
0.496 ms 118 /classes/module/Module.php:346
3260
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2542
ORDER BY `position`
0.496 ms 2 Yes /classes/Product.php:3545
3506
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4207
ORDER BY `position`
0.496 ms 1 Yes /classes/Product.php:3545
1053
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3184
ORDER BY f.position ASC
0.495 ms 5 Yes /classes/Product.php:6021
1440
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4064
ORDER BY f.position ASC
0.494 ms 5 Yes /classes/Product.php:6021
1517
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4141
ORDER BY f.position ASC
0.494 ms 5 Yes /classes/Product.php:6021
2597
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 9074
ORDER BY f.position ASC
0.494 ms 5 Yes /classes/Product.php:6021
3739
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 9059) AND (b.`id_shop` = 1) LIMIT 1
0.494 ms 1 /src/Adapter/EntityMapper.php:71
4246
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4195) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.494 ms 1 Yes Yes /classes/Product.php:4524
271
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4315
ORDER BY f.position ASC
0.494 ms 5 Yes /classes/Product.php:6021
114
SELECT SQL_NO_CACHE tr.*
FROM `hgt78_tax_rule` tr
JOIN `hgt78_tax_rules_group` trg ON (tr.`id_tax_rules_group` = trg.`id_tax_rules_group`)
WHERE trg.`active` = 1
AND tr.`id_country` = 8
AND tr.`id_tax_rules_group` = 28
AND tr.`id_state` IN (0, 0)
AND ('0' BETWEEN tr.`zipcode_from` AND tr.`zipcode_to`
OR (tr.`zipcode_to` = 0 AND tr.`zipcode_from` IN(0, '0')))
ORDER BY tr.`zipcode_from` DESC, tr.`zipcode_to` DESC, tr.`id_state` DESC, tr.`id_country` DESC
0.493 ms 1 /classes/tax/TaxRulesTaxManager.php:109
2167
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 6044 AND id_shop=1 LIMIT 1
0.493 ms 1 /classes/Product.php:6876
3097
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 10999
ORDER BY f.position ASC
0.493 ms 5 Yes /classes/Product.php:6021
1416
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4061 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4061 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.493 ms 0 /classes/Cart.php:1430
2795
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 9096
ORDER BY f.position ASC
0.492 ms 5 Yes /classes/Product.php:6021
3356
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3042
ORDER BY `position`
0.492 ms 1 Yes /classes/Product.php:3545
249
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2554
ORDER BY f.position ASC
0.491 ms 5 Yes /classes/Product.php:6021
1185
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2476 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2476 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.491 ms 0 /classes/Cart.php:1430
2395
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2491
ORDER BY f.position ASC
0.491 ms 5 Yes /classes/Product.php:6021
3239
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4324
ORDER BY `position`
0.490 ms 1 Yes /classes/Product.php:3545
527
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2529 LIMIT 1
0.490 ms 10 /classes/SpecificPrice.php:435
690
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2543
AND image_shop.`cover` = 1 LIMIT 1
0.490 ms 2 /classes/Product.php:3570
2051
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 5173
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.490 ms 0 /classes/SpecificPrice.php:259
3311
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4216
ORDER BY `position`
0.490 ms 1 Yes /classes/Product.php:3545
3412
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2526) AND (b.`id_shop` = 1) LIMIT 1
0.490 ms 1 /src/Adapter/EntityMapper.php:71
1340
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3056
ORDER BY f.position ASC
0.489 ms 5 Yes /classes/Product.php:6021
665
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4321) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.489 ms 1 /classes/stock/StockAvailable.php:453
974
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4111 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4111 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.489 ms 0 /classes/Cart.php:1430
2649
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 9079 AND `id_group` = 1 LIMIT 1
0.489 ms 0 /classes/GroupReduction.php:156
3574
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 5046) AND (b.`id_shop` = 1) LIMIT 1
0.489 ms 1 /src/Adapter/EntityMapper.php:71
1361
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4044 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4044 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.488 ms 0 /classes/Cart.php:1430
2608
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 9075
ORDER BY f.position ASC
0.488 ms 5 Yes /classes/Product.php:6021
3332
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4111
ORDER BY `position`
0.488 ms 1 Yes /classes/Product.php:3545
3341
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4106
ORDER BY `position`
0.488 ms 1 Yes /classes/Product.php:3545
3365
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2608
ORDER BY `position`
0.488 ms 1 Yes /classes/Product.php:3545
3252
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2536
0.487 ms 1 /classes/Product.php:2902
329
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4264 LIMIT 1
0.487 ms 10 /classes/SpecificPrice.php:435
2887
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 9105
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.487 ms 0 /classes/SpecificPrice.php:259
844
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3554
AND image_shop.`cover` = 1 LIMIT 1
0.486 ms 1 /classes/Product.php:3570
1737
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 5033 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 5033 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.486 ms 0 /classes/Cart.php:1430
291
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4313) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.486 ms 1 /classes/stock/StockAvailable.php:453
2493
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 9062 AND `id_group` = 1 LIMIT 1
0.486 ms 0 /classes/GroupReduction.php:156
3119
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4282
ORDER BY `position`
0.486 ms 1 Yes /classes/Product.php:3545
3580
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 5048) AND (b.`id_shop` = 1) LIMIT 1
0.486 ms 1 /src/Adapter/EntityMapper.php:71
4155
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2533) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.486 ms 1 Yes Yes /classes/Product.php:4524
2856
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 9102)
0.485 ms 1 /classes/Product.php:3860
3418
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2597) AND (b.`id_shop` = 1) LIMIT 1
0.485 ms 1 /src/Adapter/EntityMapper.php:71
764
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2548) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.485 ms 1 /classes/stock/StockAvailable.php:453
1284
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2597 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2597 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.485 ms 0 /classes/Cart.php:1430
2210
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 6154)
0.485 ms 1 /classes/Product.php:3860
216
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4279
ORDER BY f.position ASC
0.484 ms 5 Yes /classes/Product.php:6021
1953
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 5055)
0.484 ms 1 /classes/Product.php:3860
3476
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4148
ORDER BY `position`
0.484 ms 1 Yes /classes/Product.php:3545
3631
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 5174) AND (b.`id_shop` = 1) LIMIT 1
0.484 ms 1 /src/Adapter/EntityMapper.php:71
803
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2538
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.483 ms 0 /classes/SpecificPrice.php:259
2270
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 6159
ORDER BY f.position ASC
0.483 ms 5 Yes /classes/Product.php:6021
2924
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 9108 AND `id_group` = 1 LIMIT 1
0.483 ms 0 /classes/GroupReduction.php:156
3110
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4224
ORDER BY `position`
0.483 ms 1 Yes /classes/Product.php:3545
3565
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 5043) AND (b.`id_shop` = 1) LIMIT 1
0.483 ms 1 /src/Adapter/EntityMapper.php:71
3697
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 7952) AND (b.`id_shop` = 1) LIMIT 1
0.483 ms 1 /src/Adapter/EntityMapper.php:71
2243
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 6157)
0.482 ms 1 /classes/Product.php:3860
3278
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2549
ORDER BY `position`
0.482 ms 1 Yes /classes/Product.php:3545
3640
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 5331) AND (b.`id_shop` = 1) LIMIT 1
0.482 ms 1 /src/Adapter/EntityMapper.php:71
3524
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4572
ORDER BY `position`
0.482 ms 1 Yes /classes/Product.php:3545
4288
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (5158) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.482 ms 1 Yes Yes /classes/Product.php:4524
313
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4277) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.481 ms 1 /classes/stock/StockAvailable.php:453
1203
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2517)
0.481 ms 1 /classes/Product.php:3860
3560
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5041
ORDER BY `position`
0.481 ms 2 Yes /classes/Product.php:3545
3319
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4213) AND (b.`id_shop` = 1) LIMIT 1
0.480 ms 1 /src/Adapter/EntityMapper.php:71
3508
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4303) AND (b.`id_shop` = 1) LIMIT 1
0.480 ms 1 /src/Adapter/EntityMapper.php:71
777
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2549
ORDER BY f.position ASC
0.480 ms 5 Yes /classes/Product.php:6021
1848
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 5045
ORDER BY f.position ASC
0.480 ms 5 Yes /classes/Product.php:6021
2452
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 9057
ORDER BY f.position ASC
0.480 ms 5 Yes /classes/Product.php:6021
482
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.479 ms 1 /classes/Product.php:5659
293
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4313
ORDER BY f.position ASC
0.479 ms 5 Yes /classes/Product.php:6021
2556
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 9071 LIMIT 1
0.479 ms 17 /classes/SpecificPrice.php:435
3191
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4271
ORDER BY `position`
0.479 ms 1 Yes /classes/Product.php:3545
3329
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4112
ORDER BY `position`
0.479 ms 1 Yes /classes/Product.php:3545
769
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2549 LIMIT 1
0.478 ms 10 /classes/SpecificPrice.php:435
883
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2941 AND id_shop=1 LIMIT 1
0.478 ms 1 /classes/Product.php:6876
1550
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4144
ORDER BY f.position ASC
0.478 ms 5 Yes /classes/Product.php:6021
1561
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4183
ORDER BY f.position ASC
0.478 ms 5 Yes /classes/Product.php:6021
2587
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 9074
AND image_shop.`cover` = 1 LIMIT 1
0.478 ms 1 /classes/Product.php:3570
3536
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4697
ORDER BY `position`
0.478 ms 1 Yes /classes/Product.php:3545
3590
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5051
ORDER BY `position`
0.478 ms 2 Yes /classes/Product.php:3545
1571
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4195 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4195 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.477 ms 0 /classes/Cart.php:1430
4295
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (5332) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.477 ms 1 Yes Yes /classes/Product.php:4524
1616
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4303
ORDER BY f.position ASC
0.477 ms 5 Yes /classes/Product.php:6021
3942
SELECT SQL_NO_CACHE c.id_cms, cl.link_rewrite, cl.meta_title
FROM hgt78_cms c
LEFT JOIN hgt78_cms_lang cl ON (c.id_cms = cl.id_cms AND cl.id_lang = 1 AND cl.id_shop = 1)
INNER JOIN hgt78_cms_shop cms_shop
ON (cms_shop.id_cms = c.id_cms AND cms_shop.id_shop = 1)
WHERE 1
AND c.id_cms IN (17) AND c.`active` = 1 GROUP BY c.id_cms
ORDER BY c.`position`
0.477 ms 1 Yes /classes/CMS.php:151
3263
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2541
ORDER BY `position`
0.476 ms 1 Yes /classes/Product.php:3545
3812
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 9091
ORDER BY `position`
0.476 ms 1 Yes /classes/Product.php:3545
2293
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 6435
ORDER BY f.position ASC
0.476 ms 5 Yes /classes/Product.php:6021
3338
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4109
ORDER BY `position`
0.476 ms 1 Yes /classes/Product.php:3545
827
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2540)
0.475 ms 1 /classes/Product.php:3860
3469
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4130) AND (b.`id_shop` = 1) LIMIT 1
0.475 ms 1 /src/Adapter/EntityMapper.php:71
799
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2552
ORDER BY f.position ASC
0.475 ms 5 Yes /classes/Product.php:6021
1009
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4106
ORDER BY f.position ASC
0.475 ms 5 Yes /classes/Product.php:6021
3298
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3554) AND (b.`id_shop` = 1) LIMIT 1
0.475 ms 1 /src/Adapter/EntityMapper.php:71
82
SELECT SQL_NO_CACHE type, id_value, filter_show_limit, filter_type FROM hgt78_layered_category
WHERE controller = 'category'
AND id_category = 2
AND id_shop = 1
GROUP BY `type`, id_value ORDER BY position ASC
0.474 ms 12 Yes Yes /modules/ps_facetedsearch/src/Filters/Provider.php:61
1716
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4697
ORDER BY f.position ASC
0.474 ms 5 Yes /classes/Product.php:6021
2418
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 8984 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 8984 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.474 ms 0 /classes/Cart.php:1430
2506
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 9063 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 9063 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.474 ms 0 /classes/Cart.php:1430
3275
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2548
ORDER BY `position`
0.474 ms 1 Yes /classes/Product.php:3545
3649
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 5470) AND (b.`id_shop` = 1) LIMIT 1
0.474 ms 1 /src/Adapter/EntityMapper.php:71
2013
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 5078
ORDER BY f.position ASC
0.473 ms 5 Yes /classes/Product.php:6021
2361
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 7959
ORDER BY f.position ASC
0.473 ms 5 Yes /classes/Product.php:6021
3173
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4248
ORDER BY `position`
0.473 ms 1 Yes /classes/Product.php:3545
3368
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2606
ORDER BY `position`
0.473 ms 1 Yes /classes/Product.php:3545
3764
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 9071
ORDER BY `position`
0.473 ms 1 Yes /classes/Product.php:3545
1462
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4129
ORDER BY f.position ASC
0.473 ms 5 Yes /classes/Product.php:6021
4293
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (5322) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.473 ms 1 Yes Yes /classes/Product.php:4524
2638
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 9078 AND `id_group` = 1 LIMIT 1
0.472 ms 0 /classes/GroupReduction.php:156
3185
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3183
ORDER BY `position`
0.472 ms 1 Yes /classes/Product.php:3545
3382
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2523) AND (b.`id_shop` = 1) LIMIT 1
0.472 ms 1 /src/Adapter/EntityMapper.php:71
4247
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4196) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.472 ms 1 Yes Yes /classes/Product.php:4524
1208
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2517
ORDER BY f.position ASC
0.472 ms 5 Yes /classes/Product.php:6021
3434
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3056
ORDER BY `position`
0.472 ms 1 Yes /classes/Product.php:3545
3520
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4227) AND (b.`id_shop` = 1) LIMIT 1
0.472 ms 1 /src/Adapter/EntityMapper.php:71
3730
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 8986) AND (b.`id_shop` = 1) LIMIT 1
0.472 ms 1 /src/Adapter/EntityMapper.php:71
838
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2544)
0.471 ms 1 /classes/Product.php:3860
4274
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (5048) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.471 ms 1 Yes Yes /classes/Product.php:4524
83
SELECT SQL_NO_CACHE c.*, cl.*
FROM `hgt78_category` c
LEFT JOIN `hgt78_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 )
WHERE `name` = 'Coffret'
AND c.`id_category` != 2
AND c.`id_parent` = 2 LIMIT 1
0.471 ms 7 /classes/Category.php:1500
3137
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4317
ORDER BY `position`
0.471 ms 1 Yes /classes/Product.php:3545
3596
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5053
ORDER BY `position`
0.471 ms 2 Yes /classes/Product.php:3545
1164
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2522
ORDER BY f.position ASC
0.470 ms 5 Yes /classes/Product.php:6021
1119
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2844 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2844 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.470 ms 0 /classes/Cart.php:1430
2588
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 229 LIMIT 1
0.470 ms 1 /classes/Product.php:5659
2818
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 9099
AND image_shop.`cover` = 1 LIMIT 1
0.470 ms 1 /classes/Product.php:3570
3556
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 5040) AND (b.`id_shop` = 1) LIMIT 1
0.470 ms 1 /src/Adapter/EntityMapper.php:71
1020
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4116
ORDER BY f.position ASC
0.469 ms 5 Yes /classes/Product.php:6021
2338
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 7957
ORDER BY f.position ASC
0.469 ms 5 Yes /classes/Product.php:6021
1174
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2518 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2518 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.469 ms 0 /classes/Cart.php:1430
3694
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 6664) AND (b.`id_shop` = 1) LIMIT 1
0.469 ms 1 /src/Adapter/EntityMapper.php:71
3727
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 8985) AND (b.`id_shop` = 1) LIMIT 1
0.469 ms 1 /src/Adapter/EntityMapper.php:71
378
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4259 AND `id_group` = 1 LIMIT 1
0.468 ms 0 /classes/GroupReduction.php:156
3386
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2522
ORDER BY `position`
0.468 ms 1 Yes /classes/Product.php:3545
3809
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 9090
ORDER BY `position`
0.468 ms 1 Yes /classes/Product.php:3545
84
SELECT SQL_NO_CACHE c.*, cl.*
FROM `hgt78_category` c
LEFT JOIN `hgt78_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 )
WHERE `name` = 'Esotérisme'
AND c.`id_category` != 2
AND c.`id_parent` = 2 LIMIT 1
0.467 ms 7 /classes/Category.php:1500
1350
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4043 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4043 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.467 ms 0 /classes/Cart.php:1430
3349
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4074) AND (b.`id_shop` = 1) LIMIT 1
0.467 ms 1 /src/Adapter/EntityMapper.php:71
1297
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2916
AND image_shop.`cover` = 1 LIMIT 1
0.467 ms 1 /classes/Product.php:3570
4300
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (6044) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.467 ms 1 Yes Yes /classes/Product.php:4524
1872
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.466 ms 1 /classes/Product.php:5659
3198
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4269
0.466 ms 1 /classes/Product.php:2902
3295
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2544) AND (b.`id_shop` = 1) LIMIT 1
0.466 ms 1 /src/Adapter/EntityMapper.php:71
930
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4213 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4213 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.466 ms 0 /classes/Cart.php:1430
4213
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2517) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.466 ms 1 Yes Yes /classes/Product.php:4524
1252
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2525
ORDER BY f.position ASC
0.465 ms 5 Yes /classes/Product.php:6021
260
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4317
ORDER BY f.position ASC
0.465 ms 5 Yes /classes/Product.php:6021
1159
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2522)
0.465 ms 1 /classes/Product.php:3860
1241
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2524
ORDER BY f.position ASC
0.465 ms 5 Yes /classes/Product.php:6021
1274
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2599
ORDER BY f.position ASC
0.465 ms 5 Yes /classes/Product.php:6021
3530
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4576
ORDER BY `position`
0.465 ms 1 Yes /classes/Product.php:3545
3544
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 5036) AND (b.`id_shop` = 1) LIMIT 1
0.465 ms 1 /src/Adapter/EntityMapper.php:71
3637
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 5322) AND (b.`id_shop` = 1) LIMIT 1
0.465 ms 1 /src/Adapter/EntityMapper.php:71
4254
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4227) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.465 ms 1 Yes Yes /classes/Product.php:4524
953
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4113
ORDER BY f.position ASC
0.464 ms 5 Yes /classes/Product.php:6021
2125
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 5334) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.464 ms 1 /classes/stock/StockAvailable.php:453
2459
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 9058 AND id_shop=1 LIMIT 1
0.464 ms 1 /classes/Product.php:6876
2965
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 9733 LIMIT 1
0.464 ms 11 /classes/SpecificPrice.php:435
423
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4275) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.463 ms 1 /classes/stock/StockAvailable.php:453
2053
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 5173)
0.463 ms 1 /classes/Product.php:3860
3122
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4280
ORDER BY `position`
0.463 ms 1 Yes /classes/Product.php:3545
173
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4285
AND image_shop.`cover` = 1 LIMIT 1
0.462 ms 1 /classes/Product.php:3570
1694
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4576
ORDER BY f.position ASC
0.462 ms 5 Yes /classes/Product.php:6021
3353
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3184
ORDER BY `position`
0.462 ms 1 Yes /classes/Product.php:3545
3395
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2487
ORDER BY `position`
0.462 ms 1 Yes /classes/Product.php:3545
3548
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5037
ORDER BY `position`
0.462 ms 2 Yes /classes/Product.php:3545
3608
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5057
ORDER BY `position`
0.462 ms 2 Yes /classes/Product.php:3545
739
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2546)
0.462 ms 1 /classes/Product.php:3860
963
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4112 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4112 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.462 ms 0 /classes/Cart.php:1430
3742
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 9061) AND (b.`id_shop` = 1) LIMIT 1
0.462 ms 1 /src/Adapter/EntityMapper.php:71
506
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4318
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.461 ms 0 /classes/SpecificPrice.php:259
1495
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4148
ORDER BY f.position ASC
0.461 ms 5 Yes /classes/Product.php:6021
3568
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 5044) AND (b.`id_shop` = 1) LIMIT 1
0.461 ms 1 /src/Adapter/EntityMapper.php:71
4140
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4212) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.461 ms 1 Yes Yes /classes/Product.php:4524
3221
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2533
ORDER BY `position`
0.461 ms 1 Yes /classes/Product.php:3545
3467
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4129
ORDER BY `position`
0.461 ms 1 Yes /classes/Product.php:3545
3604
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 5056) AND (b.`id_shop` = 1) LIMIT 1
0.460 ms 1 /src/Adapter/EntityMapper.php:71
1451
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4090
ORDER BY f.position ASC
0.460 ms 5 Yes /classes/Product.php:6021
3437
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4043
ORDER BY `position`
0.459 ms 1 Yes /classes/Product.php:3545
3452
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4060
ORDER BY `position`
0.459 ms 1 Yes /classes/Product.php:3545
3479
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4140
ORDER BY `position`
0.459 ms 1 Yes /classes/Product.php:3545
3502
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4206) AND (b.`id_shop` = 1) LIMIT 1
0.459 ms 1 /src/Adapter/EntityMapper.php:71
3679
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 6157) AND (b.`id_shop` = 1) LIMIT 1
0.459 ms 1 /src/Adapter/EntityMapper.php:71
3703
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 7957) AND (b.`id_shop` = 1) LIMIT 1
0.459 ms 1 /src/Adapter/EntityMapper.php:71
3899
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 10891
ORDER BY `position`
0.459 ms 1 Yes /classes/Product.php:3545
4244
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4144) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.459 ms 1 Yes Yes /classes/Product.php:4524
4303
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (6153) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.459 ms 1 Yes Yes /classes/Product.php:4524
363
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4260
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.458 ms 0 /classes/SpecificPrice.php:259
921
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4213
AND image_shop.`cover` = 1 LIMIT 1
0.458 ms 1 /classes/Product.php:3570
1152
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2523 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2523 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.458 ms 0 /classes/Cart.php:1430
2567
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 9072 LIMIT 1
0.457 ms 13 /classes/SpecificPrice.php:435
3143
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4314
ORDER BY `position`
0.457 ms 1 Yes /classes/Product.php:3545
3757
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 9069) AND (b.`id_shop` = 1) LIMIT 1
0.457 ms 1 /src/Adapter/EntityMapper.php:71
3166
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4260) AND (b.`id_shop` = 1) LIMIT 1
0.456 ms 1 /src/Adapter/EntityMapper.php:71
3421
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2558) AND (b.`id_shop` = 1) LIMIT 1
0.456 ms 1 /src/Adapter/EntityMapper.php:71
3428
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2801
ORDER BY `position`
0.456 ms 1 Yes /classes/Product.php:3545
1904
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 5051
AND image_shop.`cover` = 1 LIMIT 1
0.456 ms 2 /classes/Product.php:3570
4130
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4313) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.456 ms 1 Yes Yes /classes/Product.php:4524
4167
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2543) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.456 ms 1 Yes Yes /classes/Product.php:4524
1666
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4572)
0.455 ms 1 /classes/Product.php:3860
4291
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (5174) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.455 ms 1 Yes Yes /classes/Product.php:4524
4373
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (10423) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.455 ms 1 Yes Yes /classes/Product.php:4524
411
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4266 AND `id_group` = 1 LIMIT 1
0.454 ms 0 /classes/GroupReduction.php:156
986
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4105 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4105 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.454 ms 0 /classes/Cart.php:1430
3125
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4279
ORDER BY `position`
0.454 ms 1 Yes /classes/Product.php:3545
3131
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4310
ORDER BY `position`
0.454 ms 1 Yes /classes/Product.php:3545
3781
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 9077) AND (b.`id_shop` = 1) LIMIT 1
0.454 ms 1 /src/Adapter/EntityMapper.php:71
2384
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2515
ORDER BY f.position ASC
0.453 ms 5 Yes /classes/Product.php:6021
3269
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2546
ORDER BY `position`
0.453 ms 1 Yes /classes/Product.php:3545
3464
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4090
ORDER BY `position`
0.453 ms 1 Yes /classes/Product.php:3545
3749
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 9063
ORDER BY `position`
0.453 ms 1 Yes /classes/Product.php:3545
497
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2547)
0.452 ms 1 /classes/Product.php:3860
849
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3554)
0.452 ms 1 /classes/Product.php:3860
2653
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 9081
AND image_shop.`cover` = 1 LIMIT 1
0.452 ms 1 /classes/Product.php:3570
3458
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4062
ORDER BY `position`
0.452 ms 1 Yes /classes/Product.php:3545
3664
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 6152) AND (b.`id_shop` = 1) LIMIT 1
0.452 ms 1 /src/Adapter/EntityMapper.php:71
4144
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4274) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.452 ms 1 Yes Yes /classes/Product.php:4524
635
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4323
AND image_shop.`cover` = 1 LIMIT 1
0.451 ms 1 /classes/Product.php:3570
1749
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 5036
ORDER BY f.position ASC
0.451 ms 5 Yes /classes/Product.php:6021
2724
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 9090)
0.451 ms 1 /classes/Product.php:3860
2889
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 9105)
0.451 ms 1 /classes/Product.php:3860
3176
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4212
ORDER BY `position`
0.451 ms 1 Yes /classes/Product.php:3545
3406
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2524) AND (b.`id_shop` = 1) LIMIT 1
0.451 ms 1 /src/Adapter/EntityMapper.php:71
3514
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4306) AND (b.`id_shop` = 1) LIMIT 1
0.451 ms 1 /src/Adapter/EntityMapper.php:71
4207
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4080) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.451 ms 1 Yes Yes /classes/Product.php:4524
3907
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 10999) AND (b.`id_shop` = 1) LIMIT 1
0.451 ms 1 /src/Adapter/EntityMapper.php:71
1384
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4047
ORDER BY f.position ASC
0.450 ms 5 Yes /classes/Product.php:6021
3512
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4307
ORDER BY `position`
0.450 ms 1 Yes /classes/Product.php:3545
1085
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2845 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2845 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.450 ms 0 /classes/Cart.php:1430
3170
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4259
ORDER BY `position`
0.450 ms 1 Yes /classes/Product.php:3545
3449
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4048
ORDER BY `position`
0.450 ms 1 Yes /classes/Product.php:3545
4340
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (9076) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.450 ms 1 Yes Yes /classes/Product.php:4524
1041
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4074 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4074 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.449 ms 0 /classes/Cart.php:1430
1638
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4306
ORDER BY f.position ASC
0.449 ms 5 Yes /classes/Product.php:6021
2746
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 9092)
0.449 ms 1 /classes/Product.php:3860
4153
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2531) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.449 ms 1 Yes Yes /classes/Product.php:4524
1141
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4080 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4080 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.449 ms 0 /classes/Cart.php:1430
1888
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 5049 AND id_shop=1 LIMIT 1
0.449 ms 1 /classes/Product.php:6876
2064
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 5174)
0.449 ms 1 /classes/Product.php:3860
3242
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4323
ORDER BY `position`
0.449 ms 1 Yes /classes/Product.php:3545
3583
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 5049) AND (b.`id_shop` = 1) LIMIT 1
0.449 ms 1 /src/Adapter/EntityMapper.php:71
88
SELECT SQL_NO_CACHE data FROM hgt78_layered_filter_block WHERE hash="c3939dc03e95e94d8535012c9cb9b63c" LIMIT 1
0.448 ms 1 /modules/ps_facetedsearch/src/Filters/Block.php:186
997
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4109 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4109 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.448 ms 0 /classes/Cart.php:1430
3158
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4264
ORDER BY `position`
0.448 ms 1 Yes /classes/Product.php:3545
3314
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4214
ORDER BY `position`
0.448 ms 1 Yes /classes/Product.php:3545
3496
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4195) AND (b.`id_shop` = 1) LIMIT 1
0.448 ms 1 /src/Adapter/EntityMapper.php:71
1372
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4046 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4046 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.447 ms 0 /classes/Cart.php:1430
4262
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (5036) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.447 ms 1 Yes Yes /classes/Product.php:4524
4357
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (9097) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.447 ms 1 Yes Yes /classes/Product.php:4524
3371
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2844
ORDER BY `position`
0.447 ms 1 Yes /classes/Product.php:3545
3688
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 6198) AND (b.`id_shop` = 1) LIMIT 1
0.447 ms 1 /src/Adapter/EntityMapper.php:71
1766
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 5038)
0.446 ms 1 /classes/Product.php:3860
3377
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4088
ORDER BY `position`
0.446 ms 1 Yes /classes/Product.php:3545
3427
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2801) AND (b.`id_shop` = 1) LIMIT 1
0.446 ms 1 /src/Adapter/EntityMapper.php:71
2645
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 9079
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.446 ms 0 /classes/SpecificPrice.php:259
1816
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 5043
AND image_shop.`cover` = 1 LIMIT 1
0.445 ms 2 /classes/Product.php:3570
3149
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4278
ORDER BY `position`
0.445 ms 1 Yes /classes/Product.php:3545
3491
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4144
ORDER BY `position`
0.445 ms 1 Yes /classes/Product.php:3545
3805
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 9089) AND (b.`id_shop` = 1) LIMIT 1
0.445 ms 1 /src/Adapter/EntityMapper.php:71
2460
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 9058 AND `id_group` = 1 LIMIT 1
0.445 ms 0 /classes/GroupReduction.php:156
2792
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 9096 AND `id_group` = 1 LIMIT 1
0.445 ms 0 /classes/GroupReduction.php:156
3470
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4130
ORDER BY `position`
0.445 ms 1 Yes /classes/Product.php:3545
3676
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 6156) AND (b.`id_shop` = 1) LIMIT 1
0.445 ms 1 /src/Adapter/EntityMapper.php:71
1627
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4307
ORDER BY f.position ASC
0.444 ms 5 Yes /classes/Product.php:6021
2707
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 9086
ORDER BY f.position ASC
0.444 ms 5 Yes /classes/Product.php:6021
390
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4248) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.444 ms 1 /classes/stock/StockAvailable.php:453
657
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4321
AND image_shop.`cover` = 1 LIMIT 1
0.444 ms 1 /classes/Product.php:3570
3388
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2518) AND (b.`id_shop` = 1) LIMIT 1
0.444 ms 1 /src/Adapter/EntityMapper.php:71
3622
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 5158) AND (b.`id_shop` = 1) LIMIT 1
0.444 ms 1 /src/Adapter/EntityMapper.php:71
3799
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 9085) AND (b.`id_shop` = 1) LIMIT 1
0.444 ms 1 /src/Adapter/EntityMapper.php:71
712
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2541
AND image_shop.`cover` = 1 LIMIT 1
0.443 ms 1 /classes/Product.php:3570
1484
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4133
ORDER BY f.position ASC
0.443 ms 5 Yes /classes/Product.php:6021
3107
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4225
ORDER BY `position`
0.443 ms 1 Yes /classes/Product.php:3545
3490
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4144) AND (b.`id_shop` = 1) LIMIT 1
0.443 ms 1 /src/Adapter/EntityMapper.php:71
663
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4321 AND id_shop=1 LIMIT 1
0.442 ms 1 /classes/Product.php:6876
2670
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 9082 AND id_shop=1 LIMIT 1
0.442 ms 1 /classes/Product.php:6876
830
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2540) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.441 ms 1 /classes/stock/StockAvailable.php:453
1661
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4572
AND image_shop.`cover` = 1 LIMIT 1
0.441 ms 1 /classes/Product.php:3570
3018
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 10576
AND image_shop.`cover` = 1 LIMIT 1
0.441 ms 1 /classes/Product.php:3570
3347
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4069
ORDER BY `position`
0.441 ms 1 Yes /classes/Product.php:3545
3461
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4064
ORDER BY `position`
0.441 ms 1 Yes /classes/Product.php:3545
3770
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 9073
ORDER BY `position`
0.441 ms 1 Yes /classes/Product.php:3545
2158
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 6043) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.440 ms 1 /classes/stock/StockAvailable.php:453
3473
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4133
ORDER BY `position`
0.440 ms 1 Yes /classes/Product.php:3545
3776
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 9075
ORDER BY `position`
0.440 ms 1 Yes /classes/Product.php:3545
4157
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4329) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.440 ms 1 Yes Yes /classes/Product.php:4524
533
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2529) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.440 ms 1 /classes/stock/StockAvailable.php:453
3493
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4183) AND (b.`id_shop` = 1) LIMIT 1
0.440 ms 1 /src/Adapter/EntityMapper.php:71
3682
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 6158) AND (b.`id_shop` = 1) LIMIT 1
0.440 ms 1 /src/Adapter/EntityMapper.php:71
4245
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4183) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.440 ms 1 Yes Yes /classes/Product.php:4524
4273
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (5047) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.440 ms 1 Yes Yes /classes/Product.php:4524
1915
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 5052
AND image_shop.`cover` = 1 LIMIT 1
0.439 ms 2 /classes/Product.php:3570
2495
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 9062 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 9062 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.439 ms 0 /classes/Cart.php:1430
3099
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 6017
ORDER BY `position`
0.439 ms 1 Yes /classes/Product.php:3545
3685
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 6159) AND (b.`id_shop` = 1) LIMIT 1
0.439 ms 1 /src/Adapter/EntityMapper.php:71
3709
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 7959) AND (b.`id_shop` = 1) LIMIT 1
0.439 ms 1 /src/Adapter/EntityMapper.php:71
959
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4112)
0.438 ms 1 /classes/Product.php:3860
1313
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2801)
0.438 ms 1 /classes/Product.php:3860
3457
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4062) AND (b.`id_shop` = 1) LIMIT 1
0.438 ms 1 /src/Adapter/EntityMapper.php:71
3643
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 5332) AND (b.`id_shop` = 1) LIMIT 1
0.438 ms 1 /src/Adapter/EntityMapper.php:71
4142
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4275) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.438 ms 1 Yes Yes /classes/Product.php:4524
4378
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (10852) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.438 ms 1 Yes Yes /classes/Product.php:4524
2693
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 9085 AND `id_group` = 1 LIMIT 1
0.437 ms 0 /classes/GroupReduction.php:156
3784
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 9078) AND (b.`id_shop` = 1) LIMIT 1
0.437 ms 1 /src/Adapter/EntityMapper.php:71
643
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4323) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.436 ms 1 /classes/stock/StockAvailable.php:453
3292
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2540) AND (b.`id_shop` = 1) LIMIT 1
0.436 ms 1 /src/Adapter/EntityMapper.php:71
275
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4314
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.436 ms 0 /classes/SpecificPrice.php:259
3661
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 6151) AND (b.`id_shop` = 1) LIMIT 1
0.436 ms 1 /src/Adapter/EntityMapper.php:71
4248
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4206) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.436 ms 1 Yes Yes /classes/Product.php:4524
2437
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 8986 AND id_shop=1 LIMIT 1
0.435 ms 1 /classes/Product.php:6876
3161
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4263
ORDER BY `position`
0.435 ms 1 Yes /classes/Product.php:3545
4349
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (9089) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.435 ms 1 Yes Yes /classes/Product.php:4524
4377
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (10576) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.435 ms 1 Yes Yes /classes/Product.php:4524
134
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 12682)
0.435 ms 1 /classes/Product.php:3860
1649
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4304
ORDER BY f.position ASC
0.435 ms 5 Yes /classes/Product.php:6021
2213
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 6154) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.435 ms 1 /classes/stock/StockAvailable.php:453
3539
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4696
ORDER BY `position`
0.435 ms 1 Yes /classes/Product.php:3545
3587
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5050
ORDER BY `position`
0.435 ms 2 Yes /classes/Product.php:3545
3670
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 6154) AND (b.`id_shop` = 1) LIMIT 1
0.435 ms 1 /src/Adapter/EntityMapper.php:71
4143
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3183) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.435 ms 1 Yes Yes /classes/Product.php:4524
4309
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (6159) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.435 ms 1 Yes Yes /classes/Product.php:4524
90
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 6017
AND image_shop.`cover` = 1 LIMIT 1
0.434 ms 1 /classes/Product.php:3570
2919
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 9108 LIMIT 1
0.434 ms 10 /classes/SpecificPrice.php:435
1926
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 5053
AND image_shop.`cover` = 1 LIMIT 1
0.434 ms 2 /classes/Product.php:3570
2356
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 7959)
0.434 ms 1 /classes/Product.php:3860
4278
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (5052) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.434 ms 1 Yes Yes /classes/Product.php:4524
4336
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (9072) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.434 ms 1 Yes Yes /classes/Product.php:4524
1142
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4080
ORDER BY f.position ASC
0.433 ms 5 Yes /classes/Product.php:6021
1611
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4303)
0.433 ms 1 /classes/Product.php:3860
2552
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 9070 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 9070 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.433 ms 0 /classes/Cart.php:1430
2829
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 9100
AND image_shop.`cover` = 1 LIMIT 1
0.433 ms 1 /classes/Product.php:3570
3296
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2544
ORDER BY `position`
0.433 ms 2 Yes /classes/Product.php:3545
3304
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4218) AND (b.`id_shop` = 1) LIMIT 1
0.433 ms 1 /src/Adapter/EntityMapper.php:71
3571
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 5045) AND (b.`id_shop` = 1) LIMIT 1
0.433 ms 1 /src/Adapter/EntityMapper.php:71
3778
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 9076) AND (b.`id_shop` = 1) LIMIT 1
0.433 ms 1 /src/Adapter/EntityMapper.php:71
3802
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 9086) AND (b.`id_shop` = 1) LIMIT 1
0.433 ms 1 /src/Adapter/EntityMapper.php:71
3854
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 9105
ORDER BY `position`
0.433 ms 1 Yes /classes/Product.php:3545
4168
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2542) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.433 ms 1 Yes Yes /classes/Product.php:4524
508
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4318)
0.432 ms 1 /classes/Product.php:3860
3659
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 6044
ORDER BY `position`
0.432 ms 1 Yes /classes/Product.php:3545
3869
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 9262
ORDER BY `position`
0.432 ms 1 Yes /classes/Product.php:3545
272
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4314
AND image_shop.`cover` = 1 LIMIT 1
0.432 ms 1 /classes/Product.php:3570
1004
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4106)
0.431 ms 1 /classes/Product.php:3860
2111
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 5332)
0.431 ms 1 /classes/Product.php:3860
2979
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 10423)
0.431 ms 1 /classes/Product.php:3860
3302
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3553
ORDER BY `position`
0.431 ms 1 Yes /classes/Product.php:3545
3344
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4116
ORDER BY `position`
0.431 ms 1 Yes /classes/Product.php:3545
3905
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 10928
ORDER BY `position`
0.431 ms 1 Yes /classes/Product.php:3545
440
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4274
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.431 ms 1 /classes/SpecificPrice.php:259
3599
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5054
ORDER BY `position`
0.431 ms 2 Yes /classes/Product.php:3545
4261
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (5033) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.431 ms 1 Yes Yes /classes/Product.php:4524
4292
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (5308) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.431 ms 1 Yes Yes /classes/Product.php:4524
4305
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (6155) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.431 ms 1 Yes Yes /classes/Product.php:4524
1909
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 5051)
0.430 ms 1 /classes/Product.php:3860
3482
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4141
ORDER BY `position`
0.430 ms 1 Yes /classes/Product.php:3545
3551
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5038
ORDER BY `position`
0.430 ms 2 Yes /classes/Product.php:3545
4294
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (5331) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.430 ms 1 Yes Yes /classes/Product.php:4524
3167
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4260
ORDER BY `position`
0.430 ms 1 Yes /classes/Product.php:3545
3443
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4046
ORDER BY `position`
0.430 ms 1 Yes /classes/Product.php:3545
3619
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 5081) AND (b.`id_shop` = 1) LIMIT 1
0.430 ms 1 /src/Adapter/EntityMapper.php:71
885
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2941) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.429 ms 1 /classes/stock/StockAvailable.php:453
2122
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 5334)
0.429 ms 1 /classes/Product.php:3860
3499
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4196) AND (b.`id_shop` = 1) LIMIT 1
0.429 ms 1 /src/Adapter/EntityMapper.php:71
3656
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 6043
ORDER BY `position`
0.429 ms 1 Yes /classes/Product.php:3545
3752
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 9067
ORDER BY `position`
0.429 ms 1 Yes /classes/Product.php:3545
4334
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (9070) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.429 ms 1 Yes Yes /classes/Product.php:4524
824
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2540 LIMIT 1
0.429 ms 10 /classes/SpecificPrice.php:435
1263
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2526
ORDER BY f.position ASC
0.429 ms 5 Yes /classes/Product.php:6021
3140
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4315
ORDER BY `position`
0.429 ms 1 Yes /classes/Product.php:3545
3515
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4306
ORDER BY `position`
0.429 ms 1 Yes /classes/Product.php:3545
3595
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 5053) AND (b.`id_shop` = 1) LIMIT 1
0.429 ms 1 /src/Adapter/EntityMapper.php:71
846
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3554 LIMIT 1
0.428 ms 10 /classes/SpecificPrice.php:435
4335
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (9071) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.428 ms 1 Yes Yes /classes/Product.php:4524
1885
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 5049
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.428 ms 0 /classes/SpecificPrice.php:259
2928
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 9144
AND image_shop.`cover` = 1 LIMIT 1
0.428 ms 1 /classes/Product.php:3570
3400
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2516) AND (b.`id_shop` = 1) LIMIT 1
0.428 ms 1 /src/Adapter/EntityMapper.php:71
3431
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2430
ORDER BY `position`
0.428 ms 1 Yes /classes/Product.php:3545
3436
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4043) AND (b.`id_shop` = 1) LIMIT 1
0.428 ms 1 /src/Adapter/EntityMapper.php:71
327
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4264
AND image_shop.`cover` = 1 LIMIT 1
0.427 ms 1 /classes/Product.php:3570
574
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2534)
0.427 ms 1 /classes/Product.php:3860
580
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4329
AND image_shop.`cover` = 1 LIMIT 1
0.427 ms 1 /classes/Product.php:3570
621
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4327) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.427 ms 1 /classes/stock/StockAvailable.php:453
3545
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5036
ORDER BY `position`
0.427 ms 2 Yes /classes/Product.php:3545
3725
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 8984
ORDER BY `position`
0.427 ms 1 Yes /classes/Product.php:3545
3731
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 8986
ORDER BY `position`
0.427 ms 1 Yes /classes/Product.php:3545
4237
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4130) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.427 ms 1 Yes Yes /classes/Product.php:4524
12
SELECT SQL_NO_CACHE COUNT(DISTINCT l.id_lang) FROM `hgt78_lang` l
JOIN hgt78_lang_shop lang_shop ON (lang_shop.id_lang = l.id_lang AND lang_shop.id_shop = 1)
WHERE l.`active` = 1 LIMIT 1
0.426 ms 6 /classes/Language.php:1216
3116
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4285
ORDER BY `position`
0.426 ms 1 Yes /classes/Product.php:3545
3128
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4309
ORDER BY `position`
0.426 ms 1 Yes /classes/Product.php:3545
3425
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2916
ORDER BY `position`
0.426 ms 1 Yes /classes/Product.php:3545
511
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4318) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.425 ms 1 /classes/stock/StockAvailable.php:453
1683
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4573
ORDER BY f.position ASC
0.425 ms 5 Yes /classes/Product.php:6021
2496
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 9062
ORDER BY f.position ASC
0.425 ms 5 Yes /classes/Product.php:6021
3673
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 6155) AND (b.`id_shop` = 1) LIMIT 1
0.425 ms 1 /src/Adapter/EntityMapper.php:71
4283
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (5057) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.425 ms 1 Yes Yes /classes/Product.php:4524
709
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2542) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.424 ms 1 /classes/stock/StockAvailable.php:453
4350
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (9090) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.424 ms 1 Yes Yes /classes/Product.php:4524
189
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4282)
0.424 ms 1 /classes/Product.php:3860
3871
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 9266) AND (b.`id_shop` = 1) LIMIT 1
0.424 ms 1 /src/Adapter/EntityMapper.php:71
2598
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 9075
AND image_shop.`cover` = 1 LIMIT 1
0.423 ms 1 /classes/Product.php:3570
3487
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4142) AND (b.`id_shop` = 1) LIMIT 1
0.423 ms 1 /src/Adapter/EntityMapper.php:71
3701
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 7954
ORDER BY `position`
0.423 ms 1 Yes /classes/Product.php:3545
3713
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 7962
ORDER BY `position`
0.423 ms 1 Yes /classes/Product.php:3545
3851
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 9104
ORDER BY `position`
0.423 ms 1 Yes /classes/Product.php:3545
4232
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4061) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.423 ms 1 Yes Yes /classes/Product.php:4524
4286
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (5078) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.423 ms 1 Yes Yes /classes/Product.php:4524
855
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3553
AND image_shop.`cover` = 1 LIMIT 1
0.422 ms 1 /classes/Product.php:3570
1291
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2558)
0.422 ms 1 /classes/Product.php:3860
2100
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 5331)
0.422 ms 1 /classes/Product.php:3860
2897
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 9106 LIMIT 1
0.422 ms 11 /classes/SpecificPrice.php:435
41
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 33) AND (b.`id_shop` = 1) LIMIT 1
0.421 ms 1 /src/Adapter/EntityMapper.php:71
577
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2534) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.421 ms 1 /classes/stock/StockAvailable.php:453
1939
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 5054 LIMIT 1
0.421 ms 10 /classes/SpecificPrice.php:435
2541
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `hgt78_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 9069 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `hgt78_cart_product` cp JOIN `hgt78_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgt78_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 9069 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.421 ms 0 /classes/Cart.php:1430
4372
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (9733) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.421 ms 1 Yes Yes /classes/Product.php:4524
3613
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 5059) AND (b.`id_shop` = 1) LIMIT 1
0.421 ms 1 /src/Adapter/EntityMapper.php:71
21
SELECT SQL_NO_CACHE m.`id_module`, m.`name`, ms.`id_module`as `mshop`
FROM `hgt78_module` m
LEFT JOIN `hgt78_module_shop` ms
ON m.`id_module` = ms.`id_module`
AND ms.`id_shop` = 1
0.420 ms 118 /classes/module/Module.php:346
277
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4314)
0.420 ms 1 /classes/Product.php:3860
756
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2548
AND image_shop.`cover` = 1 LIMIT 1
0.420 ms 1 /classes/Product.php:3570
3625
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 5159) AND (b.`id_shop` = 1) LIMIT 1
0.420 ms 1 /src/Adapter/EntityMapper.php:71
4241
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4141) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.420 ms 1 Yes Yes /classes/Product.php:4524
4304
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (6154) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.420 ms 1 Yes Yes /classes/Product.php:4524
2265
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 6159)
0.420 ms 1 /classes/Product.php:3860
4316
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (7958) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.419 ms 1 Yes Yes /classes/Product.php:4524
998
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4109
ORDER BY f.position ASC
0.419 ms 5 Yes /classes/Product.php:6021
2917
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 9108
AND image_shop.`cover` = 1 LIMIT 1
0.419 ms 1 /classes/Product.php:3570
3463
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4090) AND (b.`id_shop` = 1) LIMIT 1
0.419 ms 1 /src/Adapter/EntityMapper.php:71
4231
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4060) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.419 ms 1 Yes Yes /classes/Product.php:4524
4290
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (5173) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.419 ms 1 Yes Yes /classes/Product.php:4524
4381
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (10926) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.419 ms 1 Yes Yes /classes/Product.php:4524
330
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4264
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.418 ms 0 /classes/SpecificPrice.php:259
486
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4267)
0.418 ms 1 /classes/Product.php:3860
1705
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4577
ORDER BY f.position ASC
0.418 ms 5 Yes /classes/Product.php:6021
1722
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4696)
0.418 ms 1 /classes/Product.php:3860
2407
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 8978
ORDER BY f.position ASC
0.418 ms 5 Yes /classes/Product.php:6021
427
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.417 ms 1 /classes/Product.php:5659
2912
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 9107 AND id_shop=1 LIMIT 1
0.417 ms 1 /classes/Product.php:6876
3287
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2538
ORDER BY `position`
0.417 ms 1 Yes /classes/Product.php:3545
3934
SELECT SQL_NO_CACHE `id_module` FROM `hgt78_module` WHERE `name` = "iqitsearch" LIMIT 1
0.417 ms 1 /classes/module/Module.php:2664
233
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4310)
0.416 ms 1 /classes/Product.php:3860
1275
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2597
AND image_shop.`cover` = 1 LIMIT 1
0.416 ms 1 /classes/Product.php:3570
4233
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4062) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.416 ms 1 Yes Yes /classes/Product.php:4524
4287
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (5081) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.416 ms 1 Yes Yes /classes/Product.php:4524
4321
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (8978) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.416 ms 1 Yes Yes /classes/Product.php:4524
101
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 6017)
0.415 ms 1 /classes/Product.php:3860
1186
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2476
ORDER BY f.position ASC
0.415 ms 5 Yes /classes/Product.php:6021
2782
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 9095) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.415 ms 1 /classes/stock/StockAvailable.php:453
3197
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4269
ORDER BY `position`
0.415 ms 1 Yes /classes/Product.php:3545
3887
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 10469
ORDER BY `position`
0.415 ms 1 Yes /classes/Product.php:3545
4299
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (6043) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.415 ms 1 Yes Yes /classes/Product.php:4524
558
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2533
AND image_shop.`cover` = 1 LIMIT 1
0.415 ms 1 /classes/Product.php:3570
582
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4329 LIMIT 1
0.415 ms 10 /classes/SpecificPrice.php:435
2300
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 6664)
0.415 ms 1 /classes/Product.php:3860
3716
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2515
ORDER BY `position`
0.415 ms 1 Yes /classes/Product.php:3545
3152
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4277
ORDER BY `position`
0.414 ms 1 Yes /classes/Product.php:3545
3281
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2550
ORDER BY `position`
0.414 ms 1 Yes /classes/Product.php:3545
387
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4248)
0.413 ms 1 /classes/Product.php:3860
3001
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 10467)
0.413 ms 1 /classes/Product.php:3860
3466
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4129) AND (b.`id_shop` = 1) LIMIT 1
0.413 ms 1 /src/Adapter/EntityMapper.php:71
4243
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4142) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.413 ms 1 Yes Yes /classes/Product.php:4524
4279
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (5053) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.413 ms 1 Yes Yes /classes/Product.php:4524
4330
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (9063) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.413 ms 1 Yes Yes /classes/Product.php:4524
222
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4309)
0.413 ms 1 /classes/Product.php:3860
288
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4313)
0.413 ms 1 /classes/Product.php:3860
3796
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 9084) AND (b.`id_shop` = 1) LIMIT 1
0.413 ms 1 /src/Adapter/EntityMapper.php:71
4282
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (5056) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.413 ms 1 Yes Yes /classes/Product.php:4524
4313
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (7952) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.413 ms 1 Yes Yes /classes/Product.php:4524
4355
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (9095) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.413 ms 1 Yes Yes /classes/Product.php:4524
4374
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (10424) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.413 ms 1 Yes Yes /classes/Product.php:4524
1015
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4116)
0.412 ms 1 /classes/Product.php:3860
1854
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 5046)
0.412 ms 1 /classes/Product.php:3860
2599
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 229 LIMIT 1
0.412 ms 1 /classes/Product.php:5659
2993
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 10424) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.412 ms 1 /classes/stock/StockAvailable.php:453
3674
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 6155
ORDER BY `position`
0.412 ms 1 Yes /classes/Product.php:3545
3895
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 10853) AND (b.`id_shop` = 1) LIMIT 1
0.412 ms 1 /src/Adapter/EntityMapper.php:71
4328
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (9061) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.412 ms 1 Yes Yes /classes/Product.php:4524
2891
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 9105 AND `id_group` = 1 LIMIT 1
0.411 ms 0 /classes/GroupReduction.php:156
3179
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4266
ORDER BY `position`
0.411 ms 1 Yes /classes/Product.php:3545
3842
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 9101
ORDER BY `position`
0.411 ms 1 Yes /classes/Product.php:3545
4275
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (5049) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.411 ms 1 Yes Yes /classes/Product.php:4524
4332
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (9068) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.411 ms 1 Yes Yes /classes/Product.php:4524
4311
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (6435) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.411 ms 1 Yes Yes /classes/Product.php:4524
2183
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 6152
AND image_shop.`cover` = 1 LIMIT 1
0.410 ms 1 /classes/Product.php:3570
2776
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 9095 LIMIT 1
0.410 ms 17 /classes/SpecificPrice.php:435
3182
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4275
ORDER BY `position`
0.410 ms 1 Yes /classes/Product.php:3545
4298
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (5472) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.410 ms 1 Yes Yes /classes/Product.php:4524
4352
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (9092) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.410 ms 1 Yes Yes /classes/Product.php:4524
728
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2545)
0.410 ms 1 /classes/Product.php:3860
2543
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 9070
AND image_shop.`cover` = 1 LIMIT 1
0.410 ms 1 /classes/Product.php:3570
3635
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5308
ORDER BY `position`
0.410 ms 1 Yes /classes/Product.php:3545
4302
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (6152) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.410 ms 1 Yes Yes /classes/Product.php:4524
4312
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (6664) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.410 ms 1 Yes Yes /classes/Product.php:4524
4360
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (9100) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.410 ms 1 Yes Yes /classes/Product.php:4524
131
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 12682 LIMIT 1
0.409 ms 13 /classes/SpecificPrice.php:435
839
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2544 AND id_shop=1 LIMIT 1
0.409 ms 1 /classes/Product.php:6876
4285
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (5059) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.409 ms 1 Yes Yes /classes/Product.php:4524
4359
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (9099) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.409 ms 1 Yes Yes /classes/Product.php:4524
4382
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (10928) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.409 ms 1 Yes Yes /classes/Product.php:4524
4326
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (9058) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.408 ms 1 Yes Yes /classes/Product.php:4524
4329
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (9062) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.408 ms 1 Yes Yes /classes/Product.php:4524
791
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2552 LIMIT 1
0.408 ms 10 /classes/SpecificPrice.php:435
2614
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 9076)
0.408 ms 1 /classes/Product.php:3860
4151
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2528) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.408 ms 1 Yes Yes /classes/Product.php:4524
4314
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (7954) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.408 ms 1 Yes Yes /classes/Product.php:4524
4317
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (7959) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.408 ms 1 Yes Yes /classes/Product.php:4524
4154
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2532) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.407 ms 1 Yes Yes /classes/Product.php:4524
4354
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (9094) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.407 ms 1 Yes Yes /classes/Product.php:4524
343
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4263)
0.407 ms 1 /classes/Product.php:3860
464
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4270)
0.407 ms 1 /classes/Product.php:3860
646
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4322
AND image_shop.`cover` = 1 LIMIT 1
0.407 ms 1 /classes/Product.php:3570
3058
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 10891)
0.407 ms 1 /classes/Product.php:3860
4353
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (9093) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.407 ms 1 Yes Yes /classes/Product.php:4524
3113
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4286
ORDER BY `position`
0.406 ms 1 Yes /classes/Product.php:3545
4318
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (7962) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.406 ms 1 Yes Yes /classes/Product.php:4524
3335
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4105
ORDER BY `position`
0.406 ms 1 Yes /classes/Product.php:3545
4324
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (8986) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.406 ms 1 Yes Yes /classes/Product.php:4524
780
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2550 LIMIT 1
0.405 ms 10 /classes/SpecificPrice.php:435
1934
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 5053) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.405 ms 1 /classes/stock/StockAvailable.php:453
2878
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 9104)
0.405 ms 1 /classes/Product.php:3860
2968
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 9733)
0.405 ms 1 /classes/Product.php:3860
3164
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4262
ORDER BY `position`
0.405 ms 1 Yes /classes/Product.php:3545
4301
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (6151) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.405 ms 1 Yes Yes /classes/Product.php:4524
195
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4280
AND image_shop.`cover` = 1 LIMIT 1
0.405 ms 1 /classes/Product.php:3570
596
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4328)
0.404 ms 1 /classes/Product.php:3860
2584
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 9073) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.404 ms 1 /classes/stock/StockAvailable.php:453
3704
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 7957
ORDER BY `position`
0.404 ms 1 Yes /classes/Product.php:3545
3794
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 9082
ORDER BY `position`
0.404 ms 1 Yes /classes/Product.php:3545
4310
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (6198) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.404 ms 1 Yes Yes /classes/Product.php:4524
1042
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4074
ORDER BY f.position ASC
0.404 ms 5 Yes /classes/Product.php:6021
1512
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4141)
0.404 ms 1 /classes/Product.php:3860
2680
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 9084)
0.404 ms 1 /classes/Product.php:3860
3629
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5173
ORDER BY `position`
0.404 ms 1 Yes /classes/Product.php:3545
4252
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `hgt78_product_attribute` pa
INNER JOIN hgt78_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `hgt78_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `hgt78_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `hgt78_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `hgt78_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4306) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.404 ms 1 Yes Yes /classes/Product.php:4524
1782
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 5039
ORDER BY f.position ASC
0.403 ms 5 Yes /classes/Product.php:6021
2088
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 5322)
0.403 ms 1 /classes/Product.php:3860
3419
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2597
ORDER BY `position`
0.403 ms 1 Yes /classes/Product.php:3545
3787
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 9079) AND (b.`id_shop` = 1) LIMIT 1
0.403 ms 1 /src/Adapter/EntityMapper.php:71
2199
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 6153)
0.402 ms 1 /classes/Product.php:3860
69
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a0
LEFT JOIN `hgt78_category_lang` `a1` ON (a0.`id_category` = a1.`id_category`)
WHERE (a0.`nleft` < 2) AND (a0.`nright` > 577) AND (a1.`id_lang` = 1) AND (a1.`id_shop` = 1)
ORDER BY a0.`nleft` asc
0.402 ms 1 /classes/PrestaShopCollection.php:383
726
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2545
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.402 ms 0 /classes/SpecificPrice.php:259
2097
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 5331 LIMIT 1
0.402 ms 10 /classes/SpecificPrice.php:435
2458
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 9058)
0.402 ms 1 /classes/Product.php:3860
2990
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 10424)
0.402 ms 1 /classes/Product.php:3860
3359
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3041
ORDER BY `position`
0.402 ms 1 Yes /classes/Product.php:3545
43
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 35) AND (b.`id_shop` = 1) LIMIT 1
0.401 ms 1 /src/Adapter/EntityMapper.php:71
319
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4276
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.401 ms 0 /classes/SpecificPrice.php:259
371
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4259
AND image_shop.`cover` = 1 LIMIT 1
0.401 ms 1 /classes/Product.php:3570
610
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2493) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.401 ms 1 /classes/stock/StockAvailable.php:453
3736
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 9058) AND (b.`id_shop` = 1) LIMIT 1
0.401 ms 1 /src/Adapter/EntityMapper.php:71
106
SELECT SQL_NO_CACHE *
FROM `hgt78_tax` a
WHERE (a.`id_tax` = 1) LIMIT 1
0.400 ms 1 /src/Adapter/EntityMapper.php:71
414
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4266
ORDER BY f.position ASC
0.400 ms 5 Yes /classes/Product.php:6021
521
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2528 AND `id_group` = 1 LIMIT 1
0.400 ms 0 /classes/GroupReduction.php:156
2288
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 6435)
0.400 ms 1 /classes/Product.php:3860
3821
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 9094
ORDER BY `position`
0.400 ms 1 Yes /classes/Product.php:3545
3880
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 10424) AND (b.`id_shop` = 1) LIMIT 1
0.400 ms 1 /src/Adapter/EntityMapper.php:71
1418
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4062
AND image_shop.`cover` = 1 LIMIT 1
0.399 ms 1 /classes/Product.php:3570
2322
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 7954)
0.399 ms 1 /classes/Product.php:3860
2379
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2515)
0.399 ms 1 /classes/Product.php:3860
3134
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2554
ORDER BY `position`
0.399 ms 1 Yes /classes/Product.php:3545
3902
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 10926
ORDER BY `position`
0.399 ms 1 Yes /classes/Product.php:3545
745
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4281
AND image_shop.`cover` = 1 LIMIT 1
0.398 ms 1 /classes/Product.php:3570
1329
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2430
ORDER BY f.position ASC
0.398 ms 5 Yes /classes/Product.php:6021
3500
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4196
ORDER BY `position`
0.398 ms 1 Yes /classes/Product.php:3545
3845
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 9102
ORDER BY `position`
0.398 ms 1 Yes /classes/Product.php:3545
30
SELECT SQL_NO_CACHE *
FROM `hgt78_currency` a
LEFT JOIN `hgt78_currency_lang` `b` ON a.`id_currency` = b.`id_currency` AND b.`id_lang` = 1
LEFT JOIN `hgt78_currency_shop` `c` ON a.`id_currency` = c.`id_currency` AND c.`id_shop` = 1
WHERE (a.`id_currency` = 2) LIMIT 1
0.397 ms 1 /src/Adapter/EntityMapper.php:71
1280
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2597)
0.397 ms 1 /classes/Product.php:3860
1324
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2430)
0.397 ms 1 /classes/Product.php:3860
1567
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4195)
0.397 ms 1 /classes/Product.php:3860
2632
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 229 LIMIT 1
0.397 ms 1 /classes/Product.php:5659
3575
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5046
ORDER BY `position`
0.397 ms 2 Yes /classes/Product.php:3545
459
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4270
AND image_shop.`cover` = 1 LIMIT 1
0.396 ms 1 /classes/Product.php:3570
695
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2543)
0.396 ms 1 /classes/Product.php:3860
1572
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4195
ORDER BY f.position ASC
0.396 ms 5 Yes /classes/Product.php:6021
2531
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 9068
ORDER BY f.position ASC
0.396 ms 5 Yes /classes/Product.php:6021
3737
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 9058
ORDER BY `position`
0.396 ms 1 Yes /classes/Product.php:3545
901
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4214 LIMIT 1
0.396 ms 10 /classes/SpecificPrice.php:435
1346
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4043)
0.395 ms 1 /classes/Product.php:3860
1479
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4133)
0.395 ms 1 /classes/Product.php:3860
1578
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4196)
0.395 ms 1 /classes/Product.php:3860
2153
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 6043
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.395 ms 0 /classes/SpecificPrice.php:259
2809
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 9098 LIMIT 1
0.395 ms 18 /classes/SpecificPrice.php:435
2790
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 9096)
0.395 ms 1 /classes/Product.php:3860
3581
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5048
ORDER BY `position`
0.395 ms 2 Yes /classes/Product.php:3545
723
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2545
AND image_shop.`cover` = 1 LIMIT 1
0.394 ms 1 /classes/Product.php:3570
915
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4210)
0.394 ms 1 /classes/Product.php:3860
890
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4216 LIMIT 1
0.393 ms 10 /classes/SpecificPrice.php:435
1799
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 5041)
0.393 ms 1 /classes/Product.php:3860
2136
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 5470) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.393 ms 1 /classes/stock/StockAvailable.php:453
3413
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2526
ORDER BY `position`
0.393 ms 1 Yes /classes/Product.php:3545
3646
SELECT SQL_NO_CACHE *
FROM `hgt78_product` a
LEFT JOIN `hgt78_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `hgt78_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 5334) AND (b.`id_shop` = 1) LIMIT 1
0.393 ms 1 /src/Adapter/EntityMapper.php:71
3761
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 9070
ORDER BY `position`
0.393 ms 1 Yes /classes/Product.php:3545
2093
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 5322
ORDER BY f.position ASC
0.392 ms 5 Yes /classes/Product.php:6021
1501
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4140)
0.392 ms 1 /classes/Product.php:3860
2282
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 6435
AND image_shop.`cover` = 1 LIMIT 1
0.392 ms 1 /classes/Product.php:3570
3069
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 10926)
0.392 ms 1 /classes/Product.php:3860
3785
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 9078
ORDER BY `position`
0.392 ms 1 Yes /classes/Product.php:3545
244
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2554)
0.391 ms 1 /classes/Product.php:3860
1600
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4207)
0.391 ms 1 /classes/Product.php:3860
3035
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 10852)
0.391 ms 1 /classes/Product.php:3860
3494
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4183
ORDER BY `position`
0.391 ms 1 Yes /classes/Product.php:3545
3857
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 9106
ORDER BY `position`
0.391 ms 1 Yes /classes/Product.php:3545
3890
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 10576
ORDER BY `position`
0.391 ms 1 Yes /classes/Product.php:3545
1744
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 5036)
0.390 ms 1 /classes/Product.php:3860
2311
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 7952)
0.390 ms 1 /classes/Product.php:3860
2385
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2491
AND image_shop.`cover` = 1 LIMIT 1
0.390 ms 2 /classes/Product.php:3570
2553
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 9070
ORDER BY f.position ASC
0.390 ms 5 Yes /classes/Product.php:6021
2643
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 229 LIMIT 1
0.390 ms 1 /classes/Product.php:5659
295
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.389 ms 1 /classes/Product.php:5659
2030
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 5158)
0.389 ms 1 /classes/Product.php:3860
2163
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 6044 LIMIT 1
0.389 ms 10 /classes/SpecificPrice.php:435
162
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4286
AND image_shop.`cover` = 1 LIMIT 1
0.388 ms 1 /classes/Product.php:3570
2390
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2491)
0.388 ms 1 /classes/Product.php:3860
2843
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 9101
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.388 ms 0 /classes/SpecificPrice.php:259
121
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2553)
0.388 ms 1 /classes/Product.php:3860
178
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4285)
0.388 ms 1 /classes/Product.php:3860
200
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4280)
0.388 ms 1 /classes/Product.php:3860
3410
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2525
ORDER BY `position`
0.388 ms 1 Yes /classes/Product.php:3545
1534
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4142)
0.387 ms 1 /classes/Product.php:3860
2402
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 8978)
0.387 ms 1 /classes/Product.php:3860
3605
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5056
ORDER BY `position`
0.387 ms 2 Yes /classes/Product.php:3545
184
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4282
AND image_shop.`cover` = 1 LIMIT 1
0.387 ms 1 /classes/Product.php:3570
968
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4111
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.387 ms 0 /classes/SpecificPrice.php:259
1417
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4061
ORDER BY f.position ASC
0.387 ms 5 Yes /classes/Product.php:6021
1523
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4146)
0.387 ms 1 /classes/Product.php:3860
2447
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 9057)
0.387 ms 1 /classes/Product.php:3860
3305
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4218
ORDER BY `position`
0.387 ms 1 Yes /classes/Product.php:3545
3943
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 40) AND (b.`id_shop` = 1) LIMIT 1
0.387 ms 1 /src/Adapter/EntityMapper.php:71
211
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4279)
0.386 ms 1 /classes/Product.php:3860
420
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4275)
0.386 ms 1 /classes/Product.php:3860
487
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4267 AND id_shop=1 LIMIT 1
0.386 ms 1 /classes/Product.php:6876
310
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4277)
0.385 ms 1 /classes/Product.php:3860
1075
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3041
ORDER BY f.position ASC
0.385 ms 5 Yes /classes/Product.php:6021
2260
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 6159
AND image_shop.`cover` = 1 LIMIT 1
0.385 ms 1 /classes/Product.php:3570
2862
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 9103
AND image_shop.`cover` = 1 LIMIT 1
0.385 ms 1 /classes/Product.php:3570
1948
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 5055
AND image_shop.`cover` = 1 LIMIT 1
0.385 ms 2 /classes/Product.php:3570
52
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 44) AND (b.`id_shop` = 1) LIMIT 1
0.384 ms 1 /src/Adapter/EntityMapper.php:71
4387
SELECT SQL_NO_CACHE DISTINCT c.*
FROM `hgt78_category` c
LEFT JOIN `hgt78_category_lang` cl ON (c.`id_category` = cl.`id_category` AND cl.`id_lang` = 1)
WHERE `level_depth` = 1
0.384 ms 21 /classes/Category.php:2242
1390
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4048)
0.384 ms 1 /classes/Product.php:3860
2808
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 228 LIMIT 1
0.384 ms 1 /classes/Product.php:5659
3938
SELECT SQL_NO_CACHE `id_module` FROM `hgt78_module` WHERE `name` = "iqitmegamenu" LIMIT 1
0.384 ms 1 /classes/module/Module.php:2664
2306
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 7952
AND image_shop.`cover` = 1 LIMIT 1
0.383 ms 1 /classes/Product.php:3570
669
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.382 ms 1 /classes/Product.php:5659
2345
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 7958)
0.382 ms 1 /classes/Product.php:3860
266
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4315)
0.382 ms 1 /classes/Product.php:3860
926
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4213)
0.382 ms 1 /classes/Product.php:3860
1617
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4307
AND image_shop.`cover` = 1 LIMIT 1
0.382 ms 1 /classes/Product.php:3570
2140
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.382 ms 1 /classes/Product.php:5659
3698
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 7952
ORDER BY `position`
0.382 ms 1 Yes /classes/Product.php:3545
7
SELECT SQL_NO_CACHE *
FROM `hgt78_country` a
LEFT JOIN `hgt78_country_lang` `b` ON a.`id_country` = b.`id_country` AND b.`id_lang` = 1
LEFT JOIN `hgt78_country_shop` `c` ON a.`id_country` = c.`id_country` AND c.`id_shop` = 1
WHERE (a.`id_country` = 8) LIMIT 1
0.381 ms 1 /src/Adapter/EntityMapper.php:71
305
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4277
AND image_shop.`cover` = 1 LIMIT 1
0.381 ms 1 /classes/Product.php:3570
822
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2540
AND image_shop.`cover` = 1 LIMIT 1
0.381 ms 1 /classes/Product.php:3570
1435
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4064)
0.381 ms 1 /classes/Product.php:3860
3007
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 10469
AND image_shop.`cover` = 1 LIMIT 1
0.381 ms 1 /classes/Product.php:3570
385
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4248
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.380 ms 0 /classes/SpecificPrice.php:259
1064
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3042
ORDER BY f.position ASC
0.380 ms 5 Yes /classes/Product.php:6021
1678
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4573)
0.380 ms 1 /classes/Product.php:3860
2271
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 6198
AND image_shop.`cover` = 1 LIMIT 1
0.380 ms 1 /classes/Product.php:3570
1545
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4144)
0.379 ms 1 /classes/Product.php:3860
2254
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 6158)
0.379 ms 1 /classes/Product.php:3860
2974
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 10423
AND image_shop.`cover` = 1 LIMIT 1
0.379 ms 1 /classes/Product.php:3570
1269
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2599)
0.378 ms 1 /classes/Product.php:3860
1529
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4142
AND image_shop.`cover` = 1 LIMIT 1
0.378 ms 1 /classes/Product.php:3570
2841
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 228 LIMIT 1
0.378 ms 1 /classes/Product.php:5659
2546
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 9070
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.378 ms 0 /classes/SpecificPrice.php:259
2644
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 9079 LIMIT 1
0.378 ms 18 /classes/SpecificPrice.php:435
311
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4277 AND id_shop=1 LIMIT 1
0.377 ms 1 /classes/Product.php:6876
1961
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 5056 LIMIT 1
0.377 ms 10 /classes/SpecificPrice.php:435
2419
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 8984
ORDER BY f.position ASC
0.377 ms 5 Yes /classes/Product.php:6021
3626
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5159
ORDER BY `position`
0.377 ms 1 Yes /classes/Product.php:3545
453
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4271)
0.377 ms 1 /classes/Product.php:3860
550
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2532
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.377 ms 0 /classes/SpecificPrice.php:259
1717
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4696
AND image_shop.`cover` = 1 LIMIT 1
0.377 ms 1 /classes/Product.php:3570
1992
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 5059
AND image_shop.`cover` = 1 LIMIT 1
0.377 ms 2 /classes/Product.php:3570
145
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4225)
0.376 ms 1 /classes/Product.php:3860
2328
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 7957
AND image_shop.`cover` = 1 LIMIT 1
0.376 ms 1 /classes/Product.php:3570
2396
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 8978
AND image_shop.`cover` = 1 LIMIT 1
0.376 ms 1 /classes/Product.php:3570
3446
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4047
ORDER BY `position`
0.376 ms 1 Yes /classes/Product.php:3545
2046
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 5159
ORDER BY f.position ASC
0.375 ms 5 Yes /classes/Product.php:6021
3455
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4061
ORDER BY `position`
0.375 ms 1 Yes /classes/Product.php:3545
1108
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2606
ORDER BY f.position ASC
0.374 ms 5 Yes /classes/Product.php:6021
1940
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 5054
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.374 ms 0 /classes/SpecificPrice.php:259
3518
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4304
ORDER BY `position`
0.374 ms 1 Yes /classes/Product.php:3545
3647
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5334
ORDER BY `position`
0.374 ms 1 Yes /classes/Product.php:3545
3695
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 6664
ORDER BY `position`
0.374 ms 1 Yes /classes/Product.php:3545
1412
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4061)
0.374 ms 1 /classes/Product.php:3860
1655
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4227)
0.374 ms 1 /classes/Product.php:3860
2276
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 6198)
0.374 ms 1 /classes/Product.php:3860
2770
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 9094 AND `id_group` = 1 LIMIT 1
0.374 ms 0 /classes/GroupReduction.php:156
816
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2539)
0.373 ms 1 /classes/Product.php:3860
1357
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4044)
0.373 ms 1 /classes/Product.php:3860
1446
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4090)
0.373 ms 1 /classes/Product.php:3860
1490
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4148)
0.373 ms 1 /classes/Product.php:3860
2351
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 7959
AND image_shop.`cover` = 1 LIMIT 1
0.373 ms 1 /classes/Product.php:3570
2694
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 9085) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.373 ms 1 /classes/stock/StockAvailable.php:453
1065
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3041
AND image_shop.`cover` = 1 LIMIT 1
0.373 ms 1 /classes/Product.php:3570
3080
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 10928)
0.372 ms 1 /classes/Product.php:3860
3323
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4114
ORDER BY `position`
0.372 ms 1 Yes /classes/Product.php:3545
904
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4214)
0.372 ms 1 /classes/Product.php:3860
2741
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 9092
AND image_shop.`cover` = 1 LIMIT 1
0.372 ms 1 /classes/Product.php:3570
3317
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4210
ORDER BY `position`
0.372 ms 1 Yes /classes/Product.php:3545
228
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4310
AND image_shop.`cover` = 1 LIMIT 1
0.371 ms 1 /classes/Product.php:3570
255
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4317)
0.371 ms 1 /classes/Product.php:3860
2620
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 9077
AND image_shop.`cover` = 1 LIMIT 1
0.371 ms 1 /classes/Product.php:3570
3912
SELECT SQL_NO_CACHE name, alias FROM `hgt78_hook_alias`
0.371 ms 88 /classes/Hook.php:342
328
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.370 ms 1 /classes/Product.php:5659
734
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2546
AND image_shop.`cover` = 1 LIMIT 1
0.370 ms 1 /classes/Product.php:3570
3614
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5059
ORDER BY `position`
0.370 ms 2 Yes /classes/Product.php:3545
398
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4212)
0.369 ms 1 /classes/Product.php:3860
1181
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2476)
0.369 ms 1 /classes/Product.php:3860
1622
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4307)
0.369 ms 1 /classes/Product.php:3860
2069
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 5174
ORDER BY f.position ASC
0.369 ms 5 Yes /classes/Product.php:6021
899
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4214
AND image_shop.`cover` = 1 LIMIT 1
0.369 ms 1 /classes/Product.php:3570
1760
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 5037
ORDER BY f.position ASC
0.369 ms 5 Yes /classes/Product.php:6021
2930
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 9144 LIMIT 1
0.369 ms 14 /classes/SpecificPrice.php:435
1452
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4129
AND image_shop.`cover` = 1 LIMIT 1
0.368 ms 1 /classes/Product.php:3570
399
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4212 AND id_shop=1 LIMIT 1
0.368 ms 1 /classes/Product.php:6876
2763
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 9094
AND image_shop.`cover` = 1 LIMIT 1
0.368 ms 1 /classes/Product.php:3570
2156
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 6043 AND id_shop=1 LIMIT 1
0.367 ms 1 /classes/Product.php:6876
3320
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4213
ORDER BY `position`
0.367 ms 1 Yes /classes/Product.php:3545
50
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 39) AND (b.`id_shop` = 1) LIMIT 1
0.367 ms 1 /src/Adapter/EntityMapper.php:71
473
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4269
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.367 ms 0 /classes/SpecificPrice.php:259
1351
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4043
ORDER BY f.position ASC
0.367 ms 5 Yes /classes/Product.php:6021
1420
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4062 LIMIT 1
0.367 ms 10 /classes/SpecificPrice.php:435
2988
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 10424
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.367 ms 1 /classes/SpecificPrice.php:259
3554
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5039
ORDER BY `position`
0.367 ms 2 Yes /classes/Product.php:3545
135
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 12682 AND id_shop=1 LIMIT 1
0.366 ms 1 /classes/Product.php:6876
139
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 12682
ORDER BY f.position ASC
0.366 ms 5 Yes /classes/Product.php:6021
1247
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2525)
0.366 ms 1 /classes/Product.php:3860
2241
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 6157
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.366 ms 0 /classes/SpecificPrice.php:259
724
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.365 ms 1 /classes/Product.php:5659
2873
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 9104
AND image_shop.`cover` = 1 LIMIT 1
0.365 ms 1 /classes/Product.php:3570
3566
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5043
ORDER BY `position`
0.365 ms 2 Yes /classes/Product.php:3545
3617
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5078
ORDER BY `position`
0.365 ms 1 Yes /classes/Product.php:3545
2362
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 7962
AND image_shop.`cover` = 1 LIMIT 1
0.364 ms 1 /classes/Product.php:3570
1148
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2523)
0.364 ms 1 /classes/Product.php:3860
758
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2548 LIMIT 1
0.363 ms 10 /classes/SpecificPrice.php:435
1318
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2801
ORDER BY f.position ASC
0.363 ms 5 Yes /classes/Product.php:6021
2535
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 9069
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.363 ms 1 /classes/SpecificPrice.php:259
42
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 34) AND (b.`id_shop` = 1) LIMIT 1
0.363 ms 1 /src/Adapter/EntityMapper.php:71
2769
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 9094 AND id_shop=1 LIMIT 1
0.363 ms 1 /classes/Product.php:6876
910
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4210
AND image_shop.`cover` = 1 LIMIT 1
0.362 ms 1 /classes/Product.php:3570
1302
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2916)
0.362 ms 1 /classes/Product.php:3860
2647
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 9079)
0.362 ms 1 /classes/Product.php:3860
2748
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 9092 AND `id_group` = 1 LIMIT 1
0.362 ms 0 /classes/GroupReduction.php:156
3052
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 10891
AND image_shop.`cover` = 1 LIMIT 1
0.362 ms 1 /classes/Product.php:3570
1518
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4146
AND image_shop.`cover` = 1 LIMIT 1
0.362 ms 1 /classes/Product.php:3570
1633
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4306)
0.362 ms 1 /classes/Product.php:3860
2678
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 9084
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.362 ms 0 /classes/SpecificPrice.php:259
3375
SELECT SQL_NO_CACHE `name`, `alias` FROM `hgt78_hook_alias`
0.362 ms 88 /classes/Hook.php:290
3896
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 10853
ORDER BY `position`
0.362 ms 1 Yes /classes/Product.php:3545
456
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4271) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.361 ms 1 /classes/stock/StockAvailable.php:453
3075
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 10928
AND image_shop.`cover` = 1 LIMIT 1
0.361 ms 1 /classes/Product.php:3570
1373
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4046
ORDER BY f.position ASC
0.361 ms 5 Yes /classes/Product.php:6021
1507
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4141
AND image_shop.`cover` = 1 LIMIT 1
0.360 ms 1 /classes/Product.php:3570
4088
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 36) AND (b.`id_shop` = 1) LIMIT 1
0.360 ms 1 /src/Adapter/EntityMapper.php:71
46
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 38) AND (b.`id_shop` = 1) LIMIT 1
0.359 ms 1 /src/Adapter/EntityMapper.php:71
742
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2546) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.359 ms 1 /classes/stock/StockAvailable.php:453
900
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.359 ms 1 /classes/Product.php:5659
731
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2545) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.359 ms 1 /classes/stock/StockAvailable.php:453
1429
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4064
AND image_shop.`cover` = 1 LIMIT 1
0.359 ms 1 /classes/Product.php:3570
2996
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 10467
AND image_shop.`cover` = 1 LIMIT 1
0.359 ms 1 /classes/Product.php:3570
467
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4270) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.358 ms 1 /classes/stock/StockAvailable.php:453
2169
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 6044) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.358 ms 1 /classes/stock/StockAvailable.php:453
868
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4218 LIMIT 1
0.358 ms 10 /classes/SpecificPrice.php:435
954
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4112
AND image_shop.`cover` = 1 LIMIT 1
0.358 ms 1 /classes/Product.php:3570
1198
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2517
AND image_shop.`cover` = 1 LIMIT 1
0.358 ms 1 /classes/Product.php:3570
1589
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4206)
0.358 ms 1 /classes/Product.php:3860
2003
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 5078
AND image_shop.`cover` = 1 LIMIT 1
0.357 ms 1 /classes/Product.php:3570
2339
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 7958
AND image_shop.`cover` = 1 LIMIT 1
0.357 ms 1 /classes/Product.php:3570
3255
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2537
0.357 ms 1 /classes/Product.php:2902
250
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4317
AND image_shop.`cover` = 1 LIMIT 1
0.356 ms 1 /classes/Product.php:3570
1944
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 5054 AND `id_group` = 1 LIMIT 1
0.356 ms 0 /classes/GroupReduction.php:156
2981
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 10423 AND `id_group` = 1 LIMIT 1
0.356 ms 0 /classes/GroupReduction.php:156
3719
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2491
ORDER BY `position`
0.356 ms 2 Yes /classes/Product.php:3545
627
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4324
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.356 ms 0 /classes/SpecificPrice.php:259
1126
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4088)
0.356 ms 1 /classes/Product.php:3860
2367
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 7962)
0.356 ms 1 /classes/Product.php:3860
2688
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 9085 LIMIT 1
0.356 ms 10 /classes/SpecificPrice.php:435
3527
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4573
ORDER BY `position`
0.356 ms 1 Yes /classes/Product.php:3545
488
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4267 AND `id_group` = 1 LIMIT 1
0.355 ms 0 /classes/GroupReduction.php:156
2480
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 9061)
0.355 ms 1 /classes/Product.php:3860
261
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4315
AND image_shop.`cover` = 1 LIMIT 1
0.354 ms 1 /classes/Product.php:3570
970
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4111)
0.354 ms 1 /classes/Product.php:3860
2249
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 6158
AND image_shop.`cover` = 1 LIMIT 1
0.354 ms 1 /classes/Product.php:3570
2317
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 7954
AND image_shop.`cover` = 1 LIMIT 1
0.354 ms 1 /classes/Product.php:3570
2697
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 9086
AND image_shop.`cover` = 1 LIMIT 1
0.354 ms 1 /classes/Product.php:3570
3243
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4323
0.354 ms 1 /classes/Product.php:2902
1010
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4116
AND image_shop.`cover` = 1 LIMIT 1
0.354 ms 1 /classes/Product.php:3570
1540
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4144
AND image_shop.`cover` = 1 LIMIT 1
0.354 ms 1 /classes/Product.php:3570
2840
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 9101
AND image_shop.`cover` = 1 LIMIT 1
0.353 ms 1 /classes/Product.php:3570
3092
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 10999)
0.353 ms 1 /classes/Product.php:3860
3225
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2534
0.353 ms 1 /classes/Product.php:2902
3800
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 9085
ORDER BY `position`
0.353 ms 1 Yes /classes/Product.php:3545
3955
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 38) AND (b.`id_shop` = 1) LIMIT 1
0.353 ms 1 /src/Adapter/EntityMapper.php:71
692
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2543 LIMIT 1
0.353 ms 10 /classes/SpecificPrice.php:435
1457
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4129)
0.353 ms 1 /classes/Product.php:3860
3503
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4206
ORDER BY `position`
0.353 ms 1 Yes /classes/Product.php:3545
3578
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5047
ORDER BY `position`
0.352 ms 2 Yes /classes/Product.php:3545
975
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4111
ORDER BY f.position ASC
0.352 ms 5 Yes /classes/Product.php:6021
3290
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2539
ORDER BY `position`
0.352 ms 1 Yes /classes/Product.php:3545
164
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4286 LIMIT 1
0.351 ms 10 /classes/SpecificPrice.php:435
1285
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2597
ORDER BY f.position ASC
0.351 ms 5 Yes /classes/Product.php:6021
1307
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2916
ORDER BY f.position ASC
0.351 ms 5 Yes /classes/Product.php:6021
858
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3553
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.350 ms 0 /classes/SpecificPrice.php:259
2333
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 7957)
0.350 ms 1 /classes/Product.php:3860
2492
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 9062 AND id_shop=1 LIMIT 1
0.350 ms 1 /classes/Product.php:6876
3611
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5058
ORDER BY `position`
0.350 ms 2 Yes /classes/Product.php:3545
3710
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 7959
ORDER BY `position`
0.350 ms 1 Yes /classes/Product.php:3545
3779
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 9076
ORDER BY `position`
0.350 ms 1 Yes /classes/Product.php:3545
802
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2538 LIMIT 1
0.349 ms 10 /classes/SpecificPrice.php:435
2762
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 9093
ORDER BY f.position ASC
0.349 ms 5 Yes /classes/Product.php:6021
3653
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5472
ORDER BY `position`
0.349 ms 1 Yes /classes/Product.php:3545
3671
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 6154
ORDER BY `position`
0.349 ms 1 Yes /classes/Product.php:3545
674
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2536 AND id_shop=1 LIMIT 1
0.349 ms 1 /classes/Product.php:6876
1092
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2608)
0.349 ms 1 /classes/Product.php:3860
56
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 13) AND (b.`id_shop` = 1) LIMIT 1
0.348 ms 1 /src/Adapter/EntityMapper.php:71
324
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4276) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.348 ms 1 /classes/stock/StockAvailable.php:453
647
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.348 ms 1 /classes/Product.php:5659
2851
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 9102
AND image_shop.`cover` = 1 LIMIT 1
0.348 ms 1 /classes/Product.php:3570
3557
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5040
ORDER BY `position`
0.348 ms 2 Yes /classes/Product.php:3545
4113
SELECT SQL_NO_CACHE *
FROM `hgt78_currency` c
INNER JOIN hgt78_currency_shop currency_shop
ON (currency_shop.id_currency = c.id_currency AND currency_shop.id_shop = 1)
WHERE c.`deleted` = 0 AND c.`active` = 1 ORDER BY `iso_code` ASC
0.348 ms 2 Yes /classes/Currency.php:694
583
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4329
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.347 ms 0 /classes/SpecificPrice.php:259
2757
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 9093)
0.347 ms 1 /classes/Product.php:3860
3668
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 6153
ORDER BY `position`
0.347 ms 1 Yes /classes/Product.php:3545
381
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4259
ORDER BY f.position ASC
0.347 ms 5 Yes /classes/Product.php:6021
2128
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 5470
AND image_shop.`cover` = 1 LIMIT 1
0.347 ms 1 /classes/Product.php:3570
2244
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 6157 AND id_shop=1 LIMIT 1
0.347 ms 1 /classes/Product.php:6876
2578
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 9073 LIMIT 1
0.347 ms 10 /classes/SpecificPrice.php:435
22
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 2) AND (b.`id_shop` = 1) LIMIT 1
0.346 ms 1 /src/Adapter/EntityMapper.php:71
153
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4224 LIMIT 1
0.346 ms 10 /classes/SpecificPrice.php:435
274
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4314 LIMIT 1
0.346 ms 10 /classes/SpecificPrice.php:435
1115
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2844)
0.346 ms 1 /classes/Product.php:3860
1401
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4060)
0.346 ms 1 /classes/Product.php:3860
1406
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4060
ORDER BY f.position ASC
0.346 ms 5 Yes /classes/Product.php:6021
1684
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4576
AND image_shop.`cover` = 1 LIMIT 1
0.346 ms 1 /classes/Product.php:3570
1689
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4576)
0.346 ms 1 /classes/Product.php:3860
1153
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2523
ORDER BY f.position ASC
0.345 ms 5 Yes /classes/Product.php:6021
3389
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2518
ORDER BY `position`
0.345 ms 1 Yes /classes/Product.php:3545
3707
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 7958
ORDER BY `position`
0.345 ms 1 Yes /classes/Product.php:3545
3803
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 9086
ORDER BY `position`
0.345 ms 1 Yes /classes/Product.php:3545
3806
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 9089
ORDER BY `position`
0.345 ms 1 Yes /classes/Product.php:3545
1385
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4048
AND image_shop.`cover` = 1 LIMIT 1
0.344 ms 1 /classes/Product.php:3570
2257
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 6158) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.344 ms 1 /classes/stock/StockAvailable.php:453
2831
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 9100 LIMIT 1
0.344 ms 16 /classes/SpecificPrice.php:435
2935
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 9144 AND `id_group` = 1 LIMIT 1
0.344 ms 0 /classes/GroupReduction.php:156
3401
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2516
ORDER BY `position`
0.344 ms 1 Yes /classes/Product.php:3545
3860
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 9107
ORDER BY `position`
0.344 ms 1 Yes /classes/Product.php:3545
3875
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 9733
ORDER BY `position`
0.344 ms 1 Yes /classes/Product.php:3545
1894
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.344 ms 1 /classes/Product.php:5659
45
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 37) AND (b.`id_shop` = 1) LIMIT 1
0.343 ms 1 /src/Adapter/EntityMapper.php:71
1441
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4090
AND image_shop.`cover` = 1 LIMIT 1
0.343 ms 1 /classes/Product.php:3570
1219
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2516
ORDER BY f.position ASC
0.343 ms 5 Yes /classes/Product.php:6021
2194
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 6153
AND image_shop.`cover` = 1 LIMIT 1
0.343 ms 1 /classes/Product.php:3570
616
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4327
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.342 ms 0 /classes/SpecificPrice.php:259
58
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 19) AND (b.`id_shop` = 1) LIMIT 1
0.342 ms 1 /src/Adapter/EntityMapper.php:71
239
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2554
AND image_shop.`cover` = 1 LIMIT 1
0.342 ms 1 /classes/Product.php:3570
3593
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5052
ORDER BY `position`
0.342 ms 2 Yes /classes/Product.php:3545
3840
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 9100
0.342 ms 1 /classes/Product.php:2902
115
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2553
AND image_shop.`cover` = 1 LIMIT 1
0.341 ms 1 /classes/Product.php:3570
206
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4279
AND image_shop.`cover` = 1 LIMIT 1
0.341 ms 1 /classes/Product.php:3570
4007
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 216) AND (b.`id_shop` = 1) LIMIT 1
0.341 ms 1 /src/Adapter/EntityMapper.php:71
553
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2532 AND id_shop=1 LIMIT 1
0.341 ms 1 /classes/Product.php:6876
1330
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3056
AND image_shop.`cover` = 1 LIMIT 1
0.341 ms 1 /classes/Product.php:3570
2735
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 9091)
0.341 ms 1 /classes/Product.php:3860
3602
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5055
ORDER BY `position`
0.341 ms 2 Yes /classes/Product.php:3545
3908
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 10999
ORDER BY `position`
0.341 ms 1 Yes /classes/Product.php:3545
170
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4286) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.340 ms 1 /classes/stock/StockAvailable.php:453
252
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4317 LIMIT 1
0.340 ms 10 /classes/SpecificPrice.php:435
931
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4213
ORDER BY f.position ASC
0.340 ms 5 Yes /classes/Product.php:6021
3740
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 9059
ORDER BY `position`
0.340 ms 1 Yes /classes/Product.php:3545
55
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 12) AND (b.`id_shop` = 1) LIMIT 1
0.339 ms 1 /src/Adapter/EntityMapper.php:71
59
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 20) AND (b.`id_shop` = 1) LIMIT 1
0.339 ms 1 /src/Adapter/EntityMapper.php:71
2219
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 6155
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.339 ms 0 /classes/SpecificPrice.php:259
3422
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2558
ORDER BY `position`
0.339 ms 1 Yes /classes/Product.php:3545
3797
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 9084
ORDER BY `position`
0.339 ms 1 Yes /classes/Product.php:3545
3650
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5470
ORDER BY `position`
0.339 ms 1 Yes /classes/Product.php:3545
2835
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 9100 AND id_shop=1 LIMIT 1
0.338 ms 1 /classes/Product.php:6876
681
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2537 LIMIT 1
0.338 ms 10 /classes/SpecificPrice.php:435
987
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4105
ORDER BY f.position ASC
0.338 ms 5 Yes /classes/Product.php:6021
2771
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 9094) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.338 ms 1 /classes/stock/StockAvailable.php:453
3686
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 6159
ORDER BY `position`
0.338 ms 1 Yes /classes/Product.php:3545
671
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2536
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.337 ms 0 /classes/SpecificPrice.php:259
1487
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4148 LIMIT 1
0.337 ms 10 /classes/SpecificPrice.php:435
6
SELECT SQL_NO_CACHE l.*, ls.`id_shop`
FROM `hgt78_lang` l
LEFT JOIN `hgt78_lang_shop` ls ON (l.id_lang = ls.id_lang)
0.337 ms 6 /classes/Language.php:1080
44
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 36) AND (b.`id_shop` = 1) LIMIT 1
0.337 ms 1 /src/Adapter/EntityMapper.php:71
720
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2541) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.337 ms 1 /classes/stock/StockAvailable.php:453
1335
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3056)
0.337 ms 1 /classes/Product.php:3860
3033
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 10852
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.337 ms 1 /classes/SpecificPrice.php:259
3563
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5042
ORDER BY `position`
0.337 ms 2 Yes /classes/Product.php:3545
3623
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5158
ORDER BY `position`
0.336 ms 1 Yes /classes/Product.php:3545
1395
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4048
ORDER BY f.position ASC
0.336 ms 5 Yes /classes/Product.php:6021
1644
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4304)
0.336 ms 1 /classes/Product.php:3860
1970
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 5057
AND image_shop.`cover` = 1 LIMIT 1
0.336 ms 2 /classes/Product.php:3570
2082
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 5322
AND image_shop.`cover` = 1 LIMIT 1
0.336 ms 1 /classes/Product.php:3570
2700
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 9086
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.336 ms 0 /classes/SpecificPrice.php:259
3008
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 228 LIMIT 1
0.336 ms 1 /classes/Product.php:5659
3981
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 344 AND `id_shop` = 1
0.336 ms 6 /src/Adapter/EntityMapper.php:79
2565
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 9072
AND image_shop.`cover` = 1 LIMIT 1
0.335 ms 1 /classes/Product.php:3570
51
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 40) AND (b.`id_shop` = 1) LIMIT 1
0.334 ms 1 /src/Adapter/EntityMapper.php:71
833
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2544
AND image_shop.`cover` = 1 LIMIT 1
0.334 ms 2 /classes/Product.php:3570
902
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4214
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.334 ms 0 /classes/SpecificPrice.php:259
1362
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4044
ORDER BY f.position ASC
0.334 ms 5 Yes /classes/Product.php:6021
3662
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 6151
ORDER BY `position`
0.334 ms 1 Yes /classes/Product.php:3545
1672
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4573
AND image_shop.`cover` = 1 LIMIT 1
0.333 ms 1 /classes/Product.php:3570
3638
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5322
ORDER BY `position`
0.333 ms 1 Yes /classes/Product.php:3545
4019
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 37) AND (b.`id_shop` = 1) LIMIT 1
0.333 ms 1 /src/Adapter/EntityMapper.php:71
775
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2549) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.333 ms 1 /classes/stock/StockAvailable.php:453
4053
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 35) AND (b.`id_shop` = 1) LIMIT 1
0.333 ms 1 /src/Adapter/EntityMapper.php:71
1695
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4577
AND image_shop.`cover` = 1 LIMIT 1
0.332 ms 1 /classes/Product.php:3570
3728
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 8985
ORDER BY `position`
0.332 ms 1 Yes /classes/Product.php:3545
3
SELECT SQL_NO_CACHE value FROM `hgt78_configuration` WHERE `name` = "PS_MULTISHOP_FEATURE_ACTIVE" LIMIT 1
0.332 ms 1 /classes/shop/Shop.php:1183
54
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 11) AND (b.`id_shop` = 1) LIMIT 1
0.332 ms 1 /src/Adapter/EntityMapper.php:71
1021
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4069
AND image_shop.`cover` = 1 LIMIT 1
0.332 ms 1 /classes/Product.php:3570
148
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4225) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.331 ms 1 /classes/stock/StockAvailable.php:453
660
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4321
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.331 ms 0 /classes/SpecificPrice.php:259
4388
SELECT SQL_NO_CACHE c.`nleft`, c.`nright`  FROM `hgt78_category` c
LEFT JOIN `hgt78_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`id_category` = 2 LIMIT 1
0.331 ms 1 /classes/Category.php:1585
632
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4324) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.330 ms 1 /classes/stock/StockAvailable.php:453
294
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4278
AND image_shop.`cover` = 1 LIMIT 1
0.330 ms 1 /classes/Product.php:3570
307
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4277 LIMIT 1
0.330 ms 10 /classes/SpecificPrice.php:435
2251
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 6158 LIMIT 1
0.330 ms 12 /classes/SpecificPrice.php:435
2507
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 9063
ORDER BY f.position ASC
0.330 ms 5 Yes /classes/Product.php:6021
2976
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 10423 LIMIT 1
0.330 ms 10 /classes/SpecificPrice.php:435
5
SELECT SQL_NO_CACHE su.physical_uri, su.virtual_uri, su.domain, su.domain_ssl
FROM hgt78_shop s
LEFT JOIN hgt78_shop_url su ON (s.id_shop = su.id_shop)
WHERE s.id_shop = 1
AND s.active = 1 AND s.deleted = 0 AND su.main = 1 LIMIT 1
0.329 ms 1 /classes/shop/Shop.php:218
1933
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 5053 AND `id_group` = 1 LIMIT 1
0.329 ms 0 /classes/GroupReduction.php:156
2977
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 10423
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.329 ms 1 /classes/SpecificPrice.php:259
3644
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5332
ORDER BY `position`
0.329 ms 1 Yes /classes/Product.php:3545
3677
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 6156
ORDER BY `position`
0.329 ms 1 Yes /classes/Product.php:3545
53
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 319) AND (b.`id_shop` = 1) LIMIT 1
0.328 ms 1 /src/Adapter/EntityMapper.php:71
747
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4281 LIMIT 1
0.328 ms 10 /classes/SpecificPrice.php:435
2036
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 5159
AND image_shop.`cover` = 1 LIMIT 1
0.328 ms 1 /classes/Product.php:3570
2433
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 8986 LIMIT 1
0.328 ms 17 /classes/SpecificPrice.php:435
3620
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5081
ORDER BY `position`
0.328 ms 1 Yes /classes/Product.php:3545
3743
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 9061
ORDER BY `position`
0.328 ms 1 Yes /classes/Product.php:3545
3917
SELECT SQL_NO_CACHE 1 FROM hgt78_cart_product cp INNER JOIN hgt78_product p
ON (p.id_product = cp.id_product) INNER JOIN hgt78_product_shop ps
ON (ps.id_shop = cp.id_shop AND ps.id_product = p.id_product) WHERE cp.id_cart=0 LIMIT 1
0.328 ms 1 /classes/Cart.php:4255
740
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2546 AND id_shop=1 LIMIT 1
0.328 ms 1 /classes/Product.php:6876
3758
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 9069
ORDER BY `position`
0.328 ms 1 Yes /classes/Product.php:3545
140
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4225
AND image_shop.`cover` = 1 LIMIT 1
0.327 ms 1 /classes/Product.php:3570
531
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2529 AND id_shop=1 LIMIT 1
0.327 ms 1 /classes/Product.php:6876
3086
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 10999
AND image_shop.`cover` = 1 LIMIT 1
0.327 ms 1 /classes/Product.php:3570
3791
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 9081
ORDER BY `position`
0.327 ms 1 Yes /classes/Product.php:3545
3572
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5045
ORDER BY `position`
0.327 ms 2 Yes /classes/Product.php:3545
4011
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 51) LIMIT 1
0.327 ms 1 /src/Adapter/EntityMapper.php:71
75
SELECT SQL_NO_CACHE *
FROM `hgt78_carrier` a
LEFT JOIN `hgt78_carrier_shop` `c` ON a.`id_carrier` = c.`id_carrier` AND c.`id_shop` = 1
WHERE (a.`id_carrier` = 282) LIMIT 1
0.326 ms 1 /src/Adapter/EntityMapper.php:71
1059
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3042)
0.326 ms 1 /classes/Product.php:3860
2537
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 9069)
0.326 ms 1 /classes/Product.php:3860
2760
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 9093) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.326 ms 1 /classes/stock/StockAvailable.php:453
220
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4309
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.326 ms 0 /classes/SpecificPrice.php:259
586
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4329 AND id_shop=1 LIMIT 1
0.326 ms 1 /classes/Product.php:6876
1253
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2526
AND image_shop.`cover` = 1 LIMIT 1
0.326 ms 1 /classes/Product.php:3570
1341
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4043
AND image_shop.`cover` = 1 LIMIT 1
0.326 ms 1 /classes/Product.php:3570
1485
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4148
AND image_shop.`cover` = 1 LIMIT 1
0.326 ms 1 /classes/Product.php:3570
1595
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4207
AND image_shop.`cover` = 1 LIMIT 1
0.326 ms 1 /classes/Product.php:3570
3064
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 10926
AND image_shop.`cover` = 1 LIMIT 1
0.326 ms 1 /classes/Product.php:3570
3569
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5044
ORDER BY `position`
0.326 ms 2 Yes /classes/Product.php:3545
217
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4309
AND image_shop.`cover` = 1 LIMIT 1
0.325 ms 1 /classes/Product.php:3570
964
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4112
ORDER BY f.position ASC
0.325 ms 5 Yes /classes/Product.php:6021
942
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4114
ORDER BY f.position ASC
0.325 ms 5 Yes /classes/Product.php:6021
999
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4106
AND image_shop.`cover` = 1 LIMIT 1
0.325 ms 1 /classes/Product.php:3570
1728
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 5033
AND image_shop.`cover` = 1 LIMIT 1
0.325 ms 2 /classes/Product.php:3570
3683
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 6158
ORDER BY `position`
0.325 ms 1 Yes /classes/Product.php:3545
493
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.324 ms 1 /classes/Product.php:5659
547
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2532
AND image_shop.`cover` = 1 LIMIT 1
0.324 ms 1 /classes/Product.php:3570
1121
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4088
AND image_shop.`cover` = 1 LIMIT 1
0.324 ms 1 /classes/Product.php:3570
3632
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5174
ORDER BY `position`
0.324 ms 1 Yes /classes/Product.php:3545
3866
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 9144
ORDER BY `position`
0.324 ms 1 Yes /classes/Product.php:3545
3977
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 34) AND (b.`id_shop` = 1) LIMIT 1
0.324 ms 1 /src/Adapter/EntityMapper.php:71
1230
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2474
ORDER BY f.position ASC
0.323 ms 5 Yes /classes/Product.php:6021
3383
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2523
ORDER BY `position`
0.322 ms 1 Yes /classes/Product.php:3545
3488
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4142
ORDER BY `position`
0.322 ms 1 Yes /classes/Product.php:3545
3746
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 9062
ORDER BY `position`
0.322 ms 1 Yes /classes/Product.php:3545
3881
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 10424
ORDER BY `position`
0.322 ms 1 Yes /classes/Product.php:3545
57
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 18) AND (b.`id_shop` = 1) LIMIT 1
0.321 ms 1 /src/Adapter/EntityMapper.php:71
2294
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 6664
AND image_shop.`cover` = 1 LIMIT 1
0.321 ms 1 /classes/Product.php:3570
2743
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 9092 LIMIT 1
0.321 ms 18 /classes/SpecificPrice.php:435
26
SELECT SQL_NO_CACHE *
FROM `hgt78_currency` a
LEFT JOIN `hgt78_currency_lang` `b` ON a.`id_currency` = b.`id_currency` AND b.`id_lang` = 1
LEFT JOIN `hgt78_currency_shop` `c` ON a.`id_currency` = c.`id_currency` AND c.`id_shop` = 1
WHERE (a.`id_currency` = 1) LIMIT 1
0.321 ms 1 /src/Adapter/EntityMapper.php:71
404
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4266
AND image_shop.`cover` = 1 LIMIT 1
0.321 ms 1 /classes/Product.php:3570
3680
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 6157
ORDER BY `position`
0.321 ms 1 Yes /classes/Product.php:3545
1562
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4195
AND image_shop.`cover` = 1 LIMIT 1
0.320 ms 1 /classes/Product.php:3570
1866
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 5047 AND id_shop=1 LIMIT 1
0.320 ms 1 /classes/Product.php:6876
3089
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 10999 LIMIT 1
0.320 ms 15 /classes/SpecificPrice.php:435
76
SELECT SQL_NO_CACHE *
FROM `hgt78_carrier_lang`
WHERE `id_carrier` = 282 AND `id_shop` = 1
0.320 ms 198 /src/Adapter/EntityMapper.php:79
1175
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM hgt78_feature_product pf
LEFT JOIN hgt78_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN hgt78_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN hgt78_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN hgt78_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2518
ORDER BY f.position ASC
0.320 ms 5 Yes /classes/Product.php:6021
1192
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2487)
0.320 ms 1 /classes/Product.php:3860
2399
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 8978 LIMIT 1
0.320 ms 14 /classes/SpecificPrice.php:435
2476
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 228 LIMIT 1
0.320 ms 1 /classes/Product.php:5659
2603
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 9075)
0.320 ms 1 /classes/Product.php:3860
2958
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 9266 AND id_shop=1 LIMIT 1
0.320 ms 1 /classes/Product.php:6876
2997
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 228 LIMIT 1
0.320 ms 1 /classes/Product.php:5659
3585
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 5049
0.320 ms 1 /classes/Product.php:2902
4104
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 39) AND (b.`id_shop` = 1) LIMIT 1
0.320 ms 1 /src/Adapter/EntityMapper.php:71
117
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.319 ms 1 /classes/Product.php:5659
417
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4275 LIMIT 1
0.319 ms 10 /classes/SpecificPrice.php:435
3021
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 10576 LIMIT 1
0.319 ms 10 /classes/SpecificPrice.php:435
3299
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3554
ORDER BY `position`
0.319 ms 1 Yes /classes/Product.php:3545
3381
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4080
0.319 ms 1 /classes/Product.php:2902
3485
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4146
ORDER BY `position`
0.319 ms 1 Yes /classes/Product.php:3545
509
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4318 AND id_shop=1 LIMIT 1
0.318 ms 1 /classes/Product.php:6876
522
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2528) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.318 ms 1 /classes/stock/StockAvailable.php:453
737
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2546
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.318 ms 0 /classes/SpecificPrice.php:259
948
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4113)
0.318 ms 1 /classes/Product.php:3860
1917
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 5052 LIMIT 1
0.318 ms 10 /classes/SpecificPrice.php:435
2925
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 9108) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.318 ms 1 /classes/stock/StockAvailable.php:453
3036
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 10852 AND id_shop=1 LIMIT 1
0.318 ms 1 /classes/Product.php:6876
3049
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 10853) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.318 ms 1 /classes/stock/StockAvailable.php:453
3497
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4195
ORDER BY `position`
0.318 ms 1 Yes /classes/Product.php:3545
3521
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4227
ORDER BY `position`
0.318 ms 1 Yes /classes/Product.php:3545
845
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.318 ms 1 /classes/Product.php:5659
1187
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2487
AND image_shop.`cover` = 1 LIMIT 1
0.318 ms 1 /classes/Product.php:3570
3788
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 9079
ORDER BY `position`
0.318 ms 1 Yes /classes/Product.php:3545
862
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3553 AND `id_group` = 1 LIMIT 1
0.317 ms 0 /classes/GroupReduction.php:156
918
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4210) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.317 ms 1 /classes/stock/StockAvailable.php:453
1123
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4088 LIMIT 1
0.317 ms 10 /classes/SpecificPrice.php:435
2185
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 6152 LIMIT 1
0.317 ms 11 /classes/SpecificPrice.php:435
3722
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 8978
ORDER BY `position`
0.317 ms 1 Yes /classes/Product.php:3545
648
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4322 LIMIT 1
0.317 ms 10 /classes/SpecificPrice.php:435
1551
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4183
AND image_shop.`cover` = 1 LIMIT 1
0.317 ms 1 /classes/Product.php:3570
1573
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4196
AND image_shop.`cover` = 1 LIMIT 1
0.317 ms 1 /classes/Product.php:3570
1663
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4572 LIMIT 1
0.317 ms 10 /classes/SpecificPrice.php:435
2589
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 9074 LIMIT 1
0.317 ms 10 /classes/SpecificPrice.php:435
2970
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 9733 AND `id_group` = 1 LIMIT 1
0.317 ms 0 /classes/GroupReduction.php:156
3665
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 6152
ORDER BY `position`
0.317 ms 1 Yes /classes/Product.php:3545
4390
SELECT SQL_NO_CACHE c.*, cl.*  FROM `hgt78_category` c
LEFT JOIN `hgt78_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`nleft` <= 2 AND c.`nright` >= 577 AND c.`nleft` >= 1 AND c.`nright` <= 590 ORDER BY `nleft` DESC
0.316 ms 2 /classes/Category.php:1600
2526
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 9068)
0.316 ms 1 /classes/Product.php:3860
772
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2549)
0.315 ms 1 /classes/Product.php:3860
4006
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 35 AND `id_shop` = 1
0.315 ms 6 /src/Adapter/EntityMapper.php:79
757
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.314 ms 1 /classes/Product.php:5659
192
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4282) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.314 ms 1 /classes/stock/StockAvailable.php:453
895
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4216 AND `id_group` = 1 LIMIT 1
0.314 ms 0 /classes/GroupReduction.php:156
1733
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 5033)
0.314 ms 1 /classes/Product.php:3860
2373
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2515
AND image_shop.`cover` = 1 LIMIT 1
0.314 ms 1 /classes/Product.php:3570
2572
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 9072 AND `id_group` = 1 LIMIT 1
0.314 ms 0 /classes/GroupReduction.php:156
3734
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 9057
ORDER BY `position`
0.314 ms 1 Yes /classes/Product.php:3545
599
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4328) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.313 ms 1 /classes/stock/StockAvailable.php:453
2285
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 6435 LIMIT 1
0.313 ms 10 /classes/SpecificPrice.php:435
71
SELECT SQL_NO_CACHE *
FROM `hgt78_shop_url` a0
0.313 ms 1 /classes/PrestaShopCollection.php:383
2141
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 5472 LIMIT 1
0.313 ms 10 /classes/SpecificPrice.php:435
2721
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 9090 LIMIT 1
0.313 ms 13 /classes/SpecificPrice.php:435
236
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4310) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.312 ms 1 /classes/stock/StockAvailable.php:453
2617
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 9076) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.312 ms 1 /classes/stock/StockAvailable.php:453
3015
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 10469) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.312 ms 1 /classes/stock/StockAvailable.php:453
3407
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2524
ORDER BY `position`
0.312 ms 1 Yes /classes/Product.php:3545
63
SELECT SQL_NO_CACHE * FROM `hgt78_image_type` WHERE 1 AND `products` = 1  ORDER BY `width` DESC, `height` DESC, `name`ASC
0.311 ms 8 Yes /classes/ImageType.php:109
1216
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2516 AND `id_group` = 1 LIMIT 1
0.311 ms 0 /classes/GroupReduction.php:156
3350
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4074
ORDER BY `position`
0.311 ms 1 Yes /classes/Product.php:3545
3884
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 10467
ORDER BY `position`
0.311 ms 1 Yes /classes/Product.php:3545
1772
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 5039
AND image_shop.`cover` = 1 LIMIT 1
0.310 ms 2 /classes/Product.php:3570
1975
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 5057)
0.310 ms 1 /classes/Product.php:3860
1463
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4130
AND image_shop.`cover` = 1 LIMIT 1
0.310 ms 1 /classes/Product.php:3570
1496
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4140
AND image_shop.`cover` = 1 LIMIT 1
0.310 ms 1 /classes/Product.php:3570
2059
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 5174
AND image_shop.`cover` = 1 LIMIT 1
0.310 ms 1 /classes/Product.php:3570
3641
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5331
ORDER BY `position`
0.310 ms 1 Yes /classes/Product.php:3545
498
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2547 AND id_shop=1 LIMIT 1
0.309 ms 1 /classes/Product.php:6876
1379
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4047)
0.309 ms 1 /classes/Product.php:3860
1628
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4306
AND image_shop.`cover` = 1 LIMIT 1
0.309 ms 1 /classes/Product.php:3570
1818
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 5043 LIMIT 1
0.309 ms 10 /classes/SpecificPrice.php:435
2120
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 5334
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.309 ms 0 /classes/SpecificPrice.php:259
2590
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 9074
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.309 ms 0 /classes/SpecificPrice.php:259
1584
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4206
AND image_shop.`cover` = 1 LIMIT 1
0.308 ms 1 /classes/Product.php:3570
1739
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 5036
AND image_shop.`cover` = 1 LIMIT 1
0.308 ms 2 /classes/Product.php:3570
2168
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 6044 AND `id_group` = 1 LIMIT 1
0.308 ms 0 /classes/GroupReduction.php:156
538
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2531 LIMIT 1
0.308 ms 10 /classes/SpecificPrice.php:435
1932
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 5053 AND id_shop=1 LIMIT 1
0.308 ms 1 /classes/Product.php:6876
1165
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2518
AND image_shop.`cover` = 1 LIMIT 1
0.307 ms 1 /classes/Product.php:3570
2648
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 9079 AND id_shop=1 LIMIT 1
0.307 ms 1 /classes/Product.php:6876
2655
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 9081 LIMIT 1
0.307 ms 17 /classes/SpecificPrice.php:435
3782
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 9077
ORDER BY `position`
0.307 ms 1 Yes /classes/Product.php:3545
4074
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 33) AND (b.`id_shop` = 1) LIMIT 1
0.307 ms 1 /src/Adapter/EntityMapper.php:71
1895
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 5050 LIMIT 1
0.306 ms 10 /classes/SpecificPrice.php:435
322
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4276 AND id_shop=1 LIMIT 1
0.305 ms 1 /classes/Product.php:6876
3510
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4303
0.305 ms 1 /classes/Product.php:2902
9
SELECT SQL_NO_CACHE *
FROM `hgt78_lang` a
LEFT JOIN `hgt78_lang_shop` `c` ON a.`id_lang` = c.`id_lang` AND c.`id_shop` = 1
WHERE (a.`id_lang` = 1) LIMIT 1
0.304 ms 1 /src/Adapter/EntityMapper.php:71
1471
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4130) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.304 ms 1 /classes/stock/StockAvailable.php:453
1650
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4227
AND image_shop.`cover` = 1 LIMIT 1
0.304 ms 1 /classes/Product.php:3570
2000
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 5059) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.304 ms 1 /classes/stock/StockAvailable.php:453
2028
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 5158
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.304 ms 0 /classes/SpecificPrice.php:259
1890
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 5049) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.303 ms 1 /classes/stock/StockAvailable.php:453
4407
INSERT INTO `hgt78_connections_source` (`id_connections`, `http_referer`, `request_uri`, `keywords`, `date_add`) VALUES ('104206', '', 'www.encens.fr/2-accueil?productListView=grid&q=Cat%C3%A9gories-Coffret-Esot%C3%A9risme%2FDisponibilit%C3%A9-En+stock&resultsPerPage=99999', '', '2025-05-01 13:50:20')
0.303 ms 1 /classes/ObjectModel.php:622
66
SELECT SQL_NO_CACHE *
FROM `hgt78_country` a
LEFT JOIN `hgt78_country_shop` `c` ON a.`id_country` = c.`id_country` AND c.`id_shop` = 1
WHERE (a.`id_country` = 8) LIMIT 1
0.302 ms 1 /src/Adapter/EntityMapper.php:71
1945
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 5054) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.302 ms 1 /classes/stock/StockAvailable.php:453
2131
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 5470
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.302 ms 0 /classes/SpecificPrice.php:259
1700
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4577)
0.301 ms 1 /classes/Product.php:3860
2224
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 6155) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.301 ms 1 /classes/stock/StockAvailable.php:453
2796
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 9097
AND image_shop.`cover` = 1 LIMIT 1
0.301 ms 1 /classes/Product.php:3570
1474
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4133
AND image_shop.`cover` = 1 LIMIT 1
0.301 ms 1 /classes/Product.php:3570
1794
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 5041
AND image_shop.`cover` = 1 LIMIT 1
0.301 ms 2 /classes/Product.php:3570
1849
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 5046
AND image_shop.`cover` = 1 LIMIT 1
0.301 ms 2 /classes/Product.php:3570
2963
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 9733
AND image_shop.`cover` = 1 LIMIT 1
0.301 ms 1 /classes/Product.php:3570
4406
SELECT SQL_NO_CACHE `id_guest`
FROM `hgt78_connections`
WHERE `id_guest` = 192286
AND `date_add` > '2025-05-01 13:20:00'
AND id_shop IN (1) 
ORDER BY `date_add` DESC LIMIT 1
0.301 ms 1 Yes /classes/Connection.php:168
2279
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 6198) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.300 ms 1 /classes/stock/StockAvailable.php:453
2859
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 9102) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.300 ms 1 /classes/stock/StockAvailable.php:453
698
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2543) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.299 ms 1 /classes/stock/StockAvailable.php:453
110
SELECT SQL_NO_CACHE tr.*
FROM `hgt78_tax_rule` tr
JOIN `hgt78_tax_rules_group` trg ON (tr.`id_tax_rules_group` = trg.`id_tax_rules_group`)
WHERE trg.`active` = 1
AND tr.`id_country` = 8
AND tr.`id_tax_rules_group` = 0
AND tr.`id_state` IN (0, 0)
AND ('04510' BETWEEN tr.`zipcode_from` AND tr.`zipcode_to`
OR (tr.`zipcode_to` = 0 AND tr.`zipcode_from` IN(0, '04510')))
ORDER BY tr.`zipcode_from` DESC, tr.`zipcode_to` DESC, tr.`id_state` DESC, tr.`id_country` DESC
0.299 ms 0 /classes/tax/TaxRulesTaxManager.php:109
1209
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2516
AND image_shop.`cover` = 1 LIMIT 1
0.299 ms 1 /classes/Product.php:3570
2157
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 6043 AND `id_group` = 1 LIMIT 1
0.299 ms 0 /classes/GroupReduction.php:156
2162
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.299 ms 1 /classes/Product.php:5659
48
SELECT SQL_NO_CACHE * FROM `hgt78_image_type` WHERE 1 AND `categories` = 1  ORDER BY `width` DESC, `height` DESC, `name`ASC
0.298 ms 8 Yes /classes/ImageType.php:109
3930
SELECT SQL_NO_CACHE *
FROM `hgt78_currency` c
INNER JOIN hgt78_currency_shop currency_shop
ON (currency_shop.id_currency = c.id_currency AND currency_shop.id_shop = 1)
WHERE c.`deleted` = 0 AND c.`active` = 1 ORDER BY `iso_code` ASC
0.298 ms 2 Yes /classes/Currency.php:694
2414
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 8984)
0.298 ms 1 /classes/Product.php:3860
3959
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 50) LIMIT 1
0.297 ms 1 /src/Adapter/EntityMapper.php:71
393
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4212
AND image_shop.`cover` = 1 LIMIT 1
0.297 ms 1 /classes/Product.php:3570
1938
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.297 ms 1 /classes/Product.php:5659
1061
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3042 AND `id_group` = 1 LIMIT 1
0.296 ms 0 /classes/GroupReduction.php:156
3870
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 9262
0.296 ms 1 /classes/Product.php:2902
448
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4271
AND image_shop.`cover` = 1 LIMIT 1
0.295 ms 1 /classes/Product.php:3570
4009
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 44) LIMIT 1
0.295 ms 1 /src/Adapter/EntityMapper.php:71
1103
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2606)
0.294 ms 1 /classes/Product.php:3860
1264
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2599
AND image_shop.`cover` = 1 LIMIT 1
0.294 ms 1 /classes/Product.php:3570
1606
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4303
AND image_shop.`cover` = 1 LIMIT 1
0.294 ms 1 /classes/Product.php:3570
1639
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4304
AND image_shop.`cover` = 1 LIMIT 1
0.294 ms 1 /classes/Product.php:3570
1899
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 5050 AND id_shop=1 LIMIT 1
0.294 ms 1 /classes/Product.php:6876
2710
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 9089 LIMIT 1
0.294 ms 14 /classes/SpecificPrice.php:435
2947
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 9262 AND `id_group` = 1 LIMIT 1
0.294 ms 0 /classes/GroupReduction.php:156
1258
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2526)
0.293 ms 1 /classes/Product.php:3860
1817
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.293 ms 1 /classes/Product.php:5659
2571
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 9072 AND id_shop=1 LIMIT 1
0.293 ms 1 /classes/Product.php:6876
3043
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 10853 LIMIT 1
0.293 ms 11 /classes/SpecificPrice.php:435
3293
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `hgt78_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2540
ORDER BY `position`
0.293 ms 1 Yes /classes/Product.php:3545
2206
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.292 ms 1 /classes/Product.php:5659
2964
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 214 LIMIT 1
0.292 ms 1 /classes/Product.php:5659
3970
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 185 AND `id_shop` = 1
0.292 ms 6 /src/Adapter/EntityMapper.php:79
1905
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.291 ms 1 /classes/Product.php:5659
3949
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 71) LIMIT 1
0.291 ms 1 /src/Adapter/EntityMapper.php:71
4021
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 37) LIMIT 1
0.291 ms 1 /src/Adapter/EntityMapper.php:71
2147
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 5472) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.291 ms 1 /classes/stock/StockAvailable.php:453
3990
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 54 AND `id_shop` = 1
0.291 ms 6 /src/Adapter/EntityMapper.php:79
159
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4224) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.290 ms 1 /classes/stock/StockAvailable.php:453
2600
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 9075 LIMIT 1
0.290 ms 16 /classes/SpecificPrice.php:435
3873
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 9266
0.290 ms 1 /classes/Product.php:2902
225
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4309) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.290 ms 1 /classes/stock/StockAvailable.php:453
3939
SELECT SQL_NO_CACHE `id_module` FROM `hgt78_module_shop` WHERE `id_module` = 90 AND `id_shop` = 1 LIMIT 1
0.290 ms 1 /classes/module/Module.php:2137
603
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.289 ms 1 /classes/Product.php:5659
714
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2541 LIMIT 1
0.289 ms 10 /classes/SpecificPrice.php:435
1791
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 5040) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.289 ms 1 /classes/stock/StockAvailable.php:453
1906
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 5051 LIMIT 1
0.289 ms 10 /classes/SpecificPrice.php:435
2004
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.289 ms 1 /classes/Product.php:5659
2273
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 6198 LIMIT 1
0.289 ms 10 /classes/SpecificPrice.php:435
3534
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4577
0.289 ms 1 /classes/Product.php:2902
537
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.288 ms 1 /classes/Product.php:5659
713
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.288 ms 1 /classes/Product.php:5659
3968
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 175 AND `id_shop` = 1
0.288 ms 6 /src/Adapter/EntityMapper.php:79
4051
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 307) LIMIT 1
0.288 ms 1 /src/Adapter/EntityMapper.php:71
23
SELECT SQL_NO_CACHE * FROM `hgt78_currency` c ORDER BY `iso_code` ASC
0.287 ms 2 Yes /classes/Currency.php:709
3946
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 40 AND `id_shop` = 1
0.287 ms 6 /src/Adapter/EntityMapper.php:79
3983
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 45) LIMIT 1
0.287 ms 1 /src/Adapter/EntityMapper.php:71
4002
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 200) LIMIT 1
0.287 ms 1 /src/Adapter/EntityMapper.php:71
4015
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 192) LIMIT 1
0.287 ms 1 /src/Adapter/EntityMapper.php:71
1901
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 5050) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.286 ms 1 /classes/stock/StockAvailable.php:453
687
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2537) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.286 ms 1 /classes/stock/StockAvailable.php:453
2581
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 9073)
0.286 ms 1 /classes/Product.php:3860
3936
SELECT SQL_NO_CACHE SUM(`quantity`)
FROM `hgt78_cart_product`
WHERE `id_cart` = 0 LIMIT 1
0.286 ms 1 /classes/Cart.php:1303
2837
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 9100) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.285 ms 1 /classes/stock/StockAvailable.php:453
3210
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2528
0.285 ms 1 /classes/Product.php:2902
318
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4276 LIMIT 1
0.285 ms 11 /classes/SpecificPrice.php:435
4034
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 162 AND `id_shop` = 1
0.285 ms 6 /src/Adapter/EntityMapper.php:79
894
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4216 AND id_shop=1 LIMIT 1
0.284 ms 1 /classes/Product.php:6876
2998
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 10467 LIMIT 1
0.284 ms 10 /classes/SpecificPrice.php:435
3066
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 10926 LIMIT 1
0.284 ms 10 /classes/SpecificPrice.php:435
3972
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 186 AND `id_shop` = 1
0.284 ms 6 /src/Adapter/EntityMapper.php:79
549
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2532 LIMIT 1
0.283 ms 10 /classes/SpecificPrice.php:435
1048
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3184)
0.283 ms 1 /classes/Product.php:3860
1475
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.283 ms 1 /classes/Product.php:5659
1532
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4142
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.283 ms 0 /classes/SpecificPrice.php:259
2720
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 228 LIMIT 1
0.283 ms 1 /classes/Product.php:5659
3882
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 10424
0.283 ms 1 /classes/Product.php:2902
3963
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 72) LIMIT 1
0.283 ms 1 /src/Adapter/EntityMapper.php:71
1137
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4080)
0.282 ms 1 /classes/Product.php:3860
3234
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2493
0.282 ms 1 /classes/Product.php:2902
4087
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 191 AND `id_shop` = 1
0.282 ms 6 /src/Adapter/EntityMapper.php:79
956
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4112 LIMIT 1
0.281 ms 10 /classes/SpecificPrice.php:435
1032
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4074
AND image_shop.`cover` = 1 LIMIT 1
0.281 ms 1 /classes/Product.php:3570
614
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.281 ms 1 /classes/Product.php:5659
693
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2543
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.281 ms 0 /classes/SpecificPrice.php:259
1155
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.281 ms 1 /classes/Product.php:5659
1761
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 5038
AND image_shop.`cover` = 1 LIMIT 1
0.281 ms 2 /classes/Product.php:3570
154
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4224
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.280 ms 0 /classes/SpecificPrice.php:259
615
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4327 LIMIT 1
0.280 ms 10 /classes/SpecificPrice.php:435
993
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4109)
0.280 ms 1 /classes/Product.php:3860
3055
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 10891 LIMIT 1
0.280 ms 11 /classes/SpecificPrice.php:435
965
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4111
AND image_shop.`cover` = 1 LIMIT 1
0.280 ms 1 /classes/Product.php:3570
1286
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2558
AND image_shop.`cover` = 1 LIMIT 1
0.280 ms 1 /classes/Product.php:3570
1070
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3041)
0.279 ms 1 /classes/Product.php:3860
2393
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2491) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.279 ms 1 /classes/stock/StockAvailable.php:453
2943
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 9262
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.279 ms 0 /classes/SpecificPrice.php:259
4080
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 66) LIMIT 1
0.279 ms 1 /src/Adapter/EntityMapper.php:71
223
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4309 AND id_shop=1 LIMIT 1
0.278 ms 1 /classes/Product.php:6876
264
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4315
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.278 ms 0 /classes/SpecificPrice.php:259
702
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.278 ms 1 /classes/Product.php:5659
2011
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 5078) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.278 ms 1 /classes/stock/StockAvailable.php:453
3961
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 62) LIMIT 1
0.278 ms 1 /src/Adapter/EntityMapper.php:71
3997
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 78 AND `id_shop` = 1
0.278 ms 6 /src/Adapter/EntityMapper.php:79
32
SELECT SQL_NO_CACHE *
FROM `hgt78_currency` a
LEFT JOIN `hgt78_currency_shop` `c` ON a.`id_currency` = c.`id_currency` AND c.`id_shop` = 1
WHERE (a.`id_currency` = 1) LIMIT 1
0.277 ms 1 /src/Adapter/EntityMapper.php:71
175
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4285 LIMIT 1
0.277 ms 10 /classes/SpecificPrice.php:435
1214
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2516)
0.277 ms 1 /classes/Product.php:3860
1843
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 5045)
0.277 ms 1 /classes/Product.php:3860
2491
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 9062)
0.277 ms 1 /classes/Product.php:3860
3974
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 190 AND `id_shop` = 1
0.277 ms 6 /src/Adapter/EntityMapper.php:79
943
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4113
AND image_shop.`cover` = 1 LIMIT 1
0.277 ms 1 /classes/Product.php:3570
2487
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 228 LIMIT 1
0.277 ms 1 /classes/Product.php:5659
4013
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 56) LIMIT 1
0.277 ms 1 /src/Adapter/EntityMapper.php:71
587
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4329 AND `id_group` = 1 LIMIT 1
0.276 ms 0 /classes/GroupReduction.php:156
1162
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2522) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.276 ms 1 /classes/stock/StockAvailable.php:453
1368
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4046)
0.276 ms 1 /classes/Product.php:3860
2992
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 10424 AND `id_group` = 1 LIMIT 1
0.276 ms 0 /classes/GroupReduction.php:156
654
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4322) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.276 ms 1 /classes/stock/StockAvailable.php:453
1098
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2606
AND image_shop.`cover` = 1 LIMIT 1
0.276 ms 1 /classes/Product.php:3570
1170
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2518)
0.276 ms 1 /classes/Product.php:3860
2744
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 9092
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.276 ms 0 /classes/SpecificPrice.php:259
96
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE `id_product` != 0 LIMIT 1
0.275 ms 22288 /classes/SpecificPrice.php:297
1755
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 5037)
0.275 ms 1 /classes/Product.php:3860
2738
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 9091) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.275 ms 1 /classes/stock/StockAvailable.php:453
3945
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 40) LIMIT 1
0.275 ms 1 /src/Adapter/EntityMapper.php:71
889
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.274 ms 1 /classes/Product.php:5659
1037
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4074)
0.274 ms 1 /classes/Product.php:3860
1154
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2522
AND image_shop.`cover` = 1 LIMIT 1
0.274 ms 1 /classes/Product.php:3570
1442
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.274 ms 1 /classes/Product.php:5659
4029
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 74) LIMIT 1
0.274 ms 1 /src/Adapter/EntityMapper.php:71
366
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4260 AND id_shop=1 LIMIT 1
0.273 ms 1 /classes/Product.php:6876
548
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.273 ms 1 /classes/Product.php:5659
1454
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4129 LIMIT 1
0.273 ms 10 /classes/SpecificPrice.php:435
2920
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 9108
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.273 ms 0 /classes/SpecificPrice.php:259
2936
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 9144) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.273 ms 1 /classes/stock/StockAvailable.php:453
3387
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2522
0.273 ms 1 /classes/Product.php:2902
3948
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 55 AND `id_shop` = 1
0.273 ms 6 /src/Adapter/EntityMapper.php:79
461
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4270 LIMIT 1
0.272 ms 10 /classes/SpecificPrice.php:435
560
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2533 LIMIT 1
0.272 ms 10 /classes/SpecificPrice.php:435
1308
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2801
AND image_shop.`cover` = 1 LIMIT 1
0.272 ms 1 /classes/Product.php:3570
2425
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 8985)
0.272 ms 1 /classes/Product.php:3860
2702
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 9086)
0.272 ms 1 /classes/Product.php:3860
3032
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 10852 LIMIT 1
0.272 ms 11 /classes/SpecificPrice.php:435
630
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4324 AND id_shop=1 LIMIT 1
0.271 ms 1 /classes/Product.php:6876
653
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4322 AND `id_group` = 1 LIMIT 1
0.271 ms 0 /classes/GroupReduction.php:156
3765
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 9071
0.271 ms 1 /classes/Product.php:2902
4027
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 73) LIMIT 1
0.271 ms 1 /src/Adapter/EntityMapper.php:71
2319
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 7954 LIMIT 1
0.271 ms 10 /classes/SpecificPrice.php:435
3996
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 78) LIMIT 1
0.271 ms 1 /src/Adapter/EntityMapper.php:71
2268
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 6159) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.270 ms 1 /classes/stock/StockAvailable.php:453
3966
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 172 AND `id_shop` = 1
0.270 ms 6 /src/Adapter/EntityMapper.php:79
2387
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2491 LIMIT 1
0.270 ms 10 /classes/SpecificPrice.php:435
4022
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 37 AND `id_shop` = 1
0.270 ms 6 /src/Adapter/EntityMapper.php:79
2486
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 9062
AND image_shop.`cover` = 1 LIMIT 1
0.269 ms 1 /classes/Product.php:3570
1407
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4061
AND image_shop.`cover` = 1 LIMIT 1
0.269 ms 1 /classes/Product.php:3570
2164
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 6044
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.269 ms 0 /classes/SpecificPrice.php:259
2297
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 6664 LIMIT 1
0.269 ms 10 /classes/SpecificPrice.php:435
2515
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 9067 AND id_shop=1 LIMIT 1
0.269 ms 1 /classes/Product.php:6876
3846
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 9102
0.269 ms 1 /classes/Product.php:2902
3957
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 38) LIMIT 1
0.269 ms 1 /src/Adapter/EntityMapper.php:71
142
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4225 LIMIT 1
0.268 ms 10 /classes/SpecificPrice.php:435
2444
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 9057 LIMIT 1
0.268 ms 10 /classes/SpecificPrice.php:435
2815
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 9098) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.268 ms 1 /classes/stock/StockAvailable.php:453
2909
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 9107
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.268 ms 0 /classes/SpecificPrice.php:259
3083
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 10928) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.268 ms 1 /classes/stock/StockAvailable.php:453
835
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2544 LIMIT 1
0.267 ms 10 /classes/SpecificPrice.php:435
1001
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4106 LIMIT 1
0.267 ms 10 /classes/SpecificPrice.php:435
1344
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4043
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.267 ms 0 /classes/SpecificPrice.php:259
2308
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 7952 LIMIT 1
0.267 ms 10 /classes/SpecificPrice.php:435
2505
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 9063) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.267 ms 1 /classes/stock/StockAvailable.php:453
2637
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 9078 AND id_shop=1 LIMIT 1
0.267 ms 1 /classes/Product.php:6876
3477
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4148
0.267 ms 1 /classes/Product.php:2902
3984
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 45 AND `id_shop` = 1
0.267 ms 6 /src/Adapter/EntityMapper.php:79
3986
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 46) LIMIT 1
0.267 ms 1 /src/Adapter/EntityMapper.php:71
1750
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 5037
AND image_shop.`cover` = 1 LIMIT 1
0.267 ms 2 /classes/Product.php:3570
3993
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 70) LIMIT 1
0.267 ms 1 /src/Adapter/EntityMapper.php:71
539
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2531
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.266 ms 0 /classes/SpecificPrice.php:259
555
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2532) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.266 ms 1 /classes/stock/StockAvailable.php:453
1081
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2845)
0.266 ms 1 /classes/Product.php:3860
1556
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4183)
0.266 ms 1 /classes/Product.php:3860
1581
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4196) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.266 ms 1 /classes/stock/StockAvailable.php:453
2217
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.266 ms 1 /classes/Product.php:5659
3025
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 10576 AND id_shop=1 LIMIT 1
0.266 ms 1 /classes/Product.php:6876
3573
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 5045
0.266 ms 1 /classes/Product.php:2902
3935
SELECT SQL_NO_CACHE `id_module` FROM `hgt78_module_shop` WHERE `id_module` = 95 AND `id_shop` = 1 LIMIT 1
0.266 ms 1 /classes/module/Module.php:2137
3994
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 70 AND `id_shop` = 1
0.266 ms 6 /src/Adapter/EntityMapper.php:79
4012
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 51 AND `id_shop` = 1
0.266 ms 6 /src/Adapter/EntityMapper.php:79
251
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.266 ms 1 /classes/Product.php:5659
168
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4286 AND id_shop=1 LIMIT 1
0.265 ms 1 /classes/Product.php:6876
1026
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4069)
0.265 ms 1 /classes/Product.php:3860
1493
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4148) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.265 ms 1 /classes/stock/StockAvailable.php:453
3976
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 334 AND `id_shop` = 1
0.265 ms 6 /src/Adapter/EntityMapper.php:79
4000
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 199 AND `id_shop` = 1
0.265 ms 6 /src/Adapter/EntityMapper.php:79
4086
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 191) LIMIT 1
0.265 ms 1 /src/Adapter/EntityMapper.php:71
1711
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4697)
0.265 ms 1 /classes/Product.php:3860
3964
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 72 AND `id_shop` = 1
0.265 ms 6 /src/Adapter/EntityMapper.php:79
564
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2533 AND id_shop=1 LIMIT 1
0.264 ms 1 /classes/Product.php:6876
697
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2543 AND `id_group` = 1 LIMIT 1
0.264 ms 0 /classes/GroupReduction.php:156
937
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4114)
0.264 ms 1 /classes/Product.php:3860
3615
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 5059
0.264 ms 1 /classes/Product.php:2902
638
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4323
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.264 ms 0 /classes/SpecificPrice.php:259
1143
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2523
AND image_shop.`cover` = 1 LIMIT 1
0.264 ms 1 /classes/Product.php:3570
1225
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2474)
0.264 ms 1 /classes/Product.php:3860
3095
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 10999) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.264 ms 1 /classes/stock/StockAvailable.php:453
3330
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4112
0.264 ms 1 /classes/Product.php:2902
3441
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4044
0.264 ms 1 /classes/Product.php:2902
4094
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 47) LIMIT 1
0.264 ms 1 /src/Adapter/EntityMapper.php:71
1943
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 5054 AND id_shop=1 LIMIT 1
0.263 ms 1 /classes/Product.php:6876
3231
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4328
0.263 ms 1 /classes/Product.php:2902
3975
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 334) LIMIT 1
0.263 ms 1 /src/Adapter/EntityMapper.php:71
626
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4324 LIMIT 1
0.263 ms 10 /classes/SpecificPrice.php:435
2174
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 6151 LIMIT 1
0.263 ms 11 /classes/SpecificPrice.php:435
2342
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 7958 LIMIT 1
0.263 ms 10 /classes/SpecificPrice.php:435
3962
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 62 AND `id_shop` = 1
0.263 ms 6 /src/Adapter/EntityMapper.php:79
3971
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 186) LIMIT 1
0.263 ms 1 /src/Adapter/EntityMapper.php:71
4005
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 35) LIMIT 1
0.263 ms 1 /src/Adapter/EntityMapper.php:71
619
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4327 AND id_shop=1 LIMIT 1
0.262 ms 1 /classes/Product.php:6876
2774
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 9095
AND image_shop.`cover` = 1 LIMIT 1
0.262 ms 1 /classes/Product.php:3570
2929
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 212 LIMIT 1
0.262 ms 1 /classes/Product.php:5659
2948
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 9262) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.262 ms 1 /classes/stock/StockAvailable.php:453
3264
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2541
0.262 ms 1 /classes/Product.php:2902
4016
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 192 AND `id_shop` = 1
0.262 ms 6 /src/Adapter/EntityMapper.php:79
1877
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 5048 AND id_shop=1 LIMIT 1
0.261 ms 1 /classes/Product.php:6876
1432
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4064 LIMIT 1
0.261 ms 10 /classes/SpecificPrice.php:435
2455
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 9058 LIMIT 1
0.261 ms 11 /classes/SpecificPrice.php:435
3989
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 54) LIMIT 1
0.261 ms 1 /src/Adapter/EntityMapper.php:71
4024
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 48 AND `id_shop` = 1
0.261 ms 6 /src/Adapter/EntityMapper.php:79
466
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4270 AND `id_group` = 1 LIMIT 1
0.260 ms 0 /classes/GroupReduction.php:156
1124
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4088
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.260 ms 0 /classes/SpecificPrice.php:259
1437
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4064 AND `id_group` = 1 LIMIT 1
0.260 ms 0 /classes/GroupReduction.php:156
2077
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 5308 AND id_shop=1 LIMIT 1
0.260 ms 1 /classes/Product.php:6876
3261
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2542
0.260 ms 1 /classes/Product.php:2902
3952
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 165 AND `id_shop` = 1
0.260 ms 6 /src/Adapter/EntityMapper.php:79
3960
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 50 AND `id_shop` = 1
0.260 ms 6 /src/Adapter/EntityMapper.php:79
4014
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 56 AND `id_shop` = 1
0.260 ms 6 /src/Adapter/EntityMapper.php:79
2353
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 7959 LIMIT 1
0.260 ms 10 /classes/SpecificPrice.php:435
1231
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2524
AND image_shop.`cover` = 1 LIMIT 1
0.259 ms 1 /classes/Product.php:3570
3183
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4275
0.259 ms 1 /classes/Product.php:2902
927
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4213 AND id_shop=1 LIMIT 1
0.259 ms 1 /classes/Product.php:6876
1236
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2524)
0.259 ms 1 /classes/Product.php:3860
1271
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2599 AND `id_group` = 1 LIMIT 1
0.259 ms 0 /classes/GroupReduction.php:156
2826
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 9099) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.259 ms 1 /classes/stock/StockAvailable.php:453
3958
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 38 AND `id_shop` = 1
0.259 ms 6 /src/Adapter/EntityMapper.php:79
3967
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 175) LIMIT 1
0.259 ms 1 /src/Adapter/EntityMapper.php:71
3980
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 344) LIMIT 1
0.259 ms 1 /src/Adapter/EntityMapper.php:71
3999
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 199) LIMIT 1
0.259 ms 1 /src/Adapter/EntityMapper.php:71
592
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.258 ms 1 /classes/Product.php:5659
1087
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2608
AND image_shop.`cover` = 1 LIMIT 1
0.258 ms 1 /classes/Product.php:3570
230
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4310 LIMIT 1
0.258 ms 10 /classes/SpecificPrice.php:435
982
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4105)
0.258 ms 1 /classes/Product.php:3860
2799
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 9097
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.258 ms 0 /classes/SpecificPrice.php:259
2868
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 9103 AND id_shop=1 LIMIT 1
0.258 ms 1 /classes/Product.php:6876
2918
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 228 LIMIT 1
0.258 ms 1 /classes/Product.php:5659
3987
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 46 AND `id_shop` = 1
0.258 ms 6 /src/Adapter/EntityMapper.php:79
4010
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 44 AND `id_shop` = 1
0.258 ms 6 /src/Adapter/EntityMapper.php:79
111
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 6017) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.257 ms 1 /classes/stock/StockAvailable.php:453
445
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4274) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.257 ms 1 /classes/stock/StockAvailable.php:453
576
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2534 AND `id_group` = 1 LIMIT 1
0.257 ms 0 /classes/GroupReduction.php:156
1054
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3042
AND image_shop.`cover` = 1 LIMIT 1
0.257 ms 1 /classes/Product.php:3570
1526
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4146) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.257 ms 1 /classes/stock/StockAvailable.php:453
2359
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 7959) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.257 ms 1 /classes/stock/StockAvailable.php:453
2987
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 10424 LIMIT 1
0.257 ms 10 /classes/SpecificPrice.php:435
3947
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 55) LIMIT 1
0.257 ms 1 /src/Adapter/EntityMapper.php:71
4003
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 200 AND `id_shop` = 1
0.257 ms 6 /src/Adapter/EntityMapper.php:79
4018
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 195 AND `id_shop` = 1
0.257 ms 6 /src/Adapter/EntityMapper.php:79
80
SELECT SQL_NO_CACHE * FROM hgt78_delivery WHERE id_carrier = 282 LIMIT 1
0.256 ms 8 /modules/colissimo_simplicite/colissimo_simplicite.php:1420
197
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4280 LIMIT 1
0.256 ms 10 /classes/SpecificPrice.php:435
263
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4315 LIMIT 1
0.256 ms 10 /classes/SpecificPrice.php:435
704
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2542
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.256 ms 0 /classes/SpecificPrice.php:259
794
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgt78_product` p
INNER JOIN `hgt78_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `hgt78_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2552)
0.256 ms 1 /classes/Product.php:3860
867
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.256 ms 1 /classes/Product.php:5659
1706
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4697
AND image_shop.`cover` = 1 LIMIT 1
0.256 ms 1 /classes/Product.php:3570
2262
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 6159 LIMIT 1
0.256 ms 11 /classes/SpecificPrice.php:435
3276
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2548
0.256 ms 1 /classes/Product.php:2902
3950
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 71 AND `id_shop` = 1
0.256 ms 6 /src/Adapter/EntityMapper.php:79
4030
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 74 AND `id_shop` = 1
0.256 ms 6 /src/Adapter/EntityMapper.php:79
4033
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 162) LIMIT 1
0.256 ms 1 /src/Adapter/EntityMapper.php:71
1482
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4133) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.256 ms 1 /classes/stock/StockAvailable.php:453
3072
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 10926) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.256 ms 1 /classes/stock/StockAvailable.php:453
4032
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 161 AND `id_shop` = 1
0.256 ms 6 /src/Adapter/EntityMapper.php:79
181
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4285) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.255 ms 1 /classes/stock/StockAvailable.php:453
1396
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4060
AND image_shop.`cover` = 1 LIMIT 1
0.255 ms 1 /classes/Product.php:3570
2173
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.255 ms 1 /classes/Product.php:5659
3951
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 165) LIMIT 1
0.255 ms 1 /src/Adapter/EntityMapper.php:71
4052
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 307 AND `id_shop` = 1
0.255 ms 6 /src/Adapter/EntityMapper.php:79
957
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4112
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.255 ms 0 /classes/SpecificPrice.php:259
2960
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 9266) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.255 ms 1 /classes/stock/StockAvailable.php:453
3900
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 10891
0.255 ms 1 /classes/Product.php:2902
4023
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 48) LIMIT 1
0.255 ms 1 /src/Adapter/EntityMapper.php:71
35
SELECT SQL_NO_CACHE *
FROM `hgt78_group` a
LEFT JOIN `hgt78_group_shop` `c` ON a.`id_group` = c.`id_group` AND c.`id_shop` = 1
WHERE (a.`id_group` = 1) LIMIT 1
0.254 ms 1 /src/Adapter/EntityMapper.php:71
70
SELECT SQL_NO_CACHE * FROM hgt78_revslider_sliders
0.254 ms 2 /modules/revsliderprestashop/includes/revslider_db.class.php:214
659
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4321 LIMIT 1
0.254 ms 10 /classes/SpecificPrice.php:435
3953
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 169) LIMIT 1
0.254 ms 1 /src/Adapter/EntityMapper.php:71
4061
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 65 AND `id_shop` = 1
0.254 ms 6 /src/Adapter/EntityMapper.php:79
33
SELECT SQL_NO_CACHE *
FROM `hgt78_currency_lang`
WHERE `id_currency` = 1
0.254 ms 6 /src/Adapter/EntityMapper.php:79
284
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.254 ms 1 /classes/Product.php:5659
746
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.254 ms 1 /classes/Product.php:5659
2336
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 7957) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.254 ms 1 /classes/stock/StockAvailable.php:453
3965
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 172) LIMIT 1
0.254 ms 1 /src/Adapter/EntityMapper.php:71
3973
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 190) LIMIT 1
0.254 ms 1 /src/Adapter/EntityMapper.php:71
4017
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 195) LIMIT 1
0.254 ms 1 /src/Adapter/EntityMapper.php:71
4110
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 84) LIMIT 1
0.254 ms 1 /src/Adapter/EntityMapper.php:71
241
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2554 LIMIT 1
0.253 ms 11 /classes/SpecificPrice.php:435
257
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4317 AND `id_group` = 1 LIMIT 1
0.253 ms 0 /classes/GroupReduction.php:156
604
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2493 LIMIT 1
0.253 ms 10 /classes/SpecificPrice.php:435
932
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4114
AND image_shop.`cover` = 1 LIMIT 1
0.253 ms 1 /classes/Product.php:3570
1184
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2476) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.253 ms 1 /classes/stock/StockAvailable.php:453
4106
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 39) LIMIT 1
0.253 ms 1 /src/Adapter/EntityMapper.php:71
857
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3553 LIMIT 1
0.252 ms 10 /classes/SpecificPrice.php:435
1242
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2525
AND image_shop.`cover` = 1 LIMIT 1
0.252 ms 1 /classes/Product.php:3570
1520
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4146 LIMIT 1
0.252 ms 10 /classes/SpecificPrice.php:435
4025
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 53) LIMIT 1
0.252 ms 1 /src/Adapter/EntityMapper.php:71
4026
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 53 AND `id_shop` = 1
0.252 ms 6 /src/Adapter/EntityMapper.php:79
4031
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 161) LIMIT 1
0.252 ms 1 /src/Adapter/EntityMapper.php:71
4039
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 261) LIMIT 1
0.252 ms 1 /src/Adapter/EntityMapper.php:71
4401
SELECT SQL_NO_CACHE *
FROM `hgt78_cms` a
LEFT JOIN `hgt78_cms_lang` `b` ON a.`id_cms` = b.`id_cms` AND b.`id_lang` = 1
LEFT JOIN `hgt78_cms_shop` `c` ON a.`id_cms` = c.`id_cms` AND c.`id_shop` = 1
WHERE (a.`id_cms` = 2) AND (b.`id_shop` = 1) LIMIT 1
0.252 ms 1 /src/Adapter/EntityMapper.php:71
4060
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 65) LIMIT 1
0.252 ms 1 /src/Adapter/EntityMapper.php:71
81
SELECT SQL_NO_CACHE `id_category`
FROM `hgt78_category_shop`
WHERE `id_category` = 2
AND `id_shop` = 1 LIMIT 1
0.251 ms 1 /classes/Category.php:2450
1176
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2476
AND image_shop.`cover` = 1 LIMIT 1
0.251 ms 1 /classes/Product.php:3570
1352
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4044
AND image_shop.`cover` = 1 LIMIT 1
0.251 ms 1 /classes/Product.php:3570
1509
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4141 LIMIT 1
0.251 ms 10 /classes/SpecificPrice.php:435
1828
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.251 ms 1 /classes/Product.php:5659
2006
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 5078
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.251 ms 0 /classes/SpecificPrice.php:259
2202
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 6153) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.251 ms 1 /classes/stock/StockAvailable.php:453
3240
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4324
0.251 ms 1 /classes/Product.php:2902
269
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4315) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.250 ms 1 /classes/stock/StockAvailable.php:453
500
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2547) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.250 ms 1 /classes/stock/StockAvailable.php:453
715
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2541
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.250 ms 0 /classes/SpecificPrice.php:259
1812
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 5042 AND `id_group` = 1 LIMIT 1
0.250 ms 0 /classes/GroupReduction.php:156
2314
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 7952) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.250 ms 1 /classes/stock/StockAvailable.php:453
4028
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 73 AND `id_shop` = 1
0.250 ms 6 /src/Adapter/EntityMapper.php:79
566
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2533) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.250 ms 1 /classes/stock/StockAvailable.php:453
818
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2539 AND `id_group` = 1 LIMIT 1
0.250 ms 0 /classes/GroupReduction.php:156
1106
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2606) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.250 ms 1 /classes/stock/StockAvailable.php:453
2079
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 5308) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.250 ms 1 /classes/stock/StockAvailable.php:453
2420
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 8985
AND image_shop.`cover` = 1 LIMIT 1
0.250 ms 1 /classes/Product.php:3570
2481
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 9061 AND id_shop=1 LIMIT 1
0.250 ms 1 /classes/Product.php:6876
3969
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 185) LIMIT 1
0.250 ms 1 /src/Adapter/EntityMapper.php:71
1564
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4195 LIMIT 1
0.249 ms 10 /classes/SpecificPrice.php:435
2408
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 8984
AND image_shop.`cover` = 1 LIMIT 1
0.249 ms 1 /classes/Product.php:3570
2698
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 228 LIMIT 1
0.249 ms 1 /classes/Product.php:5659
3201
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4267
0.249 ms 1 /classes/Product.php:2902
1000
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.249 ms 1 /classes/Product.php:5659
1239
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2524) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.249 ms 1 /classes/stock/StockAvailable.php:453
1438
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4064) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.249 ms 1 /classes/stock/StockAvailable.php:453
1531
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4142 LIMIT 1
0.249 ms 10 /classes/SpecificPrice.php:435
2627
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 9077 AND `id_group` = 1 LIMIT 1
0.249 ms 0 /classes/GroupReduction.php:156
1132
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4080
AND image_shop.`cover` = 1 LIMIT 1
0.248 ms 1 /classes/Product.php:3570
1220
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2474
AND image_shop.`cover` = 1 LIMIT 1
0.248 ms 1 /classes/Product.php:3570
554
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2532 AND `id_group` = 1 LIMIT 1
0.248 ms 0 /classes/GroupReduction.php:156
1305
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2916) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.248 ms 1 /classes/stock/StockAvailable.php:453
1319
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2430
AND image_shop.`cover` = 1 LIMIT 1
0.248 ms 1 /classes/Product.php:3570
1443
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4090 LIMIT 1
0.248 ms 10 /classes/SpecificPrice.php:435
1998
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 5059 AND id_shop=1 LIMIT 1
0.248 ms 1 /classes/Product.php:6876
2330
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 7957 LIMIT 1
0.248 ms 10 /classes/SpecificPrice.php:435
2820
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 9099 LIMIT 1
0.248 ms 10 /classes/SpecificPrice.php:435
3010
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 10469
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.248 ms 1 /classes/SpecificPrice.php:259
384
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4248 LIMIT 1
0.247 ms 10 /classes/SpecificPrice.php:435
561
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2533
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.247 ms 0 /classes/SpecificPrice.php:259
719
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2541 AND `id_group` = 1 LIMIT 1
0.247 ms 0 /classes/GroupReduction.php:156
1954
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 5055 AND id_shop=1 LIMIT 1
0.247 ms 1 /classes/Product.php:6876
2303
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 6664) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.247 ms 1 /classes/stock/StockAvailable.php:453
2325
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 7954) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.247 ms 1 /classes/stock/StockAvailable.php:453
2431
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 8986
AND image_shop.`cover` = 1 LIMIT 1
0.247 ms 1 /classes/Product.php:3570
3009
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 10469 LIMIT 1
0.247 ms 10 /classes/SpecificPrice.php:435
4050
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 266 AND `id_shop` = 1
0.247 ms 6 /src/Adapter/EntityMapper.php:79
4079
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 61 AND `id_shop` = 1
0.247 ms 6 /src/Adapter/EntityMapper.php:79
4109
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 83 AND `id_shop` = 1
0.247 ms 6 /src/Adapter/EntityMapper.php:79
484
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4267
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.246 ms 0 /classes/SpecificPrice.php:259
725
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2545 LIMIT 1
0.246 ms 10 /classes/SpecificPrice.php:435
863
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3553) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.246 ms 1 /classes/stock/StockAvailable.php:453
1907
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 5051
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.246 ms 0 /classes/SpecificPrice.php:259
2382
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2515) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.246 ms 1 /classes/stock/StockAvailable.php:453
2511
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 9067 LIMIT 1
0.246 ms 10 /classes/SpecificPrice.php:435
2986
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 210 LIMIT 1
0.246 ms 1 /classes/Product.php:5659
3002
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 10467 AND id_shop=1 LIMIT 1
0.246 ms 1 /classes/Product.php:6876
3228
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4329
0.246 ms 1 /classes/Product.php:2902
4058
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 60) LIMIT 1
0.246 ms 1 /src/Adapter/EntityMapper.php:71
186
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4282 LIMIT 1
0.246 ms 11 /classes/SpecificPrice.php:435
658
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.245 ms 1 /classes/Product.php:5659
1343
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4043 LIMIT 1
0.245 ms 10 /classes/SpecificPrice.php:435
2971
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 9733) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.245 ms 1 /classes/stock/StockAvailable.php:453
1802
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 5041) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.245 ms 1 /classes/stock/StockAvailable.php:453
1960
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.245 ms 1 /classes/Product.php:5659
2071
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `hgt78_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 42 LIMIT 1
0.245 ms 1 /classes/Category.php:1378
2494
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 9062) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.245 ms 1 /classes/stock/StockAvailable.php:453
4064
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 82) LIMIT 1
0.245 ms 1 /src/Adapter/EntityMapper.php:71
2370
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 7962) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.244 ms 1 /classes/stock/StockAvailable.php:453
1515
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4141) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.244 ms 1 /classes/stock/StockAvailable.php:453
1537
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4142) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.244 ms 1 /classes/stock/StockAvailable.php:453
2611
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 9076 LIMIT 1
0.244 ms 18 /classes/SpecificPrice.php:435
2683
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 9084) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.244 ms 1 /classes/stock/StockAvailable.php:453
444
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4274 AND `id_group` = 1 LIMIT 1
0.243 ms 0 /classes/GroupReduction.php:156
976
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4105
AND image_shop.`cover` = 1 LIMIT 1
0.243 ms 1 /classes/Product.php:3570
4085
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 80 AND `id_shop` = 1
0.243 ms 6 /src/Adapter/EntityMapper.php:79
124
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2553) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.243 ms 1 /classes/stock/StockAvailable.php:453
922
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.243 ms 1 /classes/Product.php:5659
1043
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3184
AND image_shop.`cover` = 1 LIMIT 1
0.243 ms 1 /classes/Product.php:3570
1662
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.243 ms 1 /classes/Product.php:5659
1994
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 5059 LIMIT 1
0.243 ms 10 /classes/SpecificPrice.php:435
2946
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 9262 AND id_shop=1 LIMIT 1
0.243 ms 1 /classes/Product.php:6876
3954
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 169 AND `id_shop` = 1
0.243 ms 6 /src/Adapter/EntityMapper.php:79
246
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2554 AND `id_group` = 1 LIMIT 1
0.242 ms 0 /classes/GroupReduction.php:156
296
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4278 LIMIT 1
0.242 ms 10 /classes/SpecificPrice.php:435
905
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4214 AND id_shop=1 LIMIT 1
0.242 ms 1 /classes/Product.php:6876
923
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4213 LIMIT 1
0.242 ms 10 /classes/SpecificPrice.php:435
1076
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2845
AND image_shop.`cover` = 1 LIMIT 1
0.242 ms 1 /classes/Product.php:3570
1109
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2844
AND image_shop.`cover` = 1 LIMIT 1
0.242 ms 1 /classes/Product.php:3570
1586
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4206 LIMIT 1
0.242 ms 10 /classes/SpecificPrice.php:435
2348
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 7958) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.242 ms 1 /classes/stock/StockAvailable.php:453
2391
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2491 AND id_shop=1 LIMIT 1
0.242 ms 1 /classes/Product.php:6876
3273
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4281
0.242 ms 1 /classes/Product.php:2902
4097
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 76 AND `id_shop` = 1
0.242 ms 6 /src/Adapter/EntityMapper.php:79
4108
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 83) LIMIT 1
0.242 ms 1 /src/Adapter/EntityMapper.php:71
1374
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4047
AND image_shop.`cover` = 1 LIMIT 1
0.241 ms 1 /classes/Product.php:3570
1658
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4227) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.241 ms 1 /classes/stock/StockAvailable.php:453
1967
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 5056) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.241 ms 1 /classes/stock/StockAvailable.php:453
2982
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 10423) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.241 ms 1 /classes/stock/StockAvailable.php:453
3004
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 10467) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.241 ms 1 /classes/stock/StockAvailable.php:453
4037
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 260) LIMIT 1
0.241 ms 1 /src/Adapter/EntityMapper.php:71
2821
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 9099
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.241 ms 0 /classes/SpecificPrice.php:259
118
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2553 LIMIT 1
0.240 ms 10 /classes/SpecificPrice.php:435
157
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4224 AND id_shop=1 LIMIT 1
0.240 ms 1 /classes/Product.php:6876
434
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3183) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.240 ms 1 /classes/stock/StockAvailable.php:453
675
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2536 AND `id_group` = 1 LIMIT 1
0.240 ms 0 /classes/GroupReduction.php:156
1426
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4062) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.240 ms 1 /classes/stock/StockAvailable.php:453
608
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2493 AND id_shop=1 LIMIT 1
0.240 ms 1 /classes/Product.php:6876
1625
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4307) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.240 ms 1 /classes/stock/StockAvailable.php:453
285
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4313 LIMIT 1
0.239 ms 10 /classes/SpecificPrice.php:435
907
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4214) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.239 ms 1 /classes/stock/StockAvailable.php:453
1272
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2599) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.239 ms 1 /classes/stock/StockAvailable.php:453
1508
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.239 ms 1 /classes/Product.php:5659
3162
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4263
0.239 ms 1 /classes/Product.php:2902
3399
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2517
0.239 ms 1 /classes/Product.php:2902
988
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4109
AND image_shop.`cover` = 1 LIMIT 1
0.239 ms 1 /classes/Product.php:3570
1012
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4116 LIMIT 1
0.239 ms 10 /classes/SpecificPrice.php:435
1288
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2558 LIMIT 1
0.239 ms 10 /classes/SpecificPrice.php:435
1703
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4577) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.239 ms 1 /classes/stock/StockAvailable.php:453
2478
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 9061
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.239 ms 0 /classes/SpecificPrice.php:259
3077
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 10928 LIMIT 1
0.239 ms 10 /classes/SpecificPrice.php:435
2397
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `hgt78_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 212 LIMIT 1
0.238 ms 1 /classes/Category.php:1378
2626
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 9077 AND id_shop=1 LIMIT 1
0.238 ms 1 /classes/Product.php:6876
3153
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4277
0.238 ms 1 /classes/Product.php:2902
1363
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4046
AND image_shop.`cover` = 1 LIMIT 1
0.238 ms 1 /classes/Product.php:3570
1542
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4144 LIMIT 1
0.238 ms 10 /classes/SpecificPrice.php:435
2016
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 5081 LIMIT 1
0.238 ms 10 /classes/SpecificPrice.php:435
2438
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 8986 AND `id_group` = 1 LIMIT 1
0.238 ms 0 /classes/GroupReduction.php:156
2445
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 9057
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.238 ms 0 /classes/SpecificPrice.php:259
2557
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 9071
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.238 ms 0 /classes/SpecificPrice.php:259
60
SELECT SQL_NO_CACHE `id_module` FROM `hgt78_module` WHERE `name` = "ps_accounts" LIMIT 1
0.237 ms 1 /src/Adapter/Module/ModuleDataProvider.php:257
1382
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4047) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.237 ms 1 /classes/stock/StockAvailable.php:453
1758
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 5037) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.237 ms 1 /classes/stock/StockAvailable.php:453
2755
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 9093
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.237 ms 0 /classes/SpecificPrice.php:259
2954
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 9266 LIMIT 1
0.237 ms 10 /classes/SpecificPrice.php:435
3031
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.237 ms 1 /classes/Product.php:5659
3061
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 10891) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.237 ms 1 /classes/stock/StockAvailable.php:453
3306
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4218
0.237 ms 1 /classes/Product.php:2902
3507
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4207
0.237 ms 1 /classes/Product.php:2902
4049
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 266) LIMIT 1
0.237 ms 1 /src/Adapter/EntityMapper.php:71
4059
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 60 AND `id_shop` = 1
0.237 ms 6 /src/Adapter/EntityMapper.php:79
11
SELECT SQL_NO_CACHE domain, domain_ssl
FROM hgt78_shop_url
WHERE main = 1
AND id_shop = 1 LIMIT 1
0.236 ms 1 /classes/shop/ShopUrl.php:182
203
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4280) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.236 ms 1 /classes/stock/StockAvailable.php:453
415
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4275
AND image_shop.`cover` = 1 LIMIT 1
0.236 ms 1 /classes/Product.php:3570
1460
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4129) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.236 ms 1 /classes/stock/StockAvailable.php:453
1867
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 5047 AND `id_group` = 1 LIMIT 1
0.236 ms 0 /classes/GroupReduction.php:156
1916
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.236 ms 1 /classes/Product.php:5659
2291
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 6435) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.236 ms 1 /classes/stock/StockAvailable.php:453
3926
SELECT SQL_NO_CACHE `id_module` FROM `hgt78_module` WHERE `name` = "ps_languageselector" LIMIT 1
0.236 ms 1 /classes/module/Module.php:2664
4405
SELECT SQL_NO_CACHE psgdprl.message FROM `hgt78_psgdpr_consent` psgdpr
LEFT JOIN hgt78_psgdpr_consent_lang psgdprl ON (psgdpr.id_gdpr_consent = psgdprl.id_gdpr_consent)
WHERE psgdpr.id_module = 22 AND psgdprl.id_lang =1 LIMIT 1
0.236 ms 12 /modules/psgdpr/classes/GDPRConsent.php:111
625
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.235 ms 1 /classes/Product.php:5659
685
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2537 AND id_shop=1 LIMIT 1
0.235 ms 1 /classes/Product.php:6876
1266
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2599 LIMIT 1
0.235 ms 2 /classes/SpecificPrice.php:435
2184
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.235 ms 1 /classes/Product.php:5659
3831
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 9097
0.235 ms 1 /classes/Product.php:2902
141
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.235 ms 1 /classes/Product.php:5659
395
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4212 LIMIT 1
0.235 ms 10 /classes/SpecificPrice.php:435
1310
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2801 LIMIT 1
0.235 ms 10 /classes/SpecificPrice.php:435
1449
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4090) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.235 ms 1 /classes/stock/StockAvailable.php:453
2798
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 9097 LIMIT 1
0.235 ms 18 /classes/SpecificPrice.php:435
2857
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 9102 AND id_shop=1 LIMIT 1
0.235 ms 1 /classes/Product.php:6876
333
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4264 AND id_shop=1 LIMIT 1
0.234 ms 1 /classes/Product.php:6876
2340
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `hgt78_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 230 LIMIT 1
0.234 ms 1 /classes/Category.php:1378
2405
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 8978) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.234 ms 1 /classes/stock/StockAvailable.php:453
2766
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 9094
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.234 ms 0 /classes/SpecificPrice.php:259
4084
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 80) LIMIT 1
0.234 ms 1 /src/Adapter/EntityMapper.php:71
94
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 0 LIMIT 1
0.234 ms 1 /classes/SpecificPrice.php:426
214
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4279) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.234 ms 1 /classes/stock/StockAvailable.php:453
2727
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 9090) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.234 ms 1 /classes/stock/StockAvailable.php:453
2865
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 9103
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.234 ms 0 /classes/SpecificPrice.php:259
543
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2531 AND `id_group` = 1 LIMIT 1
0.233 ms 0 /classes/GroupReduction.php:156
2211
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 6154 AND id_shop=1 LIMIT 1
0.233 ms 1 /classes/Product.php:6876
2255
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 6158 AND id_shop=1 LIMIT 1
0.233 ms 1 /classes/Product.php:6876
2747
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 9092 AND id_shop=1 LIMIT 1
0.233 ms 1 /classes/Product.php:6876
575
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2534 AND id_shop=1 LIMIT 1
0.233 ms 1 /classes/Product.php:6876
605
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2493
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.233 ms 0 /classes/SpecificPrice.php:259
708
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2542 AND `id_group` = 1 LIMIT 1
0.233 ms 0 /classes/GroupReduction.php:156
1051
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3184) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.233 ms 1 /classes/stock/StockAvailable.php:453
1332
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3056 LIMIT 1
0.233 ms 10 /classes/SpecificPrice.php:435
1465
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4130 LIMIT 1
0.233 ms 10 /classes/SpecificPrice.php:435
2520
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 9068
AND image_shop.`cover` = 1 LIMIT 1
0.233 ms 1 /classes/Product.php:3570
2836
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 9100 AND `id_group` = 1 LIMIT 1
0.233 ms 0 /classes/GroupReduction.php:156
3270
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2546
0.233 ms 1 /classes/Product.php:2902
3588
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 5050
0.233 ms 1 /classes/Product.php:2902
4103
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 221 AND `id_shop` = 1
0.232 ms 6 /src/Adapter/EntityMapper.php:79
208
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4279 LIMIT 1
0.232 ms 10 /classes/SpecificPrice.php:435
559
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.232 ms 1 /classes/Product.php:5659
795
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2552 AND id_shop=1 LIMIT 1
0.232 ms 1 /classes/Product.php:6876
1144
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.232 ms 1 /classes/Product.php:5659
1667
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4572 AND id_shop=1 LIMIT 1
0.232 ms 1 /classes/Product.php:6876
1921
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 5052 AND id_shop=1 LIMIT 1
0.232 ms 1 /classes/Product.php:6876
2364
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 7962 LIMIT 1
0.232 ms 10 /classes/SpecificPrice.php:435
2852
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 228 LIMIT 1
0.232 ms 1 /classes/Product.php:5659
2853
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 9102 LIMIT 1
0.232 ms 13 /classes/SpecificPrice.php:435
3123
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4280
0.232 ms 1 /classes/Product.php:2902
3813
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 9091
0.232 ms 1 /classes/Product.php:2902
4054
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 49) LIMIT 1
0.232 ms 1 /src/Adapter/EntityMapper.php:71
27
SELECT SQL_NO_CACHE `id_lang` FROM `hgt78_lang`
WHERE `locale` = 'fr-fr'
OR `language_code` = 'fr-fr' LIMIT 1
0.231 ms 6 /classes/Language.php:883
2793
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 9096) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.231 ms 1 /classes/stock/StockAvailable.php:453
2842
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 9101 LIMIT 1
0.231 ms 18 /classes/SpecificPrice.php:435
3363
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2845
0.231 ms 1 /classes/Product.php:2902
1575
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4196 LIMIT 1
0.231 ms 10 /classes/SpecificPrice.php:435
1987
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 5058 AND id_shop=1 LIMIT 1
0.230 ms 1 /classes/Product.php:6876
2703
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 9086 AND id_shop=1 LIMIT 1
0.230 ms 1 /classes/Product.php:6876
2726
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 9090 AND `id_group` = 1 LIMIT 1
0.230 ms 0 /classes/GroupReduction.php:156
4099
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 77 AND `id_shop` = 1
0.230 ms 6 /src/Adapter/EntityMapper.php:79
1949
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.230 ms 1 /classes/Product.php:5659
2197
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 6153
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.230 ms 0 /classes/SpecificPrice.php:259
2499
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 9063 LIMIT 1
0.230 ms 18 /classes/SpecificPrice.php:435
2869
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 9103 AND `id_group` = 1 LIMIT 1
0.230 ms 0 /classes/GroupReduction.php:156
4036
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 163 AND `id_shop` = 1
0.230 ms 6 /src/Adapter/EntityMapper.php:79
4102
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 221) LIMIT 1
0.230 ms 1 /src/Adapter/EntityMapper.php:71
1681
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4573) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.229 ms 1 /classes/stock/StockAvailable.php:453
2233
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 6156 AND id_shop=1 LIMIT 1
0.229 ms 1 /classes/Product.php:6876
2398
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 212 LIMIT 1
0.229 ms 1 /classes/Product.php:5659
2477
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 9061 LIMIT 1
0.229 ms 18 /classes/SpecificPrice.php:435
3171
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4259
0.229 ms 1 /classes/Product.php:2902
24
SELECT SQL_NO_CACHE `id_lang` FROM `hgt78_lang`
WHERE `locale` = 'fr-fr'
OR `language_code` = 'fr-fr' LIMIT 1
0.229 ms 6 /classes/Language.php:883
201
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4280 AND id_shop=1 LIMIT 1
0.229 ms 1 /classes/Product.php:6876
1342
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.229 ms 1 /classes/Product.php:5659
1476
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4133 LIMIT 1
0.229 ms 10 /classes/SpecificPrice.php:435
3159
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4264
0.229 ms 1 /classes/Product.php:2902
3810
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 9090
0.229 ms 1 /classes/Product.php:2902
4096
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 76) LIMIT 1
0.229 ms 1 /src/Adapter/EntityMapper.php:71
438
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.228 ms 1 /classes/Product.php:5659
1289
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2558
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.228 ms 0 /classes/SpecificPrice.php:259
4095
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 47 AND `id_shop` = 1
0.228 ms 6 /src/Adapter/EntityMapper.php:79
641
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4323 AND id_shop=1 LIMIT 1
0.228 ms 1 /classes/Product.php:6876
1900
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 5050 AND `id_group` = 1 LIMIT 1
0.228 ms 0 /classes/GroupReduction.php:156
2374
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `hgt78_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 76 LIMIT 1
0.228 ms 1 /classes/Category.php:1378
2610
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 229 LIMIT 1
0.228 ms 1 /classes/Product.php:5659
2621
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 229 LIMIT 1
0.228 ms 1 /classes/Product.php:5659
3462
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4064
0.228 ms 1 /classes/Product.php:2902
25
SELECT SQL_NO_CACHE c.id_currency
FROM `hgt78_currency` c
WHERE (iso_code = 'EUR') LIMIT 1
0.227 ms 1 /classes/Currency.php:893
1018
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4116) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.227 ms 1 /classes/stock/StockAvailable.php:453
1089
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2608 LIMIT 1
0.227 ms 10 /classes/SpecificPrice.php:435
1603
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4207) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.227 ms 1 /classes/stock/StockAvailable.php:453
718
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2541 AND id_shop=1 LIMIT 1
0.227 ms 1 /classes/Product.php:6876
735
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.227 ms 1 /classes/Product.php:5659
808
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2538) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.227 ms 1 /classes/stock/StockAvailable.php:453
1730
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 5033 LIMIT 1
0.227 ms 10 /classes/SpecificPrice.php:435
1806
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.227 ms 1 /classes/Product.php:5659
1912
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 5051) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.227 ms 1 /classes/stock/StockAvailable.php:453
3138
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4317
0.227 ms 1 /classes/Product.php:2902
3189
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4274
0.227 ms 1 /classes/Product.php:2902
3429
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2801
0.227 ms 1 /classes/Product.php:2902
107
SELECT SQL_NO_CACHE *
FROM `hgt78_tax_lang`
WHERE `id_tax` = 1
0.226 ms 6 /src/Adapter/EntityMapper.php:79
609
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2493 AND `id_group` = 1 LIMIT 1
0.226 ms 0 /classes/GroupReduction.php:156
1338
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3056) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.226 ms 1 /classes/stock/StockAvailable.php:453
1504
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4140) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.226 ms 1 /classes/stock/StockAvailable.php:453
2622
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 9077 LIMIT 1
0.226 ms 10 /classes/SpecificPrice.php:435
3192
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4271
0.226 ms 1 /classes/Product.php:2902
47
SELECT SQL_NO_CACHE state FROM hgt78_feature_flag WHERE name = 'multiple_image_format' LIMIT 1
0.225 ms 1 /classes/FeatureFlag.php:105
476
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4269 AND id_shop=1 LIMIT 1
0.225 ms 1 /classes/Product.php:6876
1999
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 5059 AND `id_group` = 1 LIMIT 1
0.225 ms 0 /classes/GroupReduction.php:156
2037
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.225 ms 1 /classes/Product.php:5659
2295
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `hgt78_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 228 LIMIT 1
0.225 ms 1 /classes/Category.php:1378
3393
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2476
0.225 ms 1 /classes/Product.php:2902
4035
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 163) LIMIT 1
0.225 ms 1 /src/Adapter/EntityMapper.php:71
4111
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 84 AND `id_shop` = 1
0.225 ms 6 /src/Adapter/EntityMapper.php:79
4384
SELECT SQL_NO_CACHE `id_module` FROM `hgt78_module` WHERE `name` = "ps_categorytree" LIMIT 1
0.225 ms 1 /classes/module/Module.php:2664
79
SELECT SQL_NO_CACHE * FROM hgt78_range_price WHERE id_carrier = 282 LIMIT 1
0.225 ms 2 /modules/colissimo_simplicite/colissimo_simplicite.php:1415
1910
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 5051 AND id_shop=1 LIMIT 1
0.225 ms 1 /classes/Product.php:6876
3522
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4227
0.225 ms 1 /classes/Product.php:2902
169
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4286 AND `id_group` = 1 LIMIT 1
0.224 ms 0 /classes/GroupReduction.php:156
682
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2537
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.224 ms 0 /classes/SpecificPrice.php:259
1585
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.224 ms 1 /classes/Product.php:5659
1784
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.224 ms 1 /classes/Product.php:5659
2119
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 5334 LIMIT 1
0.224 ms 10 /classes/SpecificPrice.php:435
4055
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 49 AND `id_shop` = 1
0.224 ms 6 /src/Adapter/EntityMapper.php:79
814
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2539
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.224 ms 0 /classes/SpecificPrice.php:259
2719
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `hgt78_image` i
INNER JOIN hgt78_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 9090
AND image_shop.`cover` = 1 LIMIT 1
0.224 ms 1 /classes/Product.php:3570
3819
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 9093
0.224 ms 1 /classes/Product.php:2902
4063
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 81 AND `id_shop` = 1
0.224 ms 6 /src/Adapter/EntityMapper.php:79
300
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4278 AND id_shop=1 LIMIT 1
0.223 ms 1 /classes/Product.php:6876
2245
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 6157 AND `id_group` = 1 LIMIT 1
0.223 ms 0 /classes/GroupReduction.php:156
2309
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 7952
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.223 ms 1 /classes/SpecificPrice.php:259
4107
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 39 AND `id_shop` = 1
0.223 ms 6 /src/Adapter/EntityMapper.php:79
245
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2554 AND id_shop=1 LIMIT 1
0.223 ms 1 /classes/Product.php:6876
1630
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4306 LIMIT 1
0.223 ms 10 /classes/SpecificPrice.php:435
1664
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4572
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.223 ms 0 /classes/SpecificPrice.php:259
1896
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 5050
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.223 ms 0 /classes/SpecificPrice.php:259
1983
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 5058 LIMIT 1
0.223 ms 10 /classes/SpecificPrice.php:435
2118
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 218 LIMIT 1
0.223 ms 1 /classes/Product.php:5659
3120
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4282
0.223 ms 1 /classes/Product.php:2902
3825
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 9095
0.223 ms 1 /classes/Product.php:2902
4076
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 33) LIMIT 1
0.223 ms 1 /src/Adapter/EntityMapper.php:71
4098
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 77) LIMIT 1
0.223 ms 1 /src/Adapter/EntityMapper.php:71
95
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 6017 LIMIT 1
0.222 ms 15 /classes/SpecificPrice.php:435
597
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4328 AND id_shop=1 LIMIT 1
0.222 ms 1 /classes/Product.php:6876
1498
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4140 LIMIT 1
0.222 ms 10 /classes/SpecificPrice.php:435
2186
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 6152
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.222 ms 0 /classes/SpecificPrice.php:259
2786
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 228 LIMIT 1
0.222 ms 1 /classes/Product.php:5659
2788
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 9096
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.222 ms 0 /classes/SpecificPrice.php:259
2804
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 9097) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.222 ms 1 /classes/stock/StockAvailable.php:453
3105
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 12682
0.222 ms 1 /classes/Product.php:2902
179
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4285 AND id_shop=1 LIMIT 1
0.221 ms 1 /classes/Product.php:6876
460
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.221 ms 1 /classes/Product.php:5659
1636
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4306) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.221 ms 1 /classes/stock/StockAvailable.php:453
1977
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 5057 AND `id_group` = 1 LIMIT 1
0.221 ms 0 /classes/GroupReduction.php:156
2376
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2515 LIMIT 1
0.221 ms 10 /classes/SpecificPrice.php:435
2606
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 9075) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.221 ms 1 /classes/stock/StockAvailable.php:453
2677
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 9084 LIMIT 1
0.221 ms 14 /classes/SpecificPrice.php:435
3135
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2554
0.221 ms 1 /classes/Product.php:2902
4100
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 217) LIMIT 1
0.221 ms 1 /src/Adapter/EntityMapper.php:71
68
SELECT SQL_NO_CACHE id_required_field, object_name, field_name
FROM hgt78_required_field
0.220 ms 2 /classes/ObjectModel.php:1592
1177
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.220 ms 1 /classes/Product.php:5659
1469
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4130 AND id_shop=1 LIMIT 1
0.220 ms 1 /classes/Product.php:6876
1692
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4576) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.220 ms 1 /classes/stock/StockAvailable.php:453
1993
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.220 ms 1 /classes/Product.php:5659
3037
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 10852 AND `id_group` = 1 LIMIT 1
0.220 ms 0 /classes/GroupReduction.php:156
3165
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4262
0.220 ms 1 /classes/Product.php:2902
4038
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 260 AND `id_shop` = 1
0.220 ms 6 /src/Adapter/EntityMapper.php:79
61
SELECT SQL_NO_CACHE `id_module` FROM `hgt78_module` WHERE `name` = "ps_legalcompliance" LIMIT 1
0.220 ms 0 /classes/module/Module.php:2664
1140
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4080) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.220 ms 1 /classes/stock/StockAvailable.php:453
3288
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2538
0.220 ms 1 /classes/Product.php:2902
1614
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4303) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.219 ms 1 /classes/stock/StockAvailable.php:453
1647
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4304) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.219 ms 1 /classes/stock/StockAvailable.php:453
3150
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4278
0.219 ms 1 /classes/Product.php:2902
3717
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2515
0.219 ms 1 /classes/Product.php:2902
951
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4113) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.219 ms 1 /classes/stock/StockAvailable.php:453
1062
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3042) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.219 ms 1 /classes/stock/StockAvailable.php:453
2343
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 7958
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.219 ms 0 /classes/SpecificPrice.php:259
2483
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 9061) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.219 ms 1 /classes/stock/StockAvailable.php:453
3258
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2543
0.219 ms 1 /classes/Product.php:2902
258
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4317) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.218 ms 1 /classes/stock/StockAvailable.php:453
1145
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2523 LIMIT 1
0.218 ms 10 /classes/SpecificPrice.php:435
1796
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 5041 LIMIT 1
0.218 ms 10 /classes/SpecificPrice.php:435
4101
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 217 AND `id_shop` = 1
0.218 ms 6 /src/Adapter/EntityMapper.php:79
143
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4225
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.218 ms 0 /classes/SpecificPrice.php:259
190
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4282 AND id_shop=1 LIMIT 1
0.218 ms 1 /classes/Product.php:6876
1608
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4303 LIMIT 1
0.218 ms 10 /classes/SpecificPrice.php:435
1668
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4572 AND `id_group` = 1 LIMIT 1
0.218 ms 0 /classes/GroupReduction.php:156
1752
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 5037 LIMIT 1
0.218 ms 10 /classes/SpecificPrice.php:435
1889
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 5049 AND `id_group` = 1 LIMIT 1
0.218 ms 0 /classes/GroupReduction.php:156
2858
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 9102 AND `id_group` = 1 LIMIT 1
0.218 ms 0 /classes/GroupReduction.php:156
2975
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 210 LIMIT 1
0.218 ms 1 /classes/Product.php:5659
3309
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2941
0.218 ms 1 /classes/Product.php:2902
3315
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4214
0.218 ms 1 /classes/Product.php:2902
4073
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 197 AND `id_shop` = 1
0.218 ms 6 /src/Adapter/EntityMapper.php:79
4112
SELECT SQL_NO_CACHE `width`, `height`
FROM hgt78_image_type
WHERE `name` = 'home_default' LIMIT 1
0.218 ms 1 /classes/Image.php:563
2050
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 5173 LIMIT 1
0.217 ms 10 /classes/SpecificPrice.php:435
729
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2545 AND id_shop=1 LIMIT 1
0.217 ms 1 /classes/Product.php:6876
1458
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4129 AND id_shop=1 LIMIT 1
0.217 ms 1 /classes/Product.php:6876
2108
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 5332 LIMIT 1
0.217 ms 10 /classes/SpecificPrice.php:435
3174
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4248
0.217 ms 1 /classes/Product.php:2902
207
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.216 ms 1 /classes/Product.php:5659
234
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4310 AND id_shop=1 LIMIT 1
0.216 ms 1 /classes/Product.php:6876
748
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4281
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.216 ms 0 /classes/SpecificPrice.php:259
1255
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2526 LIMIT 1
0.216 ms 10 /classes/SpecificPrice.php:435
1355
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4044
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.216 ms 0 /classes/SpecificPrice.php:259
2195
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.216 ms 1 /classes/Product.php:5659
2307
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 216 LIMIT 1
0.216 ms 1 /classes/Product.php:5659
2732
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 9091 LIMIT 1
0.216 ms 18 /classes/SpecificPrice.php:435
3076
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.216 ms 1 /classes/Product.php:5659
3333
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4111
0.216 ms 1 /classes/Product.php:2902
74
SELECT SQL_NO_CACHE `id_module` FROM `hgt78_module` WHERE `name` = "colissimo_simplicite" LIMIT 1
0.215 ms 1 /classes/module/Module.php:2664
286
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4313
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.215 ms 0 /classes/SpecificPrice.php:259
462
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4270
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.215 ms 0 /classes/SpecificPrice.php:259
834
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.215 ms 1 /classes/Product.php:5659
1541
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.215 ms 1 /classes/Product.php:5659
2009
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 5078 AND id_shop=1 LIMIT 1
0.215 ms 1 /classes/Product.php:6876
2386
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 76 LIMIT 1
0.215 ms 1 /classes/Product.php:5659
2434
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 8986
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.215 ms 0 /classes/SpecificPrice.php:259
2725
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 9090 AND id_shop=1 LIMIT 1
0.215 ms 1 /classes/Product.php:6876
2898
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 9106
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.215 ms 0 /classes/SpecificPrice.php:259
3100
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 6017
0.215 ms 1 /classes/Product.php:2902
3492
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4144
0.215 ms 1 /classes/Product.php:2902
3911
SELECT SQL_NO_CACHE * FROM `hgt78_hook_module_exceptions`
WHERE `id_shop` IN (1)
0.215 ms 1 /classes/module/Module.php:2046
4040
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 261 AND `id_shop` = 1
0.215 ms 6 /src/Adapter/EntityMapper.php:79
4062
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 81) LIMIT 1
0.215 ms 1 /src/Adapter/EntityMapper.php:71
116
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `hgt78_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 36 LIMIT 1
0.215 ms 1 /classes/Category.php:1378
1073
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 3041) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.215 ms 1 /classes/stock/StockAvailable.php:453
2318
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 216 LIMIT 1
0.215 ms 1 /classes/Product.php:5659
64
SELECT SQL_NO_CACHE format
FROM `hgt78_address_format`
WHERE `id_country` = 8 LIMIT 1
0.214 ms 1 /classes/AddressFormat.php:656
945
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4113 LIMIT 1
0.214 ms 10 /classes/SpecificPrice.php:435
1597
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4207 LIMIT 1
0.214 ms 10 /classes/SpecificPrice.php:435
2365
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 7962
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.214 ms 0 /classes/SpecificPrice.php:259
2504
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 9063 AND `id_group` = 1 LIMIT 1
0.214 ms 0 /classes/GroupReduction.php:156
3417
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2599
0.214 ms 1 /classes/Product.php:2902
4069
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 145 AND `id_shop` = 1
0.214 ms 6 /src/Adapter/EntityMapper.php:79
620
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4327 AND `id_group` = 1 LIMIT 1
0.214 ms 0 /classes/GroupReduction.php:156
1156
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2522 LIMIT 1
0.214 ms 10 /classes/SpecificPrice.php:435
1480
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4133 AND id_shop=1 LIMIT 1
0.214 ms 1 /classes/Product.php:6876
2443
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 228 LIMIT 1
0.214 ms 1 /classes/Product.php:5659
2509
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `hgt78_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 117 LIMIT 1
0.214 ms 1 /classes/Category.php:1378
3070
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 10926 AND id_shop=1 LIMIT 1
0.214 ms 1 /classes/Product.php:6876
15
SELECT SQL_NO_CACHE `name`, `alias` FROM `hgt78_hook_alias`
0.213 ms 88 /classes/Hook.php:290
123
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2553 AND `id_group` = 1 LIMIT 1
0.213 ms 0 /classes/GroupReduction.php:156
278
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4314 AND id_shop=1 LIMIT 1
0.213 ms 1 /classes/Product.php:6876
433
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3183 AND `id_group` = 1 LIMIT 1
0.213 ms 0 /classes/GroupReduction.php:156
1982
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.213 ms 1 /classes/Product.php:5659
77
SELECT SQL_NO_CACHE * FROM hgt78_carrier_zone WHERE id_carrier = 282 LIMIT 1
0.213 ms 4 /modules/colissimo_simplicite/colissimo_simplicite.php:1383
741
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2546 AND `id_group` = 1 LIMIT 1
0.213 ms 0 /classes/GroupReduction.php:156
1294
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2558) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.213 ms 1 /classes/stock/StockAvailable.php:453
1559
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4183) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.213 ms 1 /classes/stock/StockAvailable.php:453
2107
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 218 LIMIT 1
0.213 ms 1 /classes/Product.php:5659
2650
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 9079) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.213 ms 1 /classes/stock/StockAvailable.php:453
3303
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3553
0.213 ms 1 /classes/Product.php:2902
1376
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4047 LIMIT 1
0.212 ms 10 /classes/SpecificPrice.php:435
2864
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 9103 LIMIT 1
0.212 ms 17 /classes/SpecificPrice.php:435
642
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4323 AND `id_group` = 1 LIMIT 1
0.212 ms 0 /classes/GroupReduction.php:156
928
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4213 AND `id_group` = 1 LIMIT 1
0.212 ms 0 /classes/GroupReduction.php:156
1007
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4106) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.212 ms 1 /classes/stock/StockAvailable.php:453
1548
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4144) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.212 ms 1 /classes/stock/StockAvailable.php:453
1769
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 5038) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.212 ms 1 /classes/stock/StockAvailable.php:453
2056
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 5173) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.212 ms 1 /classes/stock/StockAvailable.php:453
2074
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 5308
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.212 ms 0 /classes/SpecificPrice.php:259
2615
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 9076 AND id_shop=1 LIMIT 1
0.212 ms 1 /classes/Product.php:6876
2991
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 10424 AND id_shop=1 LIMIT 1
0.212 ms 1 /classes/Product.php:6876
3561
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 5041
0.212 ms 1 /classes/Product.php:2902
3756
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 9068
0.212 ms 1 /classes/Product.php:2902
18
SELECT SQL_NO_CACHE name, alias FROM `hgt78_hook_alias`
0.211 ms 88 /classes/Hook.php:342
67
SELECT SQL_NO_CACHE *
FROM `hgt78_country_lang`
WHERE `id_country` = 8
0.211 ms 6 /src/Adapter/EntityMapper.php:79
229
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.211 ms 1 /classes/Product.php:5659
2274
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 6198
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.211 ms 1 /classes/SpecificPrice.php:259
2298
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 6664
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.211 ms 0 /classes/SpecificPrice.php:259
2959
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 9266 AND `id_group` = 1 LIMIT 1
0.211 ms 0 /classes/GroupReduction.php:156
3432
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2430
0.211 ms 1 /classes/Product.php:2902
3576
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 5046
0.211 ms 1 /classes/Product.php:2902
3660
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 6044
0.211 ms 1 /classes/Product.php:2902
873
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4218 AND `id_group` = 1 LIMIT 1
0.210 ms 0 /classes/GroupReduction.php:156
1409
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4061 LIMIT 1
0.210 ms 10 /classes/SpecificPrice.php:435
1652
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4227 LIMIT 1
0.210 ms 10 /classes/SpecificPrice.php:435
2129
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.210 ms 1 /classes/Product.php:5659
2250
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.210 ms 1 /classes/Product.php:5659
2661
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 9081) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.210 ms 1 /classes/stock/StockAvailable.php:453
3103
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2553
0.210 ms 1 /classes/Product.php:2902
3480
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4140
0.210 ms 1 /classes/Product.php:2902
78
SELECT SQL_NO_CACHE * FROM hgt78_carrier_group WHERE id_carrier = 282 LIMIT 1
0.210 ms 8 /modules/colissimo_simplicite/colissimo_simplicite.php:1388
2456
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 9058
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.210 ms 0 /classes/SpecificPrice.php:259
224
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4309 AND `id_group` = 1 LIMIT 1
0.209 ms 0 /classes/GroupReduction.php:156
1160
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2522 AND id_shop=1 LIMIT 1
0.209 ms 1 /classes/Product.php:6876
3156
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4276
0.209 ms 1 /classes/Product.php:2902
3450
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4048
0.209 ms 1 /classes/Product.php:2902
3654
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 5472
0.209 ms 1 /classes/Product.php:2902
3903
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 10926
0.209 ms 1 /classes/Product.php:2902
344
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4263 AND id_shop=1 LIMIT 1
0.209 ms 1 /classes/Product.php:6876
1299
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2916 LIMIT 1
0.209 ms 10 /classes/SpecificPrice.php:435
2980
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 10423 AND id_shop=1 LIMIT 1
0.209 ms 1 /classes/Product.php:6876
3022
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 10576
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.209 ms 1 /classes/SpecificPrice.php:259
3937
SELECT SQL_NO_CACHE `name`
FROM `hgt78_hook`
WHERE `id_hook` = 910 LIMIT 1
0.209 ms 1 /classes/Hook.php:247
912
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4210 LIMIT 1
0.208 ms 10 /classes/SpecificPrice.php:435
1298
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.208 ms 1 /classes/Product.php:5659
3078
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 10928
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.208 ms 1 /classes/SpecificPrice.php:259
3108
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4225
0.208 ms 1 /classes/Product.php:2902
3495
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4183
0.208 ms 1 /classes/Product.php:2902
4066
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 96) LIMIT 1
0.208 ms 1 /src/Adapter/EntityMapper.php:71
598
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4328 AND `id_group` = 1 LIMIT 1
0.208 ms 0 /classes/GroupReduction.php:156
1078
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2845 LIMIT 1
0.208 ms 10 /classes/SpecificPrice.php:435
1311
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2801
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.208 ms 0 /classes/SpecificPrice.php:259
1570
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4195) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.208 ms 1 /classes/stock/StockAvailable.php:453
1641
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4304 LIMIT 1
0.208 ms 10 /classes/SpecificPrice.php:435
3147
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4313
0.208 ms 1 /classes/Product.php:2902
4077
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 33 AND `id_shop` = 1
0.208 ms 6 /src/Adapter/EntityMapper.php:79
218
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.207 ms 1 /classes/Product.php:5659
262
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.207 ms 1 /classes/Product.php:5659
273
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.207 ms 1 /classes/Product.php:5659
1325
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2430 AND id_shop=1 LIMIT 1
0.207 ms 1 /classes/Product.php:6876
1464
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.207 ms 1 /classes/Product.php:5659
1878
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 5048 AND `id_group` = 1 LIMIT 1
0.207 ms 0 /classes/GroupReduction.php:156
2124
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 5334 AND `id_group` = 1 LIMIT 1
0.207 ms 0 /classes/GroupReduction.php:156
3321
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4213
0.207 ms 1 /classes/Product.php:2902
3768
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 9072
0.207 ms 1 /classes/Product.php:2902
4090
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 36) LIMIT 1
0.207 ms 1 /src/Adapter/EntityMapper.php:71
4
SELECT SQL_NO_CACHE *
FROM `hgt78_shop` a
WHERE (a.`id_shop` = 1) LIMIT 1
0.206 ms 1 /src/Adapter/EntityMapper.php:71
377
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4259 AND id_shop=1 LIMIT 1
0.206 ms 1 /classes/Product.php:6876
1206
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2517) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.206 ms 1 /classes/stock/StockAvailable.php:453
1261
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2526) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.206 ms 1 /classes/stock/StockAvailable.php:453
1393
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4048) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.206 ms 1 /classes/stock/StockAvailable.php:453
1430
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `hgt78_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 209 LIMIT 1
0.206 ms 1 /classes/Category.php:1378
1736
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 5033) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.206 ms 1 /classes/stock/StockAvailable.php:453
3019
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 216 LIMIT 1
0.206 ms 1 /classes/Product.php:5659
3081
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 10928 AND id_shop=1 LIMIT 1
0.206 ms 1 /classes/Product.php:6876
4078
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 61) LIMIT 1
0.206 ms 1 /src/Adapter/EntityMapper.php:71
231
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4310
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.205 ms 0 /classes/SpecificPrice.php:259
297
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4278
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.205 ms 0 /classes/SpecificPrice.php:259
813
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2539 LIMIT 1
0.205 ms 10 /classes/SpecificPrice.php:435
2716
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 9089) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.205 ms 1 /classes/stock/StockAvailable.php:453
3053
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.205 ms 1 /classes/Product.php:5659
3348
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4069
0.205 ms 1 /classes/Product.php:2902
3549
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 5037
0.205 ms 1 /classes/Product.php:2902
4083
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 79 AND `id_shop` = 1
0.205 ms 6 /src/Adapter/EntityMapper.php:79
2731
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 228 LIMIT 1
0.205 ms 1 /classes/Product.php:5659
163
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.204 ms 1 /classes/Product.php:5659
631
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4324 AND `id_group` = 1 LIMIT 1
0.204 ms 0 /classes/GroupReduction.php:156
1244
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2525 LIMIT 1
0.204 ms 10 /classes/SpecificPrice.php:435
2289
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 6435 AND id_shop=1 LIMIT 1
0.204 ms 1 /classes/Product.php:6876
2863
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 228 LIMIT 1
0.204 ms 1 /classes/Product.php:5659
3186
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3183
0.204 ms 1 /classes/Product.php:2902
1675
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4573 LIMIT 1
0.204 ms 10 /classes/SpecificPrice.php:435
185
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.203 ms 1 /classes/Product.php:5659
1775
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 5039
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.203 ms 0 /classes/SpecificPrice.php:259
2256
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 6158 AND `id_group` = 1 LIMIT 1
0.203 ms 0 /classes/GroupReduction.php:156
2277
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 6198 AND id_shop=1 LIMIT 1
0.203 ms 1 /classes/Product.php:6876
2320
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 7954
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.203 ms 1 /classes/SpecificPrice.php:259
3111
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4224
0.203 ms 1 /classes/Product.php:2902
3114
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4286
0.203 ms 1 /classes/Product.php:2902
3141
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4315
0.203 ms 1 /classes/Product.php:2902
3195
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4270
0.203 ms 1 /classes/Product.php:2902
334
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4264 AND `id_group` = 1 LIMIT 1
0.203 ms 0 /classes/GroupReduction.php:156
1491
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4148 AND id_shop=1 LIMIT 1
0.203 ms 1 /classes/Product.php:6876
3059
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 10891 AND id_shop=1 LIMIT 1
0.203 ms 1 /classes/Product.php:6876
3177
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4212
0.203 ms 1 /classes/Product.php:2902
4402
SELECT SQL_NO_CACHE `id_module` FROM `hgt78_module` WHERE `name` = "ps_emailsubscription" LIMIT 1
0.203 ms 1 /classes/module/Module.php:2664
1017
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4116 AND `id_group` = 1 LIMIT 1
0.202 ms 0 /classes/GroupReduction.php:156
3582
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 5048
0.202 ms 1 /classes/Product.php:2902
176
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4285
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.202 ms 0 /classes/SpecificPrice.php:259
856
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.202 ms 1 /classes/Product.php:5659
1090
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2608
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.202 ms 0 /classes/SpecificPrice.php:259
1211
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2516 LIMIT 1
0.202 ms 10 /classes/SpecificPrice.php:435
1415
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4061) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.202 ms 1 /classes/stock/StockAvailable.php:453
1502
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4140 AND id_shop=1 LIMIT 1
0.202 ms 1 /classes/Product.php:6876
2134
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 5470 AND id_shop=1 LIMIT 1
0.202 ms 1 /classes/Product.php:6876
2180
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 6151) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.202 ms 1 /classes/stock/StockAvailable.php:453
2870
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 9103) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.202 ms 1 /classes/stock/StockAvailable.php:453
3609
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 5057
0.202 ms 1 /classes/Product.php:2902
3645
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 5332
0.202 ms 1 /classes/Product.php:2902
3807
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 9089
0.202 ms 1 /classes/Product.php:2902
165
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4286
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.201 ms 0 /classes/SpecificPrice.php:259
2612
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 9076
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.201 ms 0 /classes/SpecificPrice.php:259
3180
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4266
0.201 ms 1 /classes/Product.php:2902
280
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4314) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.201 ms 1 /classes/stock/StockAvailable.php:453
753
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4281) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.201 ms 1 /classes/stock/StockAvailable.php:453
1029
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4069) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.201 ms 1 /classes/stock/StockAvailable.php:453
1122
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.201 ms 1 /classes/Product.php:5659
1453
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.201 ms 1 /classes/Product.php:5659
1587
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4206
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.201 ms 1 /classes/SpecificPrice.php:259
1619
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4307 LIMIT 1
0.201 ms 10 /classes/SpecificPrice.php:435
1819
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 5043
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.201 ms 0 /classes/SpecificPrice.php:259
2261
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.201 ms 1 /classes/Product.php:5659
2346
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 7958 AND id_shop=1 LIMIT 1
0.201 ms 1 /classes/Product.php:6876
2848
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 9101) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.201 ms 1 /classes/stock/StockAvailable.php:453
2874
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 228 LIMIT 1
0.201 ms 1 /classes/Product.php:5659
3090
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 10999
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.201 ms 1 /classes/SpecificPrice.php:259
3327
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4113
0.201 ms 1 /classes/Product.php:2902
3357
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3042
0.201 ms 1 /classes/Product.php:2902
3369
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2606
0.201 ms 1 /classes/Product.php:2902
3852
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 9104
0.201 ms 1 /classes/Product.php:2902
29
SELECT SQL_NO_CACHE c.id_currency
FROM `hgt78_currency` c
WHERE (iso_code = 'GBP') LIMIT 1
0.200 ms 1 /classes/Currency.php:893
401
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4212) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.200 ms 1 /classes/stock/StockAvailable.php:453
499
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2547 AND `id_group` = 1 LIMIT 1
0.200 ms 0 /classes/GroupReduction.php:156
768
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.200 ms 1 /classes/Product.php:5659
1591
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4206 AND `id_group` = 1 LIMIT 1
0.200 ms 0 /classes/GroupReduction.php:156
1807
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 5042 LIMIT 1
0.200 ms 10 /classes/SpecificPrice.php:435
1840
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 5045 LIMIT 1
0.200 ms 10 /classes/SpecificPrice.php:435
1972
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 5057 LIMIT 1
0.200 ms 10 /classes/SpecificPrice.php:435
2065
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 5174 AND id_shop=1 LIMIT 1
0.200 ms 1 /classes/Product.php:6876
3047
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 10853 AND id_shop=1 LIMIT 1
0.200 ms 1 /classes/Product.php:6876
3366
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2608
0.200 ms 1 /classes/Product.php:2902
3795
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 9082
0.200 ms 1 /classes/Product.php:2902
4068
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 145) LIMIT 1
0.200 ms 1 /src/Adapter/EntityMapper.php:71
36
SELECT SQL_NO_CACHE *
FROM `hgt78_group_lang`
WHERE `id_group` = 1
0.199 ms 6 /src/Adapter/EntityMapper.php:79
119
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2553
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.199 ms 1 /classes/SpecificPrice.php:259
1095
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2608) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.199 ms 1 /classes/stock/StockAvailable.php:453
1371
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4046) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.199 ms 1 /classes/stock/StockAvailable.php:453
2705
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 9086) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.199 ms 1 /classes/stock/StockAvailable.php:453
4081
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 66 AND `id_shop` = 1
0.199 ms 6 /src/Adapter/EntityMapper.php:79
128
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `hgt78_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 34 LIMIT 1
0.199 ms 1 /classes/Category.php:1378
1686
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4576 LIMIT 1
0.199 ms 10 /classes/SpecificPrice.php:435
2830
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 228 LIMIT 1
0.199 ms 1 /classes/Product.php:5659
3567
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 5043
0.199 ms 1 /classes/Product.php:2902
1013
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4116
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.198 ms 0 /classes/SpecificPrice.php:259
4067
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 96 AND `id_shop` = 1
0.198 ms 6 /src/Adapter/EntityMapper.php:79
1607
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.198 ms 1 /classes/Product.php:5659
1687
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4576
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.198 ms 0 /classes/SpecificPrice.php:259
3420
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2597
0.198 ms 1 /classes/Product.php:2902
3501
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4196
0.198 ms 1 /classes/Product.php:2902
3525
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4572
0.198 ms 1 /classes/Product.php:2902
1283
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2597) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.197 ms 1 /classes/stock/StockAvailable.php:453
2190
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 6152 AND `id_group` = 1 LIMIT 1
0.197 ms 0 /classes/GroupReduction.php:156
2517
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 9067) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.197 ms 1 /classes/stock/StockAvailable.php:453
3067
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 10926
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.197 ms 1 /classes/SpecificPrice.php:259
3402
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2516
0.197 ms 1 /classes/Product.php:2902
3699
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 7952
0.197 ms 1 /classes/Product.php:2902
3726
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 8984
0.197 ms 1 /classes/Product.php:2902
73
SELECT SQL_NO_CACHE `name`
FROM `hgt78_hook`
WHERE `id_hook` = 746 LIMIT 1
0.197 ms 1 /classes/Hook.php:247
1027
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4069 AND id_shop=1 LIMIT 1
0.197 ms 1 /classes/Product.php:6876
1851
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 5046 LIMIT 1
0.197 ms 15 /classes/SpecificPrice.php:435
2038
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 5159 LIMIT 1
0.197 ms 10 /classes/SpecificPrice.php:435
2301
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 6664 AND id_shop=1 LIMIT 1
0.197 ms 1 /classes/Product.php:6876
2699
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 9086 LIMIT 1
0.197 ms 10 /classes/SpecificPrice.php:435
454
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4271 AND id_shop=1 LIMIT 1
0.196 ms 1 /classes/Product.php:6876
696
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2543 AND id_shop=1 LIMIT 1
0.196 ms 1 /classes/Product.php:6876
1433
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4064
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.196 ms 0 /classes/SpecificPrice.php:259
2797
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 228 LIMIT 1
0.196 ms 1 /classes/Product.php:5659
2875
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 9104 LIMIT 1
0.196 ms 10 /classes/SpecificPrice.php:435
3126
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4279
0.196 ms 1 /classes/Product.php:2902
3129
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4309
0.196 ms 1 /classes/Product.php:2902
3132
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4310
0.196 ms 1 /classes/Product.php:2902
3282
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2550
0.196 ms 1 /classes/Product.php:2902
3312
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4216
0.196 ms 1 /classes/Product.php:2902
3753
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 9067
0.196 ms 1 /classes/Product.php:2902
93
SELECT SQL_NO_CACHE `name`
FROM `hgt78_manufacturer`
WHERE `id_manufacturer` = 2
AND `active` = 1 LIMIT 1
0.195 ms 1 /classes/Manufacturer.php:316
191
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4282 AND `id_group` = 1 LIMIT 1
0.195 ms 0 /classes/GroupReduction.php:156
306
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.195 ms 1 /classes/Product.php:5659
929
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4213) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.195 ms 1 /classes/stock/StockAvailable.php:453
1763
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 5038 LIMIT 1
0.195 ms 10 /classes/SpecificPrice.php:435
2101
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 5331 AND id_shop=1 LIMIT 1
0.195 ms 1 /classes/Product.php:6876
3540
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4696
0.195 ms 1 /classes/Product.php:2902
4045
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 264) LIMIT 1
0.195 ms 1 /src/Adapter/EntityMapper.php:71
4070
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 196) LIMIT 1
0.195 ms 1 /src/Adapter/EntityMapper.php:71
368
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4260) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.194 ms 1 /classes/stock/StockAvailable.php:453
649
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4322
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.194 ms 0 /classes/SpecificPrice.php:259
960
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4112 AND id_shop=1 LIMIT 1
0.194 ms 1 /classes/Product.php:6876
1011
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.194 ms 1 /classes/Product.php:5659
1248
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2525 AND id_shop=1 LIMIT 1
0.194 ms 1 /classes/Product.php:6876
1447
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4090 AND id_shop=1 LIMIT 1
0.194 ms 1 /classes/Product.php:6876
1519
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.194 ms 1 /classes/Product.php:5659
2488
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 9062 LIMIT 1
0.194 ms 18 /classes/SpecificPrice.php:435
2689
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 9085
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.194 ms 0 /classes/SpecificPrice.php:259
3144
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4314
0.194 ms 1 /classes/Product.php:2902
3168
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4260
0.194 ms 1 /classes/Product.php:2902
3750
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 9063
0.194 ms 1 /classes/Product.php:2902
3816
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 9092
0.194 ms 1 /classes/Product.php:2902
4056
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 59) LIMIT 1
0.194 ms 1 /src/Adapter/EntityMapper.php:71
996
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4109) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.194 ms 1 /classes/stock/StockAvailable.php:453
1040
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4074) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.194 ms 1 /classes/stock/StockAvailable.php:453
1830
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 5044
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.194 ms 0 /classes/SpecificPrice.php:259
2283
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `hgt78_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 277 LIMIT 1
0.194 ms 1 /classes/Category.php:1378
2363
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 228 LIMIT 1
0.194 ms 1 /classes/Product.php:5659
3438
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4043
0.194 ms 1 /classes/Product.php:2902
240
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.193 ms 1 /classes/Product.php:5659
636
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.193 ms 1 /classes/Product.php:5659
1822
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 5043 AND id_shop=1 LIMIT 1
0.193 ms 1 /classes/Product.php:6876
2313
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 7952 AND `id_group` = 1 LIMIT 1
0.193 ms 0 /classes/GroupReduction.php:156
3396
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2487
0.193 ms 1 /classes/Product.php:2902
3552
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 5038
0.193 ms 1 /classes/Product.php:2902
3771
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 9073
0.193 ms 1 /classes/Product.php:2902
4042
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 262 AND `id_shop` = 1
0.193 ms 6 /src/Adapter/EntityMapper.php:79
4091
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 36 AND `id_shop` = 1
0.193 ms 6 /src/Adapter/EntityMapper.php:79
565
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2533 AND `id_group` = 1 LIMIT 1
0.193 ms 0 /classes/GroupReduction.php:156
1084
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2845) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.193 ms 1 /classes/stock/StockAvailable.php:453
1166
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.193 ms 1 /classes/Product.php:5659
1530
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.193 ms 1 /classes/Product.php:5659
1714
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4697) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.193 ms 1 /classes/stock/StockAvailable.php:453
1424
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4062 AND id_shop=1 LIMIT 1
0.192 ms 1 /classes/Product.php:6876
2846
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 9101 AND id_shop=1 LIMIT 1
0.192 ms 1 /classes/Product.php:6876
72
SELECT SQL_NO_CACHE *
FROM `hgt78_shop_url` a0
0.192 ms 1 /classes/PrestaShopCollection.php:383
187
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4282
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.192 ms 0 /classes/SpecificPrice.php:259
1151
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2523) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.192 ms 1 /classes/stock/StockAvailable.php:453
2234
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 6156 AND `id_group` = 1 LIMIT 1
0.192 ms 0 /classes/GroupReduction.php:156
2714
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 9089 AND id_shop=1 LIMIT 1
0.192 ms 1 /classes/Product.php:6876
3531
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4576
0.192 ms 1 /classes/Product.php:2902
235
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4310 AND `id_group` = 1 LIMIT 1
0.191 ms 0 /classes/GroupReduction.php:156
906
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4214 AND `id_group` = 1 LIMIT 1
0.191 ms 0 /classes/GroupReduction.php:156
1134
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4080 LIMIT 1
0.191 ms 10 /classes/SpecificPrice.php:435
1729
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.191 ms 1 /classes/Product.php:5659
1911
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 5051 AND `id_group` = 1 LIMIT 1
0.191 ms 0 /classes/GroupReduction.php:156
2098
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 5331
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.191 ms 0 /classes/SpecificPrice.php:259
2230
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 6156
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.191 ms 0 /classes/SpecificPrice.php:259
3013
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 10469 AND id_shop=1 LIMIT 1
0.191 ms 1 /classes/Product.php:6876
3117
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4285
0.191 ms 1 /classes/Product.php:2902
20
SELECT SQL_NO_CACHE * FROM `hgt78_hook_module_exceptions`
WHERE `id_shop` IN (1)
0.190 ms 1 /classes/module/Module.php:2046
102
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 6017 AND id_shop=1 LIMIT 1
0.190 ms 1 /classes/Product.php:6876
450
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4271 LIMIT 1
0.190 ms 10 /classes/SpecificPrice.php:435
1094
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2608 AND `id_group` = 1 LIMIT 1
0.190 ms 0 /classes/GroupReduction.php:156
1486
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.190 ms 1 /classes/Product.php:5659
3279
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2549
0.190 ms 1 /classes/Product.php:2902
4092
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 42) LIMIT 1
0.190 ms 1 /src/Adapter/EntityMapper.php:71
2422
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 8985 LIMIT 1
0.190 ms 18 /classes/SpecificPrice.php:435
8
SELECT SQL_NO_CACHE *
FROM `hgt78_shop_group` a
WHERE (a.`id_shop_group` = 1) LIMIT 1
0.189 ms 1 /src/Adapter/EntityMapper.php:71
31
SELECT SQL_NO_CACHE `id_lang` FROM `hgt78_lang`
WHERE `locale` = 'fr-fr'
OR `language_code` = 'fr-fr' LIMIT 1
0.189 ms 6 /classes/Language.php:883
1270
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2599 AND id_shop=1 LIMIT 1
0.189 ms 1 /classes/Product.php:6876
1719
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4696 LIMIT 1
0.189 ms 10 /classes/SpecificPrice.php:435
2754
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 9093 LIMIT 1
0.189 ms 13 /classes/SpecificPrice.php:435
3732
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 8986
0.189 ms 1 /classes/Product.php:2902
3894
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 10852
0.189 ms 1 /classes/Product.php:2902
1785
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 5040 LIMIT 1
0.189 ms 10 /classes/SpecificPrice.php:435
3471
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4130
0.189 ms 1 /classes/Product.php:2902
3558
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 5040
0.189 ms 1 /classes/Product.php:2902
3603
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 5055
0.189 ms 1 /classes/Product.php:2902
196
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.188 ms 1 /classes/Product.php:5659
212
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4279 AND id_shop=1 LIMIT 1
0.188 ms 1 /classes/Product.php:6876
256
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4317 AND id_shop=1 LIMIT 1
0.188 ms 1 /classes/Product.php:6876
267
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4315 AND id_shop=1 LIMIT 1
0.188 ms 1 /classes/Product.php:6876
2417
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 8984) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.188 ms 1 /classes/stock/StockAvailable.php:453
3459
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4062
0.188 ms 1 /classes/Product.php:2902
3606
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 5056
0.188 ms 1 /classes/Product.php:2902
3657
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 6043
0.188 ms 1 /classes/Product.php:2902
3913
SELECT SQL_NO_CACHE id_shop
FROM `hgt78_group_shop`
WHERE `id_group` = 1
AND id_shop = 1 LIMIT 1
0.188 ms 1 /classes/ObjectModel.php:1729
158
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4224 AND `id_group` = 1 LIMIT 1
0.188 ms 0 /classes/GroupReduction.php:156
1022
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.188 ms 1 /classes/Product.php:5659
1243
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.188 ms 1 /classes/Product.php:5659
1790
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 5040 AND `id_group` = 1 LIMIT 1
0.188 ms 0 /classes/GroupReduction.php:156
3537
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4697
0.188 ms 1 /classes/Product.php:2902
3543
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 5033
0.188 ms 1 /classes/Product.php:2902
3804
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 9086
0.188 ms 1 /classes/Product.php:2902
1067
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3041 LIMIT 1
0.187 ms 10 /classes/SpecificPrice.php:435
1510
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4141
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.187 ms 0 /classes/SpecificPrice.php:259
2352
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 228 LIMIT 1
0.187 ms 1 /classes/Product.php:5659
3354
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3184
0.187 ms 1 /classes/Product.php:2902
4071
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 196 AND `id_shop` = 1
0.187 ms 6 /src/Adapter/EntityMapper.php:79
28
SELECT SQL_NO_CACHE `id_lang` FROM `hgt78_lang`
WHERE `locale` = 'fr-fr'
OR `language_code` = 'fr-fr' LIMIT 1
0.187 ms 6 /classes/Language.php:883
967
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4111 LIMIT 1
0.187 ms 10 /classes/SpecificPrice.php:435
1005
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4106 AND id_shop=1 LIMIT 1
0.187 ms 1 /classes/Product.php:6876
1535
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4142 AND id_shop=1 LIMIT 1
0.187 ms 1 /classes/Product.php:6876
2347
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 7958 AND `id_group` = 1 LIMIT 1
0.187 ms 0 /classes/GroupReduction.php:156
2803
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 9097 AND `id_group` = 1 LIMIT 1
0.187 ms 0 /classes/GroupReduction.php:156
3339
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4109
0.187 ms 1 /classes/Product.php:2902
3342
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4106
0.187 ms 1 /classes/Product.php:2902
3923
SELECT SQL_NO_CACHE `id_module` FROM `hgt78_module` WHERE `name` = "iqithtmlandbanners" LIMIT 1
0.187 ms 1 /classes/module/Module.php:2664
4065
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 82 AND `id_shop` = 1
0.187 ms 6 /src/Adapter/EntityMapper.php:79
4082
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 79) LIMIT 1
0.187 ms 1 /src/Adapter/EntityMapper.php:71
779
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.186 ms 1 /classes/Product.php:5659
1386
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.186 ms 1 /classes/Product.php:5659
97
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE `from` BETWEEN '2025-05-01 00:00:00' AND '2025-05-01 23:59:59' LIMIT 1
0.186 ms 1 /classes/SpecificPrice.php:377
146
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4225 AND id_shop=1 LIMIT 1
0.186 ms 1 /classes/Product.php:6876
785
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2550 AND `id_group` = 1 LIMIT 1
0.186 ms 0 /classes/GroupReduction.php:156
1387
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4048 LIMIT 1
0.186 ms 10 /classes/SpecificPrice.php:435
1431
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 209 LIMIT 1
0.186 ms 1 /classes/Product.php:5659
1634
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4306 AND id_shop=1 LIMIT 1
0.186 ms 1 /classes/Product.php:6876
1708
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4697 LIMIT 1
0.186 ms 10 /classes/SpecificPrice.php:435
1718
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 216 LIMIT 1
0.186 ms 1 /classes/Product.php:5659
2266
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 6159 AND id_shop=1 LIMIT 1
0.186 ms 1 /classes/Product.php:6876
2329
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 228 LIMIT 1
0.186 ms 1 /classes/Product.php:5659
2969
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 9733 AND id_shop=1 LIMIT 1
0.186 ms 1 /classes/Product.php:6876
3345
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4116
0.186 ms 1 /classes/Product.php:2902
3621
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 5081
0.186 ms 1 /classes/Product.php:2902
37
SELECT SQL_NO_CACHE id_shop
FROM `hgt78_group_shop`
WHERE `id_group` = 1
AND id_shop = 1 LIMIT 1
0.185 ms 1 /classes/ObjectModel.php:1729
774
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2549 AND `id_group` = 1 LIMIT 1
0.185 ms 0 /classes/GroupReduction.php:156
1408
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.185 ms 1 /classes/Product.php:5659
1497
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.185 ms 1 /classes/Product.php:5659
1620
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4307
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.185 ms 0 /classes/SpecificPrice.php:259
1741
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 5036 LIMIT 1
0.185 ms 10 /classes/SpecificPrice.php:435
2335
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 7957 AND `id_group` = 1 LIMIT 1
0.185 ms 0 /classes/GroupReduction.php:156
2388
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2491
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.185 ms 0 /classes/SpecificPrice.php:259
3324
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4114
0.185 ms 1 /classes/Product.php:2902
3843
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 9101
0.185 ms 1 /classes/Product.php:2902
3849
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 9103
0.185 ms 1 /classes/Product.php:2902
4391
SELECT SQL_NO_CACHE `id_module` FROM `hgt78_module` WHERE `name` = "iqitlinksmanager" LIMIT 1
0.185 ms 1 /classes/module/Module.php:2664
1612
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4303 AND id_shop=1 LIMIT 1
0.185 ms 1 /classes/Product.php:6876
3426
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2916
0.185 ms 1 /classes/Product.php:2902
38
SELECT SQL_NO_CACHE `id_category`
FROM `hgt78_category_shop`
WHERE `id_category` = 2
AND `id_shop` = 1 LIMIT 1
0.184 ms 1 /classes/Category.php:2450
1228
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2474) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.184 ms 1 /classes/stock/StockAvailable.php:453
1292
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2558 AND id_shop=1 LIMIT 1
0.184 ms 1 /classes/Product.php:6876
2272
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 42 LIMIT 1
0.184 ms 1 /classes/Product.php:5659
2952
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `hgt78_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 213 LIMIT 1
0.184 ms 1 /classes/Category.php:1378
3087
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 228 LIMIT 1
0.184 ms 1 /classes/Product.php:5659
973
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4111) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.184 ms 1 /classes/stock/StockAvailable.php:453
1118
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2844) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.184 ms 1 /classes/stock/StockAvailable.php:453
1200
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2517 LIMIT 1
0.184 ms 10 /classes/SpecificPrice.php:435
1365
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4046 LIMIT 1
0.184 ms 10 /classes/SpecificPrice.php:435
1553
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4183 LIMIT 1
0.184 ms 10 /classes/SpecificPrice.php:435
1331
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.183 ms 1 /classes/Product.php:5659
1349
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4043) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.183 ms 1 /classes/stock/StockAvailable.php:453
1503
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4140 AND `id_group` = 1 LIMIT 1
0.183 ms 0 /classes/GroupReduction.php:156
2263
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 6159
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.183 ms 1 /classes/SpecificPrice.php:259
2672
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 9082) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.183 ms 1 /classes/stock/StockAvailable.php:453
3093
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 10999 AND id_shop=1 LIMIT 1
0.183 ms 1 /classes/Product.php:6876
3597
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 5053
0.183 ms 1 /classes/Product.php:2902
730
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2545 AND `id_group` = 1 LIMIT 1
0.183 ms 0 /classes/GroupReduction.php:156
869
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4218
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.183 ms 0 /classes/SpecificPrice.php:259
2341
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 230 LIMIT 1
0.183 ms 1 /classes/Product.php:5659
3435
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3056
0.183 ms 1 /classes/Product.php:2902
1707
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 216 LIMIT 1
0.182 ms 1 /classes/Product.php:5659
1724
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4696 AND `id_group` = 1 LIMIT 1
0.182 ms 0 /classes/GroupReduction.php:156
1965
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 5056 AND id_shop=1 LIMIT 1
0.182 ms 1 /classes/Product.php:6876
2354
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 7959
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.182 ms 0 /classes/SpecificPrice.php:259
3003
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 10467 AND `id_group` = 1 LIMIT 1
0.182 ms 0 /classes/GroupReduction.php:156
3546
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 5036
0.182 ms 1 /classes/Product.php:2902
1034
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4074 LIMIT 1
0.182 ms 10 /classes/SpecificPrice.php:435
1402
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4060 AND id_shop=1 LIMIT 1
0.182 ms 1 /classes/Product.php:6876
1521
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4146
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.182 ms 0 /classes/SpecificPrice.php:259
2534
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 9069 LIMIT 1
0.182 ms 18 /classes/SpecificPrice.php:435
572
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2534
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.181 ms 0 /classes/SpecificPrice.php:259
796
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2552 AND `id_group` = 1 LIMIT 1
0.181 ms 0 /classes/GroupReduction.php:156
1173
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2518) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.181 ms 1 /classes/stock/StockAvailable.php:453
1178
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2476 LIMIT 1
0.181 ms 12 /classes/SpecificPrice.php:435
1444
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4090
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.181 ms 0 /classes/SpecificPrice.php:259
1747
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 5036) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.181 ms 1 /classes/stock/StockAvailable.php:453
1988
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 5058 AND `id_group` = 1 LIMIT 1
0.181 ms 0 /classes/GroupReduction.php:156
2312
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 7952 AND id_shop=1 LIMIT 1
0.181 ms 1 /classes/Product.php:6876
3267
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2545
0.181 ms 1 /classes/Product.php:2902
3774
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 9074
0.181 ms 1 /classes/Product.php:2902
34
SELECT SQL_NO_CACHE id_shop
FROM `hgt78_currency_shop`
WHERE `id_currency` = 1
AND id_shop = 1 LIMIT 1
0.180 ms 1 /classes/ObjectModel.php:1729
180
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4285 AND `id_group` = 1 LIMIT 1
0.180 ms 0 /classes/GroupReduction.php:156
940
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4114) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.180 ms 1 /classes/stock/StockAvailable.php:453
1193
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2487 AND id_shop=1 LIMIT 1
0.180 ms 1 /classes/Product.php:6876
2666
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 9082 LIMIT 1
0.180 ms 18 /classes/SpecificPrice.php:435
2775
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 228 LIMIT 1
0.180 ms 1 /classes/Product.php:5659
3378
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4088
0.180 ms 1 /classes/Product.php:2902
4041
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 262) LIMIT 1
0.180 ms 1 /src/Adapter/EntityMapper.php:71
4043
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 263) LIMIT 1
0.180 ms 1 /src/Adapter/EntityMapper.php:71
4048
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 265 AND `id_shop` = 1
0.180 ms 6 /src/Adapter/EntityMapper.php:79
4072
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 197) LIMIT 1
0.180 ms 1 /src/Adapter/EntityMapper.php:71
581
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.179 ms 1 /classes/Product.php:5659
934
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4114 LIMIT 1
0.179 ms 10 /classes/SpecificPrice.php:435
938
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4114 AND id_shop=1 LIMIT 1
0.179 ms 1 /classes/Product.php:6876
1189
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2487 LIMIT 1
0.179 ms 10 /classes/SpecificPrice.php:435
1513
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4141 AND id_shop=1 LIMIT 1
0.179 ms 1 /classes/Product.php:6876
1740
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.179 ms 1 /classes/Product.php:5659
1778
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 5039 AND id_shop=1 LIMIT 1
0.179 ms 1 /classes/Product.php:6876
2200
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 6153 AND id_shop=1 LIMIT 1
0.179 ms 1 /classes/Product.php:6876
2334
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 7957 AND id_shop=1 LIMIT 1
0.179 ms 1 /classes/Product.php:6876
3720
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2491
0.179 ms 1 /classes/Product.php:2902
3822
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 9094
0.179 ms 1 /classes/Product.php:2902
4046
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 264 AND `id_shop` = 1
0.179 ms 6 /src/Adapter/EntityMapper.php:79
2594
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 9074 AND `id_group` = 1 LIMIT 1
0.179 ms 0 /classes/GroupReduction.php:156
301
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4278 AND `id_group` = 1 LIMIT 1
0.178 ms 0 /classes/GroupReduction.php:156
1250
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2525) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.178 ms 1 /classes/stock/StockAvailable.php:453
1304
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2916 AND `id_group` = 1 LIMIT 1
0.178 ms 0 /classes/GroupReduction.php:156
2302
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 6664 AND `id_group` = 1 LIMIT 1
0.178 ms 0 /classes/GroupReduction.php:156
2428
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 8985) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.178 ms 1 /classes/stock/StockAvailable.php:453
3065
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.178 ms 1 /classes/Product.php:5659
3729
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 8985
0.178 ms 1 /classes/Product.php:2902
108
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 6017 AND `id_group` = 1 LIMIT 1
0.178 ms 0 /classes/GroupReduction.php:156
1359
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4044 AND `id_group` = 1 LIMIT 1
0.178 ms 0 /classes/GroupReduction.php:156
2078
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 5308 AND `id_group` = 1 LIMIT 1
0.178 ms 0 /classes/GroupReduction.php:156
3026
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 10576 AND `id_group` = 1 LIMIT 1
0.177 ms 0 /classes/GroupReduction.php:156
4389
SELECT SQL_NO_CACHE c.`nleft`, c.`nright` FROM `hgt78_category` c
WHERE c.`id_category` = 1 LIMIT 1
0.177 ms 1 /classes/Category.php:1591
4404
SELECT SQL_NO_CACHE psgdpr.active FROM `hgt78_psgdpr_consent` psgdpr
WHERE psgdpr.id_module = 22 LIMIT 1
0.177 ms 12 /modules/psgdpr/classes/GDPRConsent.php:132
92
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 201 LIMIT 1
0.177 ms 1 /classes/Product.php:5659
962
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4112) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.177 ms 1 /classes/stock/StockAvailable.php:453
1254
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.177 ms 1 /classes/Product.php:5659
1265
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.177 ms 1 /classes/Product.php:5659
1436
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4064 AND id_shop=1 LIMIT 1
0.177 ms 1 /classes/Product.php:6876
1841
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 5045
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.177 ms 0 /classes/SpecificPrice.php:259
2528
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 9068 AND `id_group` = 1 LIMIT 1
0.177 ms 0 /classes/GroupReduction.php:156
3056
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 10891
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.177 ms 1 /classes/SpecificPrice.php:259
3591
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 5051
0.177 ms 1 /classes/Product.php:2902
3932
SELECT SQL_NO_CACHE *
FROM `hgt78_currency_lang`
WHERE `id_currency` = 2
0.177 ms 6 /src/Adapter/EntityMapper.php:79
4047
SELECT SQL_NO_CACHE *
FROM `hgt78_category` a
LEFT JOIN `hgt78_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 265) LIMIT 1
0.177 ms 1 /src/Adapter/EntityMapper.php:71
4398
SELECT SQL_NO_CACHE additional FROM hgt78_lgcookieslaw_lang WHERE id_lang = 1 LIMIT 1
0.177 ms 1 /modules/lgcookieslaw/lgcookieslaw.php:161
691
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.176 ms 1 /classes/Product.php:5659
911
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.176 ms 1 /classes/Product.php:5659
1404
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4060) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.176 ms 1 /classes/stock/StockAvailable.php:453
2042
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 5159 AND id_shop=1 LIMIT 1
0.176 ms 1 /classes/Product.php:6876
122
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2553 AND id_shop=1 LIMIT 1
0.176 ms 1 /classes/Product.php:6876
916
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4210 AND id_shop=1 LIMIT 1
0.176 ms 1 /classes/Product.php:6876
1204
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2517 AND id_shop=1 LIMIT 1
0.176 ms 1 /classes/Product.php:6876
1277
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2597 LIMIT 1
0.176 ms 10 /classes/SpecificPrice.php:435
1321
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2430 LIMIT 1
0.176 ms 10 /classes/SpecificPrice.php:435
1767
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 5038 AND id_shop=1 LIMIT 1
0.176 ms 1 /classes/Product.php:6876
1918
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 5052
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.176 ms 0 /classes/SpecificPrice.php:259
2375
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 76 LIMIT 1
0.176 ms 1 /classes/Product.php:5659
3600
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 5054
0.176 ms 1 /classes/Product.php:2902
3711
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 7959
0.176 ms 1 /classes/Product.php:2902
4393
SELECT SQL_NO_CACHE `id_module` FROM `hgt78_module` WHERE `name` = "iqitcontactpage" LIMIT 1
0.176 ms 1 /classes/module/Module.php:2664
1419
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.175 ms 1 /classes/Product.php:5659
1673
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `hgt78_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 216 LIMIT 1
0.175 ms 1 /classes/Category.php:1378
1789
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 5040 AND id_shop=1 LIMIT 1
0.175 ms 1 /classes/Product.php:6876
1984
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 5058
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.175 ms 0 /classes/SpecificPrice.php:259
2039
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 5159
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.175 ms 0 /classes/SpecificPrice.php:259
2054
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 5173 AND id_shop=1 LIMIT 1
0.175 ms 1 /classes/Product.php:6876
2189
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 6152 AND id_shop=1 LIMIT 1
0.175 ms 1 /classes/Product.php:6876
2357
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 7959 AND id_shop=1 LIMIT 1
0.175 ms 1 /classes/Product.php:6876
3390
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2518
0.175 ms 1 /classes/Product.php:2902
3414
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2526
0.175 ms 1 /classes/Product.php:2902
3483
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4141
0.175 ms 1 /classes/Product.php:2902
3513
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4307
0.175 ms 1 /classes/Product.php:2902
3519
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4304
0.175 ms 1 /classes/Product.php:2902
4057
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 59 AND `id_shop` = 1
0.175 ms 6 /src/Adapter/EntityMapper.php:79
4093
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 42 AND `id_shop` = 1
0.175 ms 6 /src/Adapter/EntityMapper.php:79
242
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2554
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.174 ms 0 /classes/SpecificPrice.php:259
1360
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4044) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.174 ms 1 /classes/stock/StockAvailable.php:453
1481
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4133 AND `id_group` = 1 LIMIT 1
0.174 ms 0 /classes/GroupReduction.php:156
1488
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4148
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.174 ms 1 /classes/SpecificPrice.php:259
1536
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4142 AND `id_group` = 1 LIMIT 1
0.174 ms 0 /classes/GroupReduction.php:156
1697
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4577 LIMIT 1
0.174 ms 10 /classes/SpecificPrice.php:435
2089
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 5322 AND id_shop=1 LIMIT 1
0.174 ms 1 /classes/Product.php:6876
2201
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 6153 AND `id_group` = 1 LIMIT 1
0.174 ms 0 /classes/GroupReduction.php:156
2380
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2515 AND id_shop=1 LIMIT 1
0.174 ms 1 /classes/Product.php:6876
3564
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 5042
0.174 ms 1 /classes/Product.php:2902
3738
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 9058
0.174 ms 1 /classes/Product.php:2902
3741
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 9059
0.174 ms 1 /classes/Product.php:2902
3474
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4133
0.174 ms 1 /classes/Product.php:2902
594
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4328
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.173 ms 0 /classes/SpecificPrice.php:259
1217
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2516) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.173 ms 1 /classes/stock/StockAvailable.php:453
1455
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4129
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.173 ms 0 /classes/SpecificPrice.php:259
3618
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 5078
0.173 ms 1 /classes/Product.php:2902
3693
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 6435
0.173 ms 1 /classes/Product.php:2902
323
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4276 AND `id_group` = 1 LIMIT 1
0.173 ms 0 /classes/GroupReduction.php:156
1731
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 5033
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.173 ms 0 /classes/SpecificPrice.php:259
2145
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 5472 AND id_shop=1 LIMIT 1
0.173 ms 1 /classes/Product.php:6876
416
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.172 ms 1 /classes/Product.php:5659
1100
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2606 LIMIT 1
0.172 ms 10 /classes/SpecificPrice.php:435
1336
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3056 AND id_shop=1 LIMIT 1
0.172 ms 1 /classes/Product.php:6876
3285
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2552
0.172 ms 1 /classes/Product.php:2902
3696
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 6664
0.172 ms 1 /classes/Product.php:2902
308
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4277
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.171 ms 0 /classes/SpecificPrice.php:259
1002
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4106
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.171 ms 0 /classes/SpecificPrice.php:259
1287
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.171 ms 1 /classes/Product.php:5659
3636
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 5308
0.171 ms 1 /classes/Product.php:2902
1023
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4069 LIMIT 1
0.170 ms 10 /classes/SpecificPrice.php:435
1680
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4573 AND `id_group` = 1 LIMIT 1
0.170 ms 0 /classes/GroupReduction.php:156
39
SELECT SQL_NO_CACHE ctg.`id_group`
FROM hgt78_category_group ctg
WHERE ctg.`id_category` = 2 AND ctg.`id_group` = 1 LIMIT 1
0.170 ms 1 /classes/Category.php:1754
341
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4263
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.170 ms 0 /classes/SpecificPrice.php:259
1056
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3042 LIMIT 1
0.170 ms 10 /classes/SpecificPrice.php:435
1316
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 2801) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.170 ms 1 /classes/stock/StockAvailable.php:453
1459
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4129 AND `id_group` = 1 LIMIT 1
0.170 ms 0 /classes/GroupReduction.php:156
1685
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.170 ms 1 /classes/Product.php:5659
1725
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4696) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.170 ms 1 /classes/stock/StockAvailable.php:453
2086
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 5322
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.170 ms 0 /classes/SpecificPrice.php:259
2604
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 9075 AND id_shop=1 LIMIT 1
0.170 ms 1 /classes/Product.php:6876
3411
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2525
0.170 ms 1 /classes/Product.php:2902
3423
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2558
0.170 ms 1 /classes/Product.php:2902
3579
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 5047
0.170 ms 1 /classes/Product.php:2902
3714
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 7962
0.170 ms 1 /classes/Product.php:2902
65
SELECT SQL_NO_CACHE `need_identification_number`
FROM `hgt78_country`
WHERE `id_country` = 8 LIMIT 1
0.169 ms 1 /classes/Country.php:405
373
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4259 LIMIT 1
0.169 ms 10 /classes/SpecificPrice.php:435
396
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4212
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.169 ms 0 /classes/SpecificPrice.php:259
1112
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2844 LIMIT 1
0.169 ms 10 /classes/SpecificPrice.php:435
1347
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4043 AND id_shop=1 LIMIT 1
0.169 ms 1 /classes/Product.php:6876
1598
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4207
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.169 ms 0 /classes/SpecificPrice.php:259
1839
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.169 ms 1 /classes/Product.php:5659
1922
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 5052 AND `id_group` = 1 LIMIT 1
0.169 ms 0 /classes/GroupReduction.php:156
2323
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 7954 AND id_shop=1 LIMIT 1
0.169 ms 1 /classes/Product.php:6876
2377
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2515
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.169 ms 0 /classes/SpecificPrice.php:259
4395
SELECT SQL_NO_CACHE `name`
FROM `hgt78_hook`
WHERE `id_hook` = 912 LIMIT 1
0.169 ms 1 /classes/Hook.php:247
136
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 12682 AND `id_group` = 1 LIMIT 1
0.169 ms 0 /classes/GroupReduction.php:156
1167
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2518 LIMIT 1
0.169 ms 10 /classes/SpecificPrice.php:435
1303
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2916 AND id_shop=1 LIMIT 1
0.169 ms 1 /classes/Product.php:6876
2692
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 9085 AND id_shop=1 LIMIT 1
0.169 ms 1 /classes/Product.php:6876
2880
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 9104 AND `id_group` = 1 LIMIT 1
0.169 ms 0 /classes/GroupReduction.php:156
1259
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2526 AND id_shop=1 LIMIT 1
0.168 ms 1 /classes/Product.php:6876
1579
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4196 AND id_shop=1 LIMIT 1
0.168 ms 1 /classes/Product.php:6876
1723
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4696 AND id_shop=1 LIMIT 1
0.168 ms 1 /classes/Product.php:6876
2331
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 7957
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.168 ms 0 /classes/SpecificPrice.php:259
2400
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 8978
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.168 ms 1 /classes/SpecificPrice.php:259
3681
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 6157
0.168 ms 1 /classes/Product.php:2902
3885
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 10467
0.168 ms 1 /classes/Product.php:2902
4044
SELECT SQL_NO_CACHE *
FROM `hgt78_category_lang`
WHERE `id_category` = 263 AND `id_shop` = 1
0.168 ms 6 /src/Adapter/EntityMapper.php:79
966
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.168 ms 1 /classes/Product.php:5659
990
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4109 LIMIT 1
0.168 ms 10 /classes/SpecificPrice.php:435
1129
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4088) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.168 ms 1 /classes/stock/StockAvailable.php:453
1293
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2558 AND `id_group` = 1 LIMIT 1
0.168 ms 0 /classes/GroupReduction.php:156
2048
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `hgt78_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 128 LIMIT 1
0.168 ms 1 /classes/Category.php:1378
2687
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 228 LIMIT 1
0.168 ms 1 /classes/Product.php:5659
3456
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4061
0.168 ms 1 /classes/Product.php:2902
62
SELECT SQL_NO_CACHE `id_module` FROM `hgt78_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
0.167 ms 0 /classes/module/Module.php:2137
825
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2540
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.167 ms 0 /classes/SpecificPrice.php:259
985
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 4105) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.167 ms 1 /classes/stock/StockAvailable.php:453
1199
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.167 ms 1 /classes/Product.php:5659
1601
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4207 AND id_shop=1 LIMIT 1
0.167 ms 1 /classes/Product.php:6876
2369
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 7962 AND `id_group` = 1 LIMIT 1
0.167 ms 0 /classes/GroupReduction.php:156
3594
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 5052
0.167 ms 1 /classes/Product.php:2902
1201
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2517
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.167 ms 0 /classes/SpecificPrice.php:259
1568
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4195 AND id_shop=1 LIMIT 1
0.167 ms 1 /classes/Product.php:6876
1751
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.167 ms 1 /classes/Product.php:5659
1762
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.167 ms 1 /classes/Product.php:5659
3624
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 5158
0.167 ms 1 /classes/Product.php:2902
1779
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 5039 AND `id_group` = 1 LIMIT 1
0.166 ms 0 /classes/GroupReduction.php:156
2403
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 8978 AND id_shop=1 LIMIT 1
0.166 ms 1 /classes/Product.php:6876
49
SELECT SQL_NO_CACHE * FROM `hgt78_image_type`
0.166 ms 8 /classes/ImageType.php:161
98
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE `to` BETWEEN '2025-05-01 00:00:00' AND '2025-05-01 23:59:59' LIMIT 1
0.166 ms 1 /classes/SpecificPrice.php:381
1116
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2844 AND id_shop=1 LIMIT 1
0.166 ms 1 /classes/Product.php:6876
1194
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2487 AND `id_group` = 1 LIMIT 1
0.166 ms 0 /classes/GroupReduction.php:156
1499
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4140
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.166 ms 0 /classes/SpecificPrice.php:259
1524
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4146 AND id_shop=1 LIMIT 1
0.166 ms 1 /classes/Product.php:6876
1569
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4195 AND `id_group` = 1 LIMIT 1
0.166 ms 0 /classes/GroupReduction.php:156
1618
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.166 ms 1 /classes/Product.php:5659
2605
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 9075 AND `id_group` = 1 LIMIT 1
0.166 ms 0 /classes/GroupReduction.php:156
3444
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4046
0.166 ms 1 /classes/Product.php:2902
3528
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4573
0.166 ms 1 /classes/Product.php:2902
1492
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4148 AND `id_group` = 1 LIMIT 1
0.165 ms 0 /classes/GroupReduction.php:156
2095
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `hgt78_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 218 LIMIT 1
0.165 ms 1 /classes/Category.php:1378
2411
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 8984 LIMIT 1
0.165 ms 18 /classes/SpecificPrice.php:435
3687
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 6159
0.165 ms 1 /classes/Product.php:2902
3914
SELECT SQL_NO_CACHE ctg.`id_group`
FROM hgt78_category_group ctg
WHERE ctg.`id_category` = 2 AND ctg.`id_group` = 1 LIMIT 1
0.165 ms 1 /classes/Category.php:1754
289
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4313 AND id_shop=1 LIMIT 1
0.164 ms 1 /classes/Product.php:6876
1380
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4047 AND id_shop=1 LIMIT 1
0.164 ms 1 /classes/Product.php:6876
1696
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.164 ms 1 /classes/Product.php:5659
2267
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 6159 AND `id_group` = 1 LIMIT 1
0.164 ms 0 /classes/GroupReduction.php:156
2286
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 6435
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.164 ms 0 /classes/SpecificPrice.php:259
3906
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 10928
0.164 ms 1 /classes/Product.php:2902
383
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.163 ms 1 /classes/Product.php:5659
1413
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4061 AND id_shop=1 LIMIT 1
0.163 ms 1 /classes/Product.php:6876
1414
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4061 AND `id_group` = 1 LIMIT 1
0.163 ms 0 /classes/GroupReduction.php:156
2175
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 6151
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.163 ms 0 /classes/SpecificPrice.php:259
2448
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 9057 AND id_shop=1 LIMIT 1
0.163 ms 1 /classes/Product.php:6876
2791
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 9096 AND id_shop=1 LIMIT 1
0.163 ms 1 /classes/Product.php:6876
3453
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4060
0.163 ms 1 /classes/Product.php:2902
3516
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4306
0.163 ms 1 /classes/Product.php:2902
3708
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 7958
0.163 ms 1 /classes/Product.php:2902
1222
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2474 LIMIT 1
0.163 ms 10 /classes/SpecificPrice.php:435
1563
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.163 ms 1 /classes/Product.php:5659
1574
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.163 ms 1 /classes/Product.php:5659
917
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4210 AND `id_group` = 1 LIMIT 1
0.162 ms 0 /classes/GroupReduction.php:156
1146
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2523
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.162 ms 0 /classes/SpecificPrice.php:259
2421
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 47 LIMIT 1
0.162 ms 1 /classes/Product.php:5659
198
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4280
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.162 ms 0 /classes/SpecificPrice.php:259
1326
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2430 AND `id_group` = 1 LIMIT 1
0.162 ms 0 /classes/GroupReduction.php:156
3294
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2540
0.162 ms 1 /classes/Product.php:2902
3759
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 9069
0.162 ms 1 /classes/Product.php:2902
202
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4280 AND `id_group` = 1 LIMIT 1
0.161 ms 0 /classes/GroupReduction.php:156
542
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2531 AND id_shop=1 LIMIT 1
0.161 ms 1 /classes/Product.php:6876
1278
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2597
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.161 ms 0 /classes/SpecificPrice.php:259
1609
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4303
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.161 ms 0 /classes/SpecificPrice.php:259
2392
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2491 AND `id_group` = 1 LIMIT 1
0.161 ms 0 /classes/GroupReduction.php:156
3642
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 5331
0.161 ms 1 /classes/Product.php:2902
3702
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 7954
0.161 ms 1 /classes/Product.php:2902
389
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4248 AND `id_group` = 1 LIMIT 1
0.160 ms 0 /classes/GroupReduction.php:156
2083
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `hgt78_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 210 LIMIT 1
0.160 ms 1 /classes/Category.php:1378
2500
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 9063
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.160 ms 0 /classes/SpecificPrice.php:259
2616
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 9076 AND `id_group` = 1 LIMIT 1
0.160 ms 0 /classes/GroupReduction.php:156
2955
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 9266
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.160 ms 0 /classes/SpecificPrice.php:259
3048
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 10853 AND `id_group` = 1 LIMIT 1
0.160 ms 0 /classes/GroupReduction.php:156
3094
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 10999 AND `id_group` = 1 LIMIT 1
0.160 ms 0 /classes/GroupReduction.php:156
3297
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2544
0.160 ms 1 /classes/Product.php:2902
3570
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 5044
0.160 ms 1 /classes/Product.php:2902
3648
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 5334
0.160 ms 1 /classes/Product.php:2902
3669
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 6153
0.160 ms 1 /classes/Product.php:2902
3888
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 10469
0.160 ms 1 /classes/Product.php:2902
4385
SELECT SQL_NO_CACHE `id_module` FROM `hgt78_module_shop` WHERE `id_module` = 13 AND `id_shop` = 1 LIMIT 1
0.160 ms 1 /classes/module/Module.php:2137
209
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4279
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.159 ms 0 /classes/SpecificPrice.php:259
429
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3183
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.159 ms 0 /classes/SpecificPrice.php:259
955
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.159 ms 1 /classes/Product.php:5659
1045
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 3184 LIMIT 1
0.159 ms 10 /classes/SpecificPrice.php:435
1398
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4060 LIMIT 1
0.159 ms 10 /classes/SpecificPrice.php:435
1399
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4060
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.159 ms 0 /classes/SpecificPrice.php:259
1448
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4090 AND `id_group` = 1 LIMIT 1
0.159 ms 0 /classes/GroupReduction.php:156
1477
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4133
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.159 ms 0 /classes/SpecificPrice.php:259
1629
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.159 ms 1 /classes/Product.php:5659
1631
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4306
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.159 ms 0 /classes/SpecificPrice.php:259
1676
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4573
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.159 ms 0 /classes/SpecificPrice.php:259
2667
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 9082
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.159 ms 0 /classes/SpecificPrice.php:259
3777
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 9075
0.159 ms 1 /classes/Product.php:2902
449
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.158 ms 1 /classes/Product.php:5659
465
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4270 AND id_shop=1 LIMIT 1
0.158 ms 1 /classes/Product.php:6876
1233
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 2524 LIMIT 1
0.158 ms 10 /classes/SpecificPrice.php:435
1596
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.158 ms 1 /classes/Product.php:5659
1679
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4573 AND id_shop=1 LIMIT 1
0.158 ms 1 /classes/Product.php:6876
2032
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 5158 AND `id_group` = 1 LIMIT 1
0.158 ms 0 /classes/GroupReduction.php:156
3071
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 10926 AND `id_group` = 1 LIMIT 1
0.158 ms 0 /classes/GroupReduction.php:156
3864
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 9108
0.158 ms 1 /classes/Product.php:2902
4403
SELECT SQL_NO_CACHE `id_module` FROM `hgt78_module_shop` WHERE `id_module` = 22 AND `id_shop` = 1 LIMIT 1
0.158 ms 1 /classes/module/Module.php:2137
972
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4111 AND `id_group` = 1 LIMIT 1
0.158 ms 0 /classes/GroupReduction.php:156
2498
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 228 LIMIT 1
0.158 ms 1 /classes/Product.php:5659
3360
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3041
0.158 ms 1 /classes/Product.php:2902
99
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 6017
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.157 ms 0 /classes/SpecificPrice.php:259
763
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2548 AND `id_group` = 1 LIMIT 1
0.157 ms 0 /classes/GroupReduction.php:156
817
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2539 AND id_shop=1 LIMIT 1
0.157 ms 1 /classes/Product.php:6876
1466
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4130
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.157 ms 0 /classes/SpecificPrice.php:259
3651
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 5470
0.157 ms 1 /classes/Product.php:2902
3684
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 6158
0.157 ms 1 /classes/Product.php:2902
3747
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 9062
0.157 ms 1 /classes/Product.php:2902
1016
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4116 AND id_shop=1 LIMIT 1
0.157 ms 1 /classes/Product.php:6876
1238
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2524 AND `id_group` = 1 LIMIT 1
0.157 ms 0 /classes/GroupReduction.php:156
1800
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 5041 AND id_shop=1 LIMIT 1
0.157 ms 1 /classes/Product.php:6876
2879
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 9104 AND id_shop=1 LIMIT 1
0.157 ms 1 /classes/Product.php:6876
3336
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4105
0.157 ms 1 /classes/Product.php:2902
3663
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 6151
0.157 ms 1 /classes/Product.php:2902
3672
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 6154
0.157 ms 1 /classes/Product.php:2902
3798
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 9084
0.157 ms 1 /classes/Product.php:2902
3855
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 9105
0.157 ms 1 /classes/Product.php:2902
1674
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 216 LIMIT 1
0.156 ms 1 /classes/Product.php:5659
2737
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 9091 AND `id_group` = 1 LIMIT 1
0.156 ms 0 /classes/GroupReduction.php:156
2854
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 9102
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.156 ms 0 /classes/SpecificPrice.php:259
3372
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2844
0.156 ms 1 /classes/Product.php:2902
3858
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 9106
0.156 ms 1 /classes/Product.php:2902
290
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4313 AND `id_group` = 1 LIMIT 1
0.156 ms 0 /classes/GroupReduction.php:156
1757
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 5037 AND `id_group` = 1 LIMIT 1
0.156 ms 0 /classes/GroupReduction.php:156
1764
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 5038
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.156 ms 0 /classes/SpecificPrice.php:259
3627
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 5159
0.156 ms 1 /classes/Product.php:2902
3780
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 9076
0.156 ms 1 /classes/Product.php:2902
3891
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 10576
0.156 ms 1 /classes/Product.php:2902
3928
SELECT SQL_NO_CACHE `id_module` FROM `hgt78_module` WHERE `name` = "ps_currencyselector" LIMIT 1
0.156 ms 1 /classes/module/Module.php:2664
971
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4111 AND id_shop=1 LIMIT 1
0.155 ms 1 /classes/Product.php:6876
979
SELECT SQL_NO_CACHE 1 FROM `hgt78_specific_price` WHERE id_product = 4105 LIMIT 1
0.155 ms 10 /classes/SpecificPrice.php:435
1226
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2474 AND id_shop=1 LIMIT 1
0.155 ms 1 /classes/Product.php:6876
1642
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4304
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.155 ms 1 /classes/SpecificPrice.php:259
3465
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4090
0.155 ms 1 /classes/Product.php:2902
3675
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 6155
0.155 ms 1 /classes/Product.php:2902
3762
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 9070
0.155 ms 1 /classes/Product.php:2902
1188
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.154 ms 1 /classes/Product.php:5659
1260
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2526 AND `id_group` = 1 LIMIT 1
0.154 ms 0 /classes/GroupReduction.php:156
1320
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.154 ms 1 /classes/Product.php:5659
1364
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.154 ms 1 /classes/Product.php:5659
1590
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4206 AND id_shop=1 LIMIT 1
0.154 ms 1 /classes/Product.php:6876
1624
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4307 AND `id_group` = 1 LIMIT 1
0.154 ms 0 /classes/GroupReduction.php:156
1646
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4304 AND `id_group` = 1 LIMIT 1
0.154 ms 0 /classes/GroupReduction.php:156
1651
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.154 ms 1 /classes/Product.php:5659
2524
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 9068
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.154 ms 0 /classes/SpecificPrice.php:259
2601
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 9075
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.154 ms 0 /classes/SpecificPrice.php:259
3082
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 10928 AND `id_group` = 1 LIMIT 1
0.154 ms 0 /classes/GroupReduction.php:156
3879
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 10423
0.154 ms 1 /classes/Product.php:2902
268
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4315 AND `id_group` = 1 LIMIT 1
0.153 ms 0 /classes/GroupReduction.php:156
312
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4277 AND `id_group` = 1 LIMIT 1
0.153 ms 0 /classes/GroupReduction.php:156
1055
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.153 ms 1 /classes/Product.php:5659
1552
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.153 ms 1 /classes/Product.php:5659
3630
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 5173
0.153 ms 1 /classes/Product.php:2902
2062
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 5174
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.153 ms 0 /classes/SpecificPrice.php:259
2540
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 9069) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.153 ms 1 /classes/stock/StockAvailable.php:453
3792
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 9081
0.153 ms 1 /classes/Product.php:2902
352
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4262
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.152 ms 0 /classes/SpecificPrice.php:259
949
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4113 AND id_shop=1 LIMIT 1
0.152 ms 1 /classes/Product.php:6876
1824
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 5043) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.152 ms 1 /classes/stock/StockAvailable.php:453
2090
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 5322 AND `id_group` = 1 LIMIT 1
0.152 ms 0 /classes/GroupReduction.php:156
2178
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 6151 AND id_shop=1 LIMIT 1
0.152 ms 1 /classes/Product.php:6876
2368
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 7962 AND id_shop=1 LIMIT 1
0.152 ms 1 /classes/Product.php:6876
2676
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 228 LIMIT 1
0.152 ms 1 /classes/Product.php:5659
924
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4213
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.152 ms 0 /classes/SpecificPrice.php:259
1050
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3184 AND `id_group` = 1 LIMIT 1
0.152 ms 0 /classes/GroupReduction.php:156
1745
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 5036 AND id_shop=1 LIMIT 1
0.152 ms 1 /classes/Product.php:6876
2284
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 277 LIMIT 1
0.152 ms 1 /classes/Product.php:5659
1314
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2801 AND id_shop=1 LIMIT 1
0.151 ms 1 /classes/Product.php:6876
2551
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 9070) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.151 ms 1 /classes/stock/StockAvailable.php:453
2704
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 9086 AND `id_group` = 1 LIMIT 1
0.151 ms 0 /classes/GroupReduction.php:156
3405
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2474
0.151 ms 1 /classes/Product.php:2902
3468
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4129
0.151 ms 1 /classes/Product.php:2902
4396
SELECT SQL_NO_CACHE content FROM hgt78_lgcookieslaw_lang WHERE id_lang = 1 LIMIT 1
0.151 ms 1 /modules/lgcookieslaw/lgcookieslaw.php:161
109
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_group`
WHERE `id_group` = 1 LIMIT 1
0.151 ms 1 /classes/Group.php:154
279
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4314 AND `id_group` = 1 LIMIT 1
0.151 ms 0 /classes/GroupReduction.php:156
1049
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3184 AND id_shop=1 LIMIT 1
0.151 ms 1 /classes/Product.php:6876
1190
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2487
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.151 ms 0 /classes/SpecificPrice.php:259
1210
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.151 ms 1 /classes/Product.php:5659
1337
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3056 AND `id_group` = 1 LIMIT 1
0.151 ms 0 /classes/GroupReduction.php:156
1640
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.151 ms 1 /classes/Product.php:5659
1690
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4576 AND id_shop=1 LIMIT 1
0.151 ms 1 /classes/Product.php:6876
2278
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 6198 AND `id_group` = 1 LIMIT 1
0.151 ms 0 /classes/GroupReduction.php:156
477
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4269 AND `id_group` = 1 LIMIT 1
0.150 ms 0 /classes/GroupReduction.php:156
1182
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2476 AND id_shop=1 LIMIT 1
0.150 ms 1 /classes/Product.php:6876
1388
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4048
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.150 ms 0 /classes/SpecificPrice.php:259
1546
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4144 AND id_shop=1 LIMIT 1
0.150 ms 1 /classes/Product.php:6876
1623
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4307 AND id_shop=1 LIMIT 1
0.150 ms 1 /classes/Product.php:6876
2409
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `hgt78_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 47 LIMIT 1
0.150 ms 1 /classes/Category.php:1378
213
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4279 AND `id_group` = 1 LIMIT 1
0.149 ms 0 /classes/GroupReduction.php:156
680
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.149 ms 1 /classes/Product.php:5659
946
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4113
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.149 ms 0 /classes/SpecificPrice.php:259
977
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `hgt78_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 214 LIMIT 1
0.149 ms 1 /classes/Category.php:1378
1006
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4106 AND `id_group` = 1 LIMIT 1
0.149 ms 0 /classes/GroupReduction.php:156
1060
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3042 AND id_shop=1 LIMIT 1
0.149 ms 1 /classes/Product.php:6876
1333
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3056
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.149 ms 0 /classes/SpecificPrice.php:259
1576
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4196
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.149 ms 0 /classes/SpecificPrice.php:259
1635
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4306 AND `id_group` = 1 LIMIT 1
0.149 ms 0 /classes/GroupReduction.php:156
1645
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4304 AND id_shop=1 LIMIT 1
0.149 ms 1 /classes/Product.php:6876
1653
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4227
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.149 ms 0 /classes/SpecificPrice.php:259
1720
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4696
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.149 ms 0 /classes/SpecificPrice.php:259
1768
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 5038 AND `id_group` = 1 LIMIT 1
0.149 ms 0 /classes/GroupReduction.php:156
1966
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 5056 AND `id_group` = 1 LIMIT 1
0.149 ms 0 /classes/GroupReduction.php:156
3447
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4047
0.149 ms 1 /classes/Product.php:2902
1245
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2525
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.148 ms 0 /classes/SpecificPrice.php:259
1309
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.148 ms 1 /classes/Product.php:5659
1470
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4130 AND `id_group` = 1 LIMIT 1
0.148 ms 0 /classes/GroupReduction.php:156
2102
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 5331 AND `id_group` = 1 LIMIT 1
0.148 ms 0 /classes/GroupReduction.php:156
3318
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4210
0.148 ms 1 /classes/Product.php:2902
1391
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4048 AND id_shop=1 LIMIT 1
0.148 ms 1 /classes/Product.php:6876
2072
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 42 LIMIT 1
0.148 ms 1 /classes/Product.php:5659
2562
SELECT SQL_NO_CACHE SUM(quantity)
FROM `hgt78_stock_available`
WHERE (id_product = 9071) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.148 ms 1 /classes/stock/StockAvailable.php:453
3801
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 9085
0.148 ms 1 /classes/Product.php:2902
1300
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2916
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.147 ms 0 /classes/SpecificPrice.php:259
1808
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 5042
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.147 ms 0 /classes/SpecificPrice.php:259
3633
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 5174
0.147 ms 1 /classes/Product.php:2902
1088
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.147 ms 1 /classes/Product.php:5659
1256
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2526
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.147 ms 0 /classes/SpecificPrice.php:259
1613
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4303 AND `id_group` = 1 LIMIT 1
0.147 ms 0 /classes/GroupReduction.php:156
1358
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4044 AND id_shop=1 LIMIT 1
0.146 ms 1 /classes/Product.php:6876
10
SELECT SQL_NO_CACHE id_shop
FROM `hgt78_lang_shop`
WHERE `id_lang` = 1
AND id_shop = 1 LIMIT 1
0.146 ms 1 /classes/ObjectModel.php:1729
1425
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4062 AND `id_group` = 1 LIMIT 1
0.146 ms 0 /classes/GroupReduction.php:156
1698
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4577
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.146 ms 0 /classes/SpecificPrice.php:259
1995
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 5059
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.146 ms 0 /classes/SpecificPrice.php:259
3909
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 10999
0.146 ms 1 /classes/Product.php:2902
405
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.145 ms 1 /classes/Product.php:5659
989
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.145 ms 1 /classes/Product.php:5659
1117
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2844 AND `id_group` = 1 LIMIT 1
0.145 ms 0 /classes/GroupReduction.php:156
2179
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 6151 AND `id_group` = 1 LIMIT 1
0.145 ms 0 /classes/GroupReduction.php:156
2358
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 7959 AND `id_group` = 1 LIMIT 1
0.145 ms 0 /classes/GroupReduction.php:156
1104
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2606 AND id_shop=1 LIMIT 1
0.144 ms 1 /classes/Product.php:6876
1403
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4060 AND `id_group` = 1 LIMIT 1
0.144 ms 0 /classes/GroupReduction.php:156
1514
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4141 AND `id_group` = 1 LIMIT 1
0.144 ms 0 /classes/GroupReduction.php:156
1565
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4195
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.144 ms 0 /classes/SpecificPrice.php:259
2066
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 5174 AND `id_group` = 1 LIMIT 1
0.144 ms 0 /classes/GroupReduction.php:156
2113
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 5332 AND `id_group` = 1 LIMIT 1
0.144 ms 0 /classes/GroupReduction.php:156
2290
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 6435 AND `id_group` = 1 LIMIT 1
0.144 ms 0 /classes/GroupReduction.php:156
2503
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 9063 AND id_shop=1 LIMIT 1
0.144 ms 1 /classes/Product.php:6876
3291
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2539
0.144 ms 1 /classes/Product.php:2902
3555
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 5039
0.144 ms 1 /classes/Product.php:2902
3705
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 7957
0.144 ms 1 /classes/Product.php:2902
3744
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 9061
0.144 ms 1 /classes/Product.php:2902
3786
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 9078
0.144 ms 1 /classes/Product.php:2902
3867
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 9144
0.144 ms 1 /classes/Product.php:2902
913
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4210
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.143 ms 0 /classes/SpecificPrice.php:259
1093
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2608 AND id_shop=1 LIMIT 1
0.143 ms 1 /classes/Product.php:6876
1161
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2522 AND `id_group` = 1 LIMIT 1
0.143 ms 0 /classes/GroupReduction.php:156
1973
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 5057
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.143 ms 0 /classes/SpecificPrice.php:259
2404
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 8978 AND `id_group` = 1 LIMIT 1
0.143 ms 0 /classes/GroupReduction.php:156
3351
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4074
0.143 ms 1 /classes/Product.php:2902
3486
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4146
0.143 ms 1 /classes/Product.php:2902
3504
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4206
0.143 ms 1 /classes/Product.php:2902
3861
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 9107
0.143 ms 1 /classes/Product.php:2902
3897
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 10853
0.143 ms 1 /classes/Product.php:2902
1105
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2606 AND `id_group` = 1 LIMIT 1
0.142 ms 0 /classes/GroupReduction.php:156
1657
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4227 AND `id_group` = 1 LIMIT 1
0.142 ms 0 /classes/GroupReduction.php:156
3300
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 3554
0.142 ms 1 /classes/Product.php:2902
3612
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 5058
0.142 ms 1 /classes/Product.php:2902
3666
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 6152
0.142 ms 1 /classes/Product.php:2902
1205
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2517 AND `id_group` = 1 LIMIT 1
0.142 ms 0 /classes/GroupReduction.php:156
2777
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 9095
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.142 ms 0 /classes/SpecificPrice.php:259
950
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4113 AND `id_group` = 1 LIMIT 1
0.141 ms 0 /classes/GroupReduction.php:156
2953
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 213 LIMIT 1
0.141 ms 1 /classes/Product.php:5659
3384
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2523
0.141 ms 1 /classes/Product.php:2902
3723
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 8978
0.141 ms 1 /classes/Product.php:2902
1033
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.141 ms 1 /classes/Product.php:5659
1127
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4088 AND id_shop=1 LIMIT 1
0.141 ms 1 /classes/Product.php:6876
1856
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 5046 AND `id_group` = 1 LIMIT 1
0.141 ms 0 /classes/GroupReduction.php:156
2521
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `hgt78_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 229 LIMIT 1
0.141 ms 1 /classes/Category.php:1378
3060
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 10891 AND `id_group` = 1 LIMIT 1
0.141 ms 0 /classes/GroupReduction.php:156
3498
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4195
0.141 ms 1 /classes/Product.php:2902
3639
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 5322
0.141 ms 1 /classes/Product.php:2902
3735
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 9057
0.141 ms 1 /classes/Product.php:2902
3789
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 9079
0.141 ms 1 /classes/Product.php:2902
451
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4271
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.140 ms 0 /classes/SpecificPrice.php:259
1183
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2476 AND `id_group` = 1 LIMIT 1
0.140 ms 0 /classes/GroupReduction.php:156
1410
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4061
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.140 ms 0 /classes/SpecificPrice.php:259
1756
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 5037 AND id_shop=1 LIMIT 1
0.140 ms 1 /classes/Product.php:6876
3408
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 2524
0.140 ms 1 /classes/Product.php:2902
3489
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 4142
0.140 ms 1 /classes/Product.php:2902
3678
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 6156
0.140 ms 1 /classes/Product.php:2902
3783
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 9077
0.140 ms 1 /classes/Product.php:2902
3876
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `hgt78_product_attribute`
WHERE `id_product` = 9733
0.140 ms 1 /classes/Product.php:2902
147
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4225 AND `id_group` = 1 LIMIT 1
0.139 ms 0 /classes/GroupReduction.php:156
1773
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.139 ms 1 /classes/Product.php:5659
2049
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 128 LIMIT 1
0.139 ms 1 /classes/Product.php:5659
2296
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 228 LIMIT 1
0.139 ms 1 /classes/Product.php:5659
2764
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 228 LIMIT 1
0.139 ms 1 /classes/Product.php:5659
2449
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 9057 AND `id_group` = 1 LIMIT 1
0.138 ms 0 /classes/GroupReduction.php:156
367
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4260 AND `id_group` = 1 LIMIT 1
0.137 ms 0 /classes/GroupReduction.php:156
1099
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.137 ms 1 /classes/Product.php:5659
1281
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2597 AND id_shop=1 LIMIT 1
0.137 ms 1 /classes/Product.php:6876
2432
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 47 LIMIT 1
0.137 ms 1 /classes/Product.php:5659
1028
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4069 AND `id_group` = 1 LIMIT 1
0.136 ms 0 /classes/GroupReduction.php:156
1171
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2518 AND id_shop=1 LIMIT 1
0.136 ms 1 /classes/Product.php:6876
1543
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4144
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.136 ms 0 /classes/SpecificPrice.php:259
2715
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 9089 AND `id_group` = 1 LIMIT 1
0.136 ms 0 /classes/GroupReduction.php:156
2753
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 228 LIMIT 1
0.136 ms 1 /classes/Product.php:5659
828
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2540 AND id_shop=1 LIMIT 1
0.136 ms 1 /classes/Product.php:6876
1212
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2516
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.136 ms 0 /classes/SpecificPrice.php:259
1602
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4207 AND `id_group` = 1 LIMIT 1
0.136 ms 0 /classes/GroupReduction.php:156
2043
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 5159 AND `id_group` = 1 LIMIT 1
0.136 ms 0 /classes/GroupReduction.php:156
2876
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 9104
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.136 ms 0 /classes/SpecificPrice.php:259
1691
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4576 AND `id_group` = 1 LIMIT 1
0.135 ms 0 /classes/GroupReduction.php:156
1557
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4183 AND id_shop=1 LIMIT 1
0.135 ms 1 /classes/Product.php:6876
2415
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 8984 AND id_shop=1 LIMIT 1
0.135 ms 1 /classes/Product.php:6876
4394
SELECT SQL_NO_CACHE `id_module` FROM `hgt78_module_shop` WHERE `id_module` = 81 AND `id_shop` = 1 LIMIT 1
0.135 ms 1 /classes/module/Module.php:2137
4399
SELECT SQL_NO_CACHE button1 FROM hgt78_lgcookieslaw_lang WHERE id_lang = 1 LIMIT 1
0.135 ms 1 /modules/lgcookieslaw/lgcookieslaw.php:161
374
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4259
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.134 ms 0 /classes/SpecificPrice.php:259
1353
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.134 ms 1 /classes/Product.php:5659
1709
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4697
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.134 ms 0 /classes/SpecificPrice.php:259
1267
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2599
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.133 ms 0 /classes/SpecificPrice.php:259
1786
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 5040
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.133 ms 0 /classes/SpecificPrice.php:259
1795
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.133 ms 1 /classes/Product.php:5659
1082
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2845 AND id_shop=1 LIMIT 1
0.132 ms 1 /classes/Product.php:6876
1237
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2524 AND id_shop=1 LIMIT 1
0.132 ms 1 /classes/Product.php:6876
2423
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 8985
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.132 ms 0 /classes/SpecificPrice.php:259
1110
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `hgt78_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 208 LIMIT 1
0.132 ms 1 /classes/Category.php:1378
1753
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 5037
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.132 ms 0 /classes/SpecificPrice.php:259
432
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3183 AND id_shop=1 LIMIT 1
0.131 ms 1 /classes/Product.php:6876
944
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.131 ms 1 /classes/Product.php:5659
1348
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4043 AND `id_group` = 1 LIMIT 1
0.131 ms 0 /classes/GroupReduction.php:156
1377
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4047
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.131 ms 0 /classes/SpecificPrice.php:259
1823
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 5043 AND `id_group` = 1 LIMIT 1
0.131 ms 0 /classes/GroupReduction.php:156
3927
SELECT SQL_NO_CACHE `id_module` FROM `hgt78_module_shop` WHERE `id_module` = 27 AND `id_shop` = 1 LIMIT 1
0.131 ms 1 /classes/module/Module.php:2137
983
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4105 AND id_shop=1 LIMIT 1
0.131 ms 1 /classes/Product.php:6876
1101
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2606
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.131 ms 0 /classes/SpecificPrice.php:259
1157
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2522
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.131 ms 0 /classes/SpecificPrice.php:259
1172
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2518 AND `id_group` = 1 LIMIT 1
0.130 ms 0 /classes/GroupReduction.php:156
1249
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2525 AND `id_group` = 1 LIMIT 1
0.130 ms 0 /classes/GroupReduction.php:156
1734
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 5033 AND id_shop=1 LIMIT 1
0.130 ms 1 /classes/Product.php:6876
2084
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 210 LIMIT 1
0.130 ms 1 /classes/Product.php:5659
933
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.129 ms 1 /classes/Product.php:5659
994
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4109 AND id_shop=1 LIMIT 1
0.129 ms 1 /classes/Product.php:6876
1149
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2523 AND id_shop=1 LIMIT 1
0.129 ms 1 /classes/Product.php:6876
1232
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.129 ms 1 /classes/Product.php:5659
1547
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4144 AND `id_group` = 1 LIMIT 1
0.129 ms 0 /classes/GroupReduction.php:156
2324
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 7954 AND `id_group` = 1 LIMIT 1
0.129 ms 0 /classes/GroupReduction.php:156
1066
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.128 ms 1 /classes/Product.php:5659
1077
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.128 ms 1 /classes/Product.php:5659
1113
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2844
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.128 ms 0 /classes/SpecificPrice.php:259
1215
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 2516 AND id_shop=1 LIMIT 1
0.128 ms 1 /classes/Product.php:6876
1369
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4046 AND id_shop=1 LIMIT 1
0.128 ms 1 /classes/Product.php:6876
1397
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.128 ms 1 /classes/Product.php:5659
1525
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4146 AND `id_group` = 1 LIMIT 1
0.128 ms 0 /classes/GroupReduction.php:156
455
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4271 AND `id_group` = 1 LIMIT 1
0.127 ms 0 /classes/GroupReduction.php:156
1133
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 208 LIMIT 1
0.127 ms 1 /classes/Product.php:5659
1221
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.127 ms 1 /classes/Product.php:5659
961
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4112 AND `id_group` = 1 LIMIT 1
0.126 ms 0 /classes/GroupReduction.php:156
984
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4105 AND `id_group` = 1 LIMIT 1
0.126 ms 0 /classes/GroupReduction.php:156
1111
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 208 LIMIT 1
0.126 ms 1 /classes/Product.php:5659
1701
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4577 AND id_shop=1 LIMIT 1
0.126 ms 1 /classes/Product.php:6876
2055
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 5173 AND `id_group` = 1 LIMIT 1
0.126 ms 0 /classes/GroupReduction.php:156
2381
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2515 AND `id_group` = 1 LIMIT 1
0.126 ms 0 /classes/GroupReduction.php:156
2426
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 8985 AND id_shop=1 LIMIT 1
0.126 ms 1 /classes/Product.php:6876
1044
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.126 ms 1 /classes/Product.php:5659
1071
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 3041 AND id_shop=1 LIMIT 1
0.126 ms 1 /classes/Product.php:6876
1375
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.126 ms 1 /classes/Product.php:5659
1554
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4183
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.126 ms 0 /classes/SpecificPrice.php:259
2660
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 9081 AND `id_group` = 1 LIMIT 1
0.125 ms 0 /classes/GroupReduction.php:156
790
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.125 ms 1 /classes/Product.php:5659
1322
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2430
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.125 ms 0 /classes/SpecificPrice.php:259
1580
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4196 AND `id_group` = 1 LIMIT 1
0.125 ms 0 /classes/GroupReduction.php:156
2410
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 47 LIMIT 1
0.125 ms 1 /classes/Product.php:5659
2561
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 9071 AND `id_group` = 1 LIMIT 1
0.125 ms 0 /classes/GroupReduction.php:156
2682
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 9084 AND `id_group` = 1 LIMIT 1
0.125 ms 0 /classes/GroupReduction.php:156
394
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 36 LIMIT 1
0.124 ms 1 /classes/Product.php:5659
1038
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4074 AND id_shop=1 LIMIT 1
0.124 ms 1 /classes/Product.php:6876
1046
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3184
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.124 ms 0 /classes/SpecificPrice.php:259
1138
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4080 AND id_shop=1 LIMIT 1
0.124 ms 1 /classes/Product.php:6876
4392
SELECT SQL_NO_CACHE `id_module` FROM `hgt78_module_shop` WHERE `id_module` = 89 AND `id_shop` = 1 LIMIT 1
0.124 ms 1 /classes/module/Module.php:2137
1797
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 5041
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.123 ms 0 /classes/SpecificPrice.php:259
1844
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 5045 AND id_shop=1 LIMIT 1
0.123 ms 1 /classes/Product.php:6876
2096
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 218 LIMIT 1
0.123 ms 1 /classes/Product.php:5659
1712
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4697 AND id_shop=1 LIMIT 1
0.123 ms 1 /classes/Product.php:6876
1072
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 3041 AND `id_group` = 1 LIMIT 1
0.122 ms 0 /classes/GroupReduction.php:156
2733
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 9091
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.122 ms 0 /classes/SpecificPrice.php:259
2427
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 8985 AND `id_group` = 1 LIMIT 1
0.120 ms 0 /classes/GroupReduction.php:156
2522
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 229 LIMIT 1
0.120 ms 1 /classes/Product.php:5659
1392
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4048 AND `id_group` = 1 LIMIT 1
0.119 ms 0 /classes/GroupReduction.php:156
1742
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 5036
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.119 ms 0 /classes/SpecificPrice.php:259
1068
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3041
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.118 ms 0 /classes/SpecificPrice.php:259
1079
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2845
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.118 ms 0 /classes/SpecificPrice.php:259
1735
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 5033 AND `id_group` = 1 LIMIT 1
0.118 ms 0 /classes/GroupReduction.php:156
2802
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 9097 AND id_shop=1 LIMIT 1
0.118 ms 1 /classes/Product.php:6876
751
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 4281 AND id_shop=1 LIMIT 1
0.117 ms 1 /classes/Product.php:6876
1057
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 3042
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.117 ms 0 /classes/SpecificPrice.php:259
1168
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2518
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.116 ms 0 /classes/SpecificPrice.php:259
1223
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2474
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.116 ms 0 /classes/SpecificPrice.php:259
2583
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 9073 AND `id_group` = 1 LIMIT 1
0.116 ms 0 /classes/GroupReduction.php:156
935
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4114
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.116 ms 0 /classes/SpecificPrice.php:259
1366
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4046
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.116 ms 0 /classes/SpecificPrice.php:259
1135
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4080
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.115 ms 0 /classes/SpecificPrice.php:259
1035
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4074
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.115 ms 0 /classes/SpecificPrice.php:259
1179
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2476
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.114 ms 0 /classes/SpecificPrice.php:259
1234
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 2524
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.113 ms 0 /classes/SpecificPrice.php:259
1315
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2801 AND `id_group` = 1 LIMIT 1
0.113 ms 0 /classes/GroupReduction.php:156
2780
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `hgt78_product_shop`
WHERE `id_product` = 9095 AND id_shop=1 LIMIT 1
0.113 ms 1 /classes/Product.php:6876
980
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4105
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.112 ms 0 /classes/SpecificPrice.php:259
2412
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 8984
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.112 ms 0 /classes/SpecificPrice.php:259
2711
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 9089
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.112 ms 0 /classes/SpecificPrice.php:259
1024
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4069
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.112 ms 0 /classes/SpecificPrice.php:259
991
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 4109
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.111 ms 0 /classes/SpecificPrice.php:259
939
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4114 AND `id_group` = 1 LIMIT 1
0.110 ms 0 /classes/GroupReduction.php:156
829
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2540 AND `id_group` = 1 LIMIT 1
0.110 ms 0 /classes/GroupReduction.php:156
1381
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4047 AND `id_group` = 1 LIMIT 1
0.110 ms 0 /classes/GroupReduction.php:156
2781
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 9095 AND `id_group` = 1 LIMIT 1
0.110 ms 0 /classes/GroupReduction.php:156
807
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2538 AND `id_group` = 1 LIMIT 1
0.109 ms 0 /classes/GroupReduction.php:156
978
SELECT SQL_NO_CACHE name FROM hgt78_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 214 LIMIT 1
0.109 ms 1 /classes/Product.php:5659
1558
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4183 AND `id_group` = 1 LIMIT 1
0.109 ms 0 /classes/GroupReduction.php:156
1845
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 5045 AND `id_group` = 1 LIMIT 1
0.107 ms 0 /classes/GroupReduction.php:156
2512
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 9067
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.107 ms 0 /classes/SpecificPrice.php:259
2489
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `hgt78_specific_price_priority`
WHERE `id_product` = 9062
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.106 ms 0 /classes/SpecificPrice.php:259
1746
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 5036 AND `id_group` = 1 LIMIT 1
0.106 ms 0 /classes/GroupReduction.php:156
1083
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2845 AND `id_group` = 1 LIMIT 1
0.105 ms 0 /classes/GroupReduction.php:156
1227
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2474 AND `id_group` = 1 LIMIT 1
0.104 ms 0 /classes/GroupReduction.php:156
1039
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4074 AND `id_group` = 1 LIMIT 1
0.102 ms 0 /classes/GroupReduction.php:156
1128
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4088 AND `id_group` = 1 LIMIT 1
0.102 ms 0 /classes/GroupReduction.php:156
2416
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 8984 AND `id_group` = 1 LIMIT 1
0.102 ms 0 /classes/GroupReduction.php:156
1713
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4697 AND `id_group` = 1 LIMIT 1
0.102 ms 0 /classes/GroupReduction.php:156
995
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4109 AND `id_group` = 1 LIMIT 1
0.101 ms 0 /classes/GroupReduction.php:156
1150
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2523 AND `id_group` = 1 LIMIT 1
0.101 ms 0 /classes/GroupReduction.php:156
1139
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4080 AND `id_group` = 1 LIMIT 1
0.101 ms 0 /classes/GroupReduction.php:156
1282
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 2597 AND `id_group` = 1 LIMIT 1
0.101 ms 0 /classes/GroupReduction.php:156
1370
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4046 AND `id_group` = 1 LIMIT 1
0.100 ms 0 /classes/GroupReduction.php:156
1702
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 4577 AND `id_group` = 1 LIMIT 1
0.100 ms 0 /classes/GroupReduction.php:156
2516
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 9067 AND `id_group` = 1 LIMIT 1
0.100 ms 0 /classes/GroupReduction.php:156
2550
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 9070 AND `id_group` = 1 LIMIT 1
0.099 ms 0 /classes/GroupReduction.php:156
4400
SELECT SQL_NO_CACHE button2 FROM hgt78_lgcookieslaw_lang WHERE id_lang = 1 LIMIT 1
0.099 ms 1 /modules/lgcookieslaw/lgcookieslaw.php:161
2539
SELECT SQL_NO_CACHE `reduction`
FROM `hgt78_product_group_reduction_cache`
WHERE `id_product` = 9069 AND `id_group` = 1 LIMIT 1
0.097 ms 0 /classes/GroupReduction.php:156

Doubles

274 queries
SELECT *
FROM `hgtXX_product` a
LEFT JOIN `hgtXX_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = XX
LEFT JOIN `hgtXX_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = XX
WHERE (a.`id_product` = XX) AND (b.`id_shop` = XX) LIMIT XX
271 queries
SELECT XX FROM `hgtXX_specific_price` WHERE id_product = XX LIMIT XX
270 queries
SELECT image_shop.`id_image`
                    FROM `hgtXX_image` i
                     INNER JOIN hgtXX_image_shop image_shop
        ON (image_shop.id_image = i.id_image AND image_shop.id_shop = XX)
                    WHERE i.`id_product` = XX
                    AND image_shop.`cover` = XX LIMIT XX
270 queries
SELECT name FROM hgtXX_category_lang WHERE id_shop = XX AND id_lang = XX AND id_category = XX LIMIT XX
270 queries
				SELECT `priority`, `id_specific_price_priority`
				FROM `hgtXX_specific_price_priority`
				WHERE `id_product` = XX
				ORDER BY `id_specific_price_priority` DESC LIMIT XX
270 queries
			SELECT *, ( IF (`id_group` = XX, XX, XX) +  IF (`id_country` = XX, XX, XX) +  IF (`id_currency` = XX, XX, XX) +  IF (`id_shop` = XX, XX, XX) +  IF (`id_customer` = XX, XX, XX)) AS `score`
				FROM `hgtXX_specific_price`
				WHERE
                `id_shop` IN (XX, XX) AND
                `id_currency` IN (XX, XX) AND
                `id_country` IN (XX, XX) AND
                `id_group` IN (XX, XX) AND `id_product` = XX AND `id_customer` = XX AND `id_product_attribute` = XX AND `id_cart` = XX  AND (`from` = 'XX-XX-XX XX:XX:XX' OR 'XX-XX-XX XX:XX:XX' >= `from`) AND (`to` = 'XX-XX-XX XX:XX:XX' OR 'XX-XX-XX XX:XX:XX' <= `to`)
				AND IF(`from_quantity` > XX, `from_quantity`, XX) <= XX ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT XX
270 queries
SELECT product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,XX) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `hgtXX_product` p
INNER JOIN `hgtXX_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = XX)
LEFT JOIN `hgtXX_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = XX)
WHERE (p.`id_product` = XX)
270 queries
                            SELECT `id_tax_rules_group`
                            FROM `hgtXX_product_shop`
                            WHERE `id_product` = XX AND id_shop=XX LIMIT XX
270 queries
			SELECT `reduction`
			FROM `hgtXX_product_group_reduction_cache`
			WHERE `id_product` = XX AND `id_group` = XX LIMIT XX
270 queries
SELECT SUM(quantity)
FROM `hgtXX_stock_available`
WHERE (id_product = XX) AND (id_product_attribute = XX) AND (id_shop = XX) AND (id_shop_group = XX) LIMIT XX
270 queries
SELECT
            COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), XX) as deep_quantity,
            COALESCE(SUM(first_level_quantity), XX) as quantity
          FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, XX as pack_quantity
          FROM `hgtXX_cart_product` cp
            WHERE cp.`id_product_attribute` = XX
            
            AND cp.`id_cart` = XX AND cp.`id_product` = XX UNION SELECT XX as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
          FROM `hgtXX_cart_product` cp JOIN `hgtXX_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `hgtXX_product` pr ON p.`id_product_pack` = pr.`id_product`
            WHERE cp.`id_product_attribute` = XX
            
            AND cp.`id_cart` = XX AND p.`id_product_item` = XX AND (pr.`pack_stock_type` IN (XX,XX) OR (
            pr.`pack_stock_type` = XX
            AND XX = XX
        ))) as q LIMIT XX
270 queries
                SELECT name, value, pf.id_feature, f.position, fvl.id_feature_value
                FROM hgtXX_feature_product pf
                LEFT JOIN hgtXX_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = XX)
                LEFT JOIN hgtXX_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = XX)
                LEFT JOIN hgtXX_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = XX)
                 INNER JOIN hgtXX_feature_shop feature_shop
        ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = XX)
                WHERE pf.id_product = XX
                ORDER BY f.position ASC
270 queries
            SELECT image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
            FROM `hgtXX_image` i
             INNER JOIN hgtXX_image_shop image_shop
        ON (image_shop.id_image = i.id_image AND image_shop.id_shop = XX)
            LEFT JOIN `hgtXX_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = XX)
            WHERE i.`id_product` = XX
            ORDER BY `position`
270 queries
SELECT `id_product_attribute`
            FROM `hgtXX_product_attribute`
            WHERE `id_product` = XX
270 queries
SELECT pa.`id_product`, a.`color`, pac.`id_product_attribute`, XX qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
            FROM `hgtXX_product_attribute` pa
             INNER JOIN hgtXX_product_attribute_shop product_attribute_shop
        ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = XX)
            JOIN `hgtXX_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
            JOIN `hgtXX_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
            JOIN `hgtXX_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = XX)
            JOIN `hgtXX_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
            WHERE pa.`id_product` IN (XX) AND ag.`is_color_group` = XX
            GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
            
            ORDER BY a.`position` ASC;
71 queries
SELECT *
FROM `hgtXX_category` a
LEFT JOIN `hgtXX_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = XX
WHERE (a.`id_category` = XX) LIMIT XX
71 queries
SELECT *
							FROM `hgtXX_category_lang`
							WHERE `id_category` = XX AND `id_shop` = XX
27 queries
SELECT *
FROM `hgtXX_category` a
LEFT JOIN `hgtXX_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = XX
LEFT JOIN `hgtXX_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = XX
WHERE (a.`id_category` = XX) AND (b.`id_shop` = XX) LIMIT XX
21 queries
			SELECT cl.`link_rewrite`
			FROM `hgtXX_category_lang` cl
			WHERE `id_lang` = XX
			 AND cl.id_shop = XX 
			AND cl.`id_category` = XX LIMIT XX
18 queries
				SELECT c.*, cl.*
				FROM `hgtXX_category` c
				 INNER JOIN hgtXX_category_shop category_shop
        ON (category_shop.id_category = c.id_category AND category_shop.id_shop = XX)
				LEFT JOIN `hgtXX_category_lang` cl ON c.`id_category` = cl.`id_category` AND cl.id_shop = XX 
				LEFT JOIN `hgtXX_category_group` cg ON c.`id_category` = cg.`id_category`
				RIGHT JOIN `hgtXX_category` cXX ON cXX.`id_category` = XX AND c.`nleft` >= cXX.`nleft` AND c.`nright` <= cXX.`nright`
				WHERE XX  AND `id_lang` = XX
				 AND c.`active` = XX
				 AND cg.`id_group` IN (XX)
				 GROUP BY c.`id_category`
				 ORDER BY c.`level_depth` ASC
				, category_shop.`position` ASC
				
10 queries
SELECT `id_module` FROM `hgtXX_module_shop` WHERE `id_module` = XX AND `id_shop` = XX LIMIT XX
4 queries
SELECT `id_lang` FROM `hgtXX_lang`
                    WHERE `locale` = 'fr-fr'
                    OR `language_code` = 'fr-fr' LIMIT XX
3 queries
							SELECT `name`
							FROM `hgtXX_hook`
							WHERE `id_hook` = XX LIMIT XX
3 queries
				SELECT tr.*
				FROM `hgtXX_tax_rule` tr
				JOIN `hgtXX_tax_rules_group` trg ON (tr.`id_tax_rules_group` = trg.`id_tax_rules_group`)
				WHERE trg.`active` = XX
				AND tr.`id_country` = XX
				AND tr.`id_tax_rules_group` = XX
				AND tr.`id_state` IN (XX, XX)
				AND ('XX' BETWEEN tr.`zipcode_from` AND tr.`zipcode_to`
					OR (tr.`zipcode_to` = XX AND tr.`zipcode_from` IN(XX, 'XX')))
				ORDER BY tr.`zipcode_from` DESC, tr.`zipcode_to` DESC, tr.`id_state` DESC, tr.`id_country` DESC
2 queries
SELECT lower(name) as name
FROM `hgtXX_hook` h
WHERE (h.active = XX)
2 queries
SELECT h.`name` as hook, m.`id_module`, h.`id_hook`, m.`name` as module
FROM `hgtXX_module` m
 INNER JOIN hgtXX_module_shop module_shop
        ON (module_shop.id_module = m.id_module AND module_shop.id_shop = XX AND module_shop.enable_device & XX)
INNER JOIN `hgtXX_hook_module` `hm` ON hm.`id_module` = m.`id_module`
INNER JOIN `hgtXX_hook` `h` ON hm.`id_hook` = h.`id_hook`
LEFT JOIN `hgtXX_module_group` `mg` ON mg.`id_module` = m.`id_module`
WHERE (h.`name` != "paymentOptions") AND (hm.`id_shop` = XX) AND (mg.id_shop = XX AND  mg.`id_group` IN (XX))
GROUP BY hm.id_hook, hm.id_module
ORDER BY hm.`position`
2 queries
SELECT `name`, `alias` FROM `hgtXX_hook_alias`
2 queries
SELECT `id_hook`, `name` FROM `hgtXX_hook`
2 queries
                SELECT m.`id_module`, m.`name`, ms.`id_module`as `mshop`
                FROM `hgtXX_module` m
                LEFT JOIN `hgtXX_module_shop` ms
                ON m.`id_module` = ms.`id_module`
                AND ms.`id_shop` = XX
2 queries
SELECT name, alias FROM `hgtXX_hook_alias`
2 queries
SELECT * FROM `hgtXX_hook_module_exceptions`
                WHERE `id_shop` IN (XX)
2 queries
SELECT *
FROM `hgtXX_currency` a
LEFT JOIN `hgtXX_currency_lang` `b` ON a.`id_currency` = b.`id_currency` AND b.`id_lang` = XX
LEFT JOIN `hgtXX_currency_shop` `c` ON a.`id_currency` = c.`id_currency` AND c.`id_shop` = XX
WHERE (a.`id_currency` = XX) LIMIT XX
2 queries
SELECT *
FROM `hgtXX_currency` a
LEFT JOIN `hgtXX_currency_shop` `c` ON a.`id_currency` = c.`id_currency` AND c.`id_shop` = XX
WHERE (a.`id_currency` = XX) LIMIT XX
2 queries
SELECT *
							FROM `hgtXX_currency_lang`
							WHERE `id_currency` = XX
2 queries
				SELECT id_shop
				FROM `hgtXX_group_shop`
				WHERE `id_group` = XX
				AND id_shop = XX LIMIT XX
2 queries
		SELECT `id_category`
		FROM `hgtXX_category_shop`
		WHERE `id_category` = XX
		AND `id_shop` = XX LIMIT XX
2 queries
				SELECT ctg.`id_group`
				FROM hgtXX_category_group ctg
				WHERE ctg.`id_category` = XX AND ctg.`id_group` = XX LIMIT XX
2 queries
SELECT *
FROM `hgtXX_shop_url` aXX
2 queries
SELECT XX FROM `hgtXX_cart_rule` WHERE ((date_to >= "XX-XX-XX XX:XX:XX" AND date_to <= "XX-XX-XX XX:XX:XX") OR (date_from >= "XX-XX-XX XX:XX:XX" AND date_from <= "XX-XX-XX XX:XX:XX") OR (date_from < "XX-XX-XX XX:XX:XX" AND date_to > "XX-XX-XX XX:XX:XX")) AND `id_customer` IN (XX,XX) LIMIT XX
2 queries
            SELECT *
            FROM `hgtXX_currency` c
             INNER JOIN hgtXX_currency_shop currency_shop
        ON (currency_shop.id_currency = c.id_currency AND currency_shop.id_shop = XX)
                WHERE c.`deleted` = XX AND c.`active` = XX ORDER BY `iso_code` ASC
2 queries
SELECT buttonXX FROM hgtXX_lgcookieslaw_lang WHERE id_lang = XX LIMIT XX

Tables stress

817 product
817 product_shop
544 specific_price
542 cart_product
541 product_attribute
540 image
540 image_shop
540 product_attribute_shop
415 category_lang
275 product_lang
272 stock_available
271 attribute_group
271 feature
271 feature_shop
271 feature_lang
271 product_attribute_combination
270 specific_price_priority
270 product_group_reduction_cache
270 pack
270 feature_product
270 feature_value_lang
270 image_lang
270 attribute
270 attribute_lang
145 category
120 category_shop
23 category_group
17 module
14 module_shop
12 hook
10 currency
8 currency_shop
7 lang
6 shop_url
5 hook_alias
5 image_type
5 lgcookieslaw_lang
4 shop
4 lang_shop
4 currency_lang
4 cart_rule
3 country
3 hook_module
3 group_shop
3 tax_rule
3 tax_rules_group
2 shop_group
2 configuration
2 country_lang
2 country_shop
2 module_group
2 hook_module_exceptions
2 group
2 category_product
2 cart_rule_lang
2 cms
2 cms_lang
2 cms_shop
2 psgdpr_consent
1 configuration_lang
1 meta
1 meta_lang
1 group_lang
1 feature_flag
1 address_format
1 required_field
1 revslider_sliders
1 carrier
1 carrier_shop
1 carrier_lang
1 carrier_zone
1 carrier_group
1 range_price
1 delivery
1 layered_category
1 attribute_group_shop
1 attribute_group_lang
1 layered_indexable_attribute_group
1 layered_indexable_attribute_group_lang_value
1 layered_indexable_feature
1 layered_indexable_feature_lang_value
1 product_sale
1 layered_filter_block
1 manufacturer
1 tax
1 tax_lang
1 iqit_elementor_category
1 cart_rule_group
1 iqitmegamenu_tabs_shop
1 iqitmegamenu_tabs
1 iqitmegamenu_tabs_lang
1 psgdpr_consent_lang
1 connections

ObjectModel instances

Name Instances Source
Product 278 /classes/Link.php:113 (__construct) [id: 12682]
/classes/Link.php:113 (__construct) [id: 10576]
/classes/Link.php:113 (__construct) [id: 10891]
/classes/Link.php:113 (__construct) [id: 10999]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 6017]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2553]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 12682]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4225]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4224]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4286]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4285]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4282]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4280]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4279]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4309]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4310]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2554]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4317]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4315]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4314]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4313]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4278]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4277]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4276]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4264]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4263]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4262]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4260]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4259]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4248]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4212]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4266]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4275]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3183]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4274]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4271]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4270]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4269]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4267]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2547]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4318]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2528]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2529]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2531]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2532]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2533]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2534]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4329]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4328]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2493]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4327]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4324]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4323]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4322]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4321]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2536]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2537]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2543]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2542]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2541]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2545]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2546]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4281]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2548]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2549]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2550]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2552]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2538]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2539]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2540]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2544]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3554]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3553]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4218]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2941]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4216]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4214]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4210]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4213]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4114]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4113]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4112]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4111]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4105]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4109]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4106]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4116]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4069]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4074]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3184]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3042]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3041]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2845]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2608]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2606]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2844]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4088]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4080]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2523]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2522]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2518]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2476]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2487]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2517]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2516]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2474]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2524]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2525]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2526]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2599]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2597]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2558]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2916]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2801]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2430]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3056]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4043]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4044]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4046]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4047]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4048]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4060]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4061]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4062]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4064]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4090]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4129]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4130]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4133]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4148]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4140]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4141]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4146]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4142]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4144]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4183]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4195]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4196]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4206]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4207]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4303]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4307]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4306]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4304]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4227]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4572]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4573]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4576]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4577]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4697]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4696]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 5033]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 5036]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 5037]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 5038]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 5039]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 5040]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 5041]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 5042]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 5043]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 5044]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 5045]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 5046]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 5047]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 5048]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 5049]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 5050]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 5051]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 5052]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 5053]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 5054]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 5055]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 5056]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 5057]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 5058]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 5059]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 5078]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 5081]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 5158]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 5159]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 5173]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 5174]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 5308]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 5322]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 5331]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 5332]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 5334]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 5470]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 5472]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 6043]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 6044]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 6151]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 6152]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 6153]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 6154]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 6155]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 6156]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 6157]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 6158]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 6159]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 6198]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 6435]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 6664]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 7952]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 7954]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 7957]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 7958]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 7959]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 7962]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2515]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2491]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 8978]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 8984]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 8985]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 8986]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 9057]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 9058]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 9059]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 9061]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 9062]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 9063]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 9067]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 9068]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 9069]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 9070]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 9071]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 9072]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 9073]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 9074]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 9075]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 9076]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 9077]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 9078]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 9079]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 9081]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 9082]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 9084]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 9085]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 9086]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 9089]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 9090]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 9091]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 9092]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 9093]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 9094]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 9095]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 9096]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 9097]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 9098]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 9099]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 9100]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 9101]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 9102]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 9103]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 9104]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 9105]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 9106]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 9107]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 9108]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 9144]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 9262]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 9266]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 9733]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 10423]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 10424]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 10467]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 10469]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 10576]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 10852]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 10853]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 10891]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 10926]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 10928]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 10999]
/classes/Link.php:113 (__construct) [id: 12682]
/classes/Link.php:113 (__construct) [id: 10576]
/classes/Link.php:113 (__construct) [id: 10891]
/classes/Link.php:113 (__construct) [id: 10999]
Category 105 /controllers/front/listing/CategoryController.php:78 (__construct) [id: 2]
/controllers/front/listing/CategoryController.php:216 (__construct) [id: 33]
/controllers/front/listing/CategoryController.php:216 (__construct) [id: 34]
/controllers/front/listing/CategoryController.php:216 (__construct) [id: 35]
/controllers/front/listing/CategoryController.php:216 (__construct) [id: 36]
/controllers/front/listing/CategoryController.php:216 (__construct) [id: 37]
/controllers/front/listing/CategoryController.php:216 (__construct) [id: 38]
/controllers/front/listing/CategoryController.php:216 (__construct) [id: 39]
/controllers/front/listing/CategoryController.php:216 (__construct) [id: 40]
/controllers/front/listing/CategoryController.php:216 (__construct) [id: 44]
/controllers/front/listing/CategoryController.php:216 (__construct) [id: 319]
/controllers/front/listing/CategoryController.php:216 (__construct) [id: 11]
/controllers/front/listing/CategoryController.php:216 (__construct) [id: 12]
/controllers/front/listing/CategoryController.php:216 (__construct) [id: 13]
/controllers/front/listing/CategoryController.php:216 (__construct) [id: 18]
/controllers/front/listing/CategoryController.php:216 (__construct) [id: 19]
/controllers/front/listing/CategoryController.php:216 (__construct) [id: 20]
/classes/Meta.php:380 (__construct) [id: 2]
/classes/PrestaShopCollection.php:385 (hydrateCollection) [id: ]
/classes/Link.php:402 (__construct) [id: 2]
/classes/Link.php:402 (__construct) [id: 2]
/modules/iqitmegamenu/iqitmegamenu.php:3282 (__construct) [id: 40]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 40]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 55]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 71]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 165]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 169]
/modules/iqitmegamenu/iqitmegamenu.php:3282 (__construct) [id: 38]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 38]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 50]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 62]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 72]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 172]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 175]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 185]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 186]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 190]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 334]
/modules/iqitmegamenu/iqitmegamenu.php:3282 (__construct) [id: 34]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 344]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 45]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 46]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 54]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 70]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 78]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 199]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 200]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 35]
/modules/iqitmegamenu/iqitmegamenu.php:3282 (__construct) [id: 216]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 44]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 51]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 56]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 192]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 195]
/modules/iqitmegamenu/iqitmegamenu.php:3282 (__construct) [id: 37]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 37]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 48]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 53]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 73]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 74]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 161]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 162]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 163]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 260]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 261]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 262]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 263]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 264]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 265]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 266]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 307]
/modules/iqitmegamenu/iqitmegamenu.php:3282 (__construct) [id: 35]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 35]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 49]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 59]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 60]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 65]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 81]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 82]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 96]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 145]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 196]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 197]
/modules/iqitmegamenu/iqitmegamenu.php:3282 (__construct) [id: 33]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 33]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 61]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 66]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 79]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 80]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 191]
/modules/iqitmegamenu/iqitmegamenu.php:3282 (__construct) [id: 36]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 36]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 42]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 47]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 76]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 77]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 217]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 221]
/modules/iqitmegamenu/iqitmegamenu.php:3282 (__construct) [id: 39]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 39]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 83]
/modules/iqitmegamenu/iqitmegamenu.php:3491 (__construct) [id: 84]
/classes/Link.php:402 (__construct) [id: 2]
/classes/Link.php:402 (__construct) [id: 2]
/modules/ps_categorytree/ps_categorytree.php:364 (getParentsCategories) [id: 2]
Currency 4 /src/Adapter/Currency/CurrencyDataProvider.php:101 (__construct) [id: 1]
/src/Adapter/Currency/CurrencyDataProvider.php:101 (__construct) [id: 2]
/classes/Tools.php:690 (getCurrencyInstance) [id: 1]
/modules/ps_currencyselector/ps_currencyselector.php:112 (getCurrencies) [id: 2]
Address 4 /classes/shop/Shop.php:486 (__construct) [id: ]
/classes/Product.php:3694 (initialize) [id: ]
/classes/Product.php:3804 (__construct) [id: ]
/classes/Product.php:5964 (__construct) [id: ]
Country 3 /config/config.inc.php:146 (__construct) [id: 8]
/classes/AddressFormat.php:404 (__construct) [id: 8]
/classes/controller/FrontController.php:1779 (__construct) [id: 8]
ShopUrl 2 /classes/PrestaShopCollection.php:385 (hydrateCollection) [id: ]
/classes/PrestaShopCollection.php:385 (hydrateCollection) [id: ]
Language 2 /config/config.inc.php:211 (__construct) [id: 1]
/classes/Tools.php:560 (__construct) [id: 1]
Cart 2 /classes/controller/FrontController.php:467 (__construct) [id: ]
/classes/controller/FrontController.php:541 (__construct) [id: ]
Tax 2 /classes/tax/TaxRulesTaxManager.php:116 (__construct) [id: 1]
/classes/tax/TaxRulesTaxManager.php:116 (__construct) [id: 1]
Carrier 2 /modules/colissimo_simplicite/colissimo_simplicite.php:84 (__construct) [id: 282]
/modules/colissimo_simplicite/colissimo_simplicite.php:1394 (__construct) [id: 282]
Shop 1 /config/config.inc.php:117 (initialize) [id: 1]
CMS 1 /classes/Link.php:555 (__construct) [id: 2]
IqitElementorCategory 1 /modules/iqitelementor/iqitelementor.php:853 (isJustElementor) [id: ]
Risk 1 /classes/controller/FrontController.php:1705 (__construct) [id: ]
State 1 /classes/controller/FrontController.php:1778 (__construct) [id: 0]
AddressFormat 1 /classes/controller/FrontController.php:1773 (generateAddress) [id: ]
Gender 1 /classes/controller/FrontController.php:1702 (__construct) [id: 0]
Group 1 /classes/Cart.php:249 (getCurrent) [id: 1]
Customer 1 /config/config.inc.php:264 (__construct) [id: ]
ShopGroup 1 /classes/shop/Shop.php:561 (__construct) [id: 1]
ConnectionsSource 1 /modules/statsdata/statsdata.php:119 (logHttpReferer) [id: ]

Included Files

# Filename
0 /index.php
1 /config/config.inc.php
2 /config/defines.inc.php
3 /config/autoload.php
4 /vendor/autoload.php
5 /vendor/composer/autoload_real.php
6 /vendor/composer/platform_check.php
7 /vendor/composer/ClassLoader.php
8 /vendor/composer/include_paths.php
9 /vendor/composer/autoload_static.php
10 /vendor/symfony/polyfill-php72/bootstrap.php
11 /vendor/symfony/polyfill-mbstring/bootstrap.php
12 /vendor/symfony/polyfill-mbstring/bootstrap80.php
13 /vendor/symfony/polyfill-intl-normalizer/bootstrap.php
14 /vendor/symfony/polyfill-intl-normalizer/bootstrap80.php
15 /vendor/symfony/polyfill-intl-idn/bootstrap.php
16 /vendor/symfony/deprecation-contracts/function.php
17 /vendor/ralouphie/getallheaders/src/getallheaders.php
18 /vendor/symfony/polyfill-ctype/bootstrap.php
19 /vendor/symfony/polyfill-ctype/bootstrap80.php
20 /vendor/symfony/polyfill-php80/bootstrap.php
21 /vendor/guzzlehttp/promises/src/functions_include.php
22 /vendor/guzzlehttp/promises/src/functions.php
23 /vendor/guzzlehttp/guzzle/src/functions_include.php
24 /vendor/guzzlehttp/guzzle/src/functions.php
25 /vendor/symfony/polyfill-iconv/bootstrap.php
26 /vendor/ezyang/htmlpurifier/library/HTMLPurifier.composer.php
27 /vendor/jakeasmith/http_build_url/src/http_build_url.php
28 /vendor/lcobucci/jwt/compat/class-aliases.php
29 /vendor/lcobucci/jwt/src/Token.php
30 /vendor/lcobucci/jwt/src/Signature.php
31 /vendor/lcobucci/jwt/compat/json-exception-polyfill.php
32 /vendor/lcobucci/jwt/compat/lcobucci-clock-polyfill.php
33 /vendor/swiftmailer/swiftmailer/lib/swift_required.php
34 /vendor/swiftmailer/swiftmailer/lib/classes/Swift.php
35 /vendor/symfony/polyfill-intl-icu/bootstrap.php
36 /vendor/symfony/polyfill-php73/bootstrap.php
37 /vendor/symfony/polyfill-php81/bootstrap.php
38 /vendor/api-platform/core/src/deprecation.php
39 /vendor/api-platform/core/src/Api/FilterInterface.php
40 /vendor/api-platform/core/src/Api/ResourceClassResolverInterface.php
41 /vendor/api-platform/core/src/deprecated_interfaces.php
42 /vendor/api-platform/core/src/Metadata/Property/Factory/PropertyNameCollectionFactoryInterface.php
43 /vendor/api-platform/core/src/Metadata/Resource/Factory/ResourceNameCollectionFactoryInterface.php
44 /vendor/api-platform/core/src/Metadata/Extractor/ResourceExtractorInterface.php
45 /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/DateFilterInterface.php
46 /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/ExistsFilterInterface.php
47 /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/OrderFilterInterface.php
48 /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/RangeFilterInterface.php
49 /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/SearchFilterInterface.php
50 /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Extension/AggregationCollectionExtensionInterface.php
51 /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Extension/AggregationItemExtensionInterface.php
52 /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Extension/AggregationResultCollectionExtensionInterface.php
53 /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Extension/AggregationResultItemExtensionInterface.php
54 /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Filter/FilterInterface.php
55 /vendor/api-platform/core/src/Doctrine/Orm/QueryAwareInterface.php
56 /vendor/api-platform/core/src/Doctrine/Orm/Util/QueryNameGeneratorInterface.php
57 /vendor/api-platform/core/src/Elasticsearch/Metadata/Document/Factory/DocumentMetadataFactoryInterface.php
58 /vendor/api-platform/core/src/Symfony/Validator/ValidationGroupsGeneratorInterface.php
59 /vendor/api-platform/core/src/Symfony/Validator/Exception/ConstraintViolationListAwareExceptionInterface.php
60 /vendor/api-platform/core/src/Exception/ExceptionInterface.php
61 /vendor/api-platform/core/src/Core/Bridge/Symfony/Validator/Metadata/Property/Restriction/PropertySchemaRestrictionMetadataInterface.php
62 /vendor/api-platform/core/src/State/Pagination/PaginatorInterface.php
63 /vendor/api-platform/core/src/State/Pagination/PartialPaginatorInterface.php
64 /vendor/api-platform/core/src/Documentation/DocumentationInterface.php
65 /vendor/api-platform/core/src/JsonLd/AnonymousContextBuilderInterface.php
66 /vendor/api-platform/core/src/JsonLd/ContextBuilderInterface.php
67 /vendor/api-platform/core/src/Core/JsonSchema/SchemaFactoryInterface.php
68 /vendor/api-platform/core/src/JsonSchema/TypeFactoryInterface.php
69 /vendor/api-platform/core/src/OpenApi/Factory/OpenApiFactoryInterface.php
70 /vendor/api-platform/core/src/PathResolver/OperationPathResolverInterface.php
71 /vendor/api-platform/core/src/Symfony/Security/ResourceAccessCheckerInterface.php
72 /vendor/api-platform/core/src/Serializer/Filter/FilterInterface.php
73 /vendor/api-platform/core/src/Serializer/SerializerContextBuilderInterface.php
74 /vendor/api-platform/core/src/Validator/ValidatorInterface.php
75 /vendor/api-platform/core/src/Api/UrlGeneratorInterface.php
76 /vendor/api-platform/core/src/GraphQl/ExecutorInterface.php
77 /vendor/api-platform/core/src/GraphQl/Error/ErrorHandlerInterface.php
78 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/ValidateStageInterface.php
79 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/ReadStageInterface.php
80 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/SecurityPostDenormalizeStageInterface.php
81 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/SecurityStageInterface.php
82 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/WriteStageInterface.php
83 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/SerializeStageInterface.php
84 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/DeserializeStageInterface.php
85 /vendor/api-platform/core/src/GraphQl/Resolver/QueryItemResolverInterface.php
86 /vendor/api-platform/core/src/GraphQl/Resolver/QueryCollectionResolverInterface.php
87 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Factory/ResolverFactoryInterface.php
88 /vendor/api-platform/core/src/GraphQl/Resolver/MutationResolverInterface.php
89 /vendor/api-platform/core/src/Core/GraphQl/Subscription/MercureSubscriptionIriGeneratorInterface.php
90 /vendor/api-platform/core/src/Core/GraphQl/Subscription/SubscriptionIdentifierGeneratorInterface.php
91 /vendor/api-platform/core/src/Core/GraphQl/Subscription/SubscriptionManagerInterface.php
92 /vendor/api-platform/core/src/Core/GraphQl/Serializer/SerializerContextBuilderInterface.php
93 /vendor/api-platform/core/src/GraphQl/Type/TypesFactoryInterface.php
94 /vendor/api-platform/core/src/GraphQl/Type/Definition/TypeInterface.php
95 /vendor/api-platform/core/src/GraphQl/Type/TypesContainerInterface.php
96 /vendor/psr/container/src/ContainerInterface.php
97 /vendor/api-platform/core/src/Operation/PathSegmentNameGeneratorInterface.php
98 /vendor/ircmaxell/password-compat/lib/password.php
99 /vendor/martinlindhe/php-mb-helpers/src/mb_helpers.php
100 /vendor/prestashop/laminas-code-lts/polyfill/ReflectionEnumPolyfill.php
101 /src/Core/Version.php
102 /config/alias.php
103 /vendor/prestashop/autoload/src/PrestashopAutoload.php
104 /vendor/prestashop/autoload/src/LegacyClassLoader.php
105 /vendor/symfony/symfony/src/Symfony/Component/Filesystem/Filesystem.php
106 /vendor/prestashop/autoload/src/Autoloader.php
107 /config/bootstrap.php
108 /src/Core/ContainerBuilder.php
109 /src/Core/Foundation/IoC/Container.php
110 /src/Adapter/ServiceLocator.php
111 /var/cache/prod/appParameters.php
114 /var/cache/prod/class_index.php
115 /classes/controller/Controller.php
117 /classes/ObjectModel.php
118 /src/Core/Foundation/Database/EntityInterface.php
120 /classes/db/Db.php
122 /classes/Hook.php
124 /classes/module/Module.php
125 /src/Core/Module/Legacy/ModuleInterface.php
127 /classes/Tools.php
128 /classes/Context.php
129 /classes/shop/Shop.php
130 /src/Core/Security/PasswordGenerator.php
131 /classes/db/DbPDO.php
132 /classes/AddressFormat.php
133 /classes/Configuration.php
134 /classes/Validate.php
135 /classes/cache/Cache.php
136 /src/Adapter/EntityMapper.php
137 /classes/db/DbQuery.php
138 /src/Core/Addon/Theme/ThemeManagerBuilder.php
139 /vendor/psr/log/Psr/Log/NullLogger.php
140 /vendor/psr/log/Psr/Log/AbstractLogger.php
141 /vendor/psr/log/Psr/Log/LoggerInterface.php
142 /src/Adapter/Configuration.php
143 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/ParameterBag.php
144 /src/Core/Domain/Configuration/ShopConfigurationInterface.php
145 /src/Core/ConfigurationInterface.php
146 /src/Core/Addon/Theme/ThemeRepository.php
147 /src/Core/Addon/AddonRepositoryInterface.php
148 /src/Core/Domain/Shop/ValueObject/ShopConstraint.php
149 /src/Core/Addon/Theme/Theme.php
150 /src/Core/Addon/AddonInterface.php
151 /src/Core/Util/ArrayFinder.php
152 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyAccess.php
153 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyAccessorBuilder.php
154 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyAccessor.php
155 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyAccessorInterface.php
156 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyPath.php
157 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyPathInterface.php
158 /config/defines_uri.inc.php
159 /classes/Language.php
160 /src/Core/Language/LanguageInterface.php
161 /classes/Country.php
162 /classes/PrestaShopCollection.php
163 /classes/shop/ShopGroup.php
164 /classes/Cookie.php
165 /classes/PhpEncryption.php
166 /classes/PhpEncryptionEngine.php
167 /vendor/defuse/php-encryption/src/Key.php
168 /vendor/defuse/php-encryption/src/Encoding.php
169 /vendor/defuse/php-encryption/src/Core.php
170 /vendor/defuse/php-encryption/src/Crypto.php
171 /vendor/defuse/php-encryption/src/KeyOrPassword.php
172 /vendor/defuse/php-encryption/src/RuntimeTests.php
173 /vendor/defuse/php-encryption/src/DerivedKeys.php
174 /vendor/defuse/php-encryption/src/Exception/WrongKeyOrModifiedCiphertextException.php
175 /vendor/defuse/php-encryption/src/Exception/CryptoException.php
176 /src/Core/Session/SessionHandler.php
177 /src/Core/Session/SessionHandlerInterface.php
178 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Session.php
179 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Attribute/AttributeBag.php
180 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Attribute/AttributeBagInterface.php
181 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/SessionBagInterface.php
182 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Flash/FlashBag.php
183 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Flash/FlashBagInterface.php
184 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/SessionBagProxy.php
185 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/SessionInterface.php
186 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/PhpBridgeSessionStorage.php
187 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/NativeSessionStorage.php
188 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/MetadataBag.php
189 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/Handler/StrictSessionHandler.php
190 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/Handler/AbstractSessionHandler.php
191 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/Proxy/SessionHandlerProxy.php
192 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/Proxy/AbstractProxy.php
193 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/SessionStorageInterface.php
194 /config/smarty.config.inc.php
195 /vendor/smarty/smarty/libs/Smarty.class.php
196 /vendor/smarty/smarty/libs/functions.php
197 /vendor/smarty/smarty/libs/Autoloader.php
198 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_data.php
199 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_extension_handler.php
200 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php
201 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php
202 /vendor/smarty/smarty/libs/sysplugins/smarty_resource.php
203 /vendor/smarty/smarty/libs/sysplugins/smarty_variable.php
204 /vendor/smarty/smarty/libs/sysplugins/smarty_template_source.php
205 /vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php
206 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_resource_file.php
207 /config/smartyfront.config.inc.php
208 /classes/Smarty/SmartyResourceModule.php
209 /vendor/smarty/smarty/libs/sysplugins/smarty_resource_custom.php
210 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_method_registerresource.php
211 /classes/Smarty/SmartyResourceParent.php
212 /classes/Smarty/SmartyLazyRegister.php
213 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_method_registerplugin.php
214 /vendor/smarty/smarty/libs/plugins/modifier.truncate.php
215 /classes/Customer.php
216 /classes/Group.php
217 /classes/Link.php
218 /classes/shop/ShopUrl.php
219 /classes/Dispatcher.php
220 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Request.php
221 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/AcceptHeader.php
222 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/AcceptHeaderItem.php
223 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/FileBag.php
224 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/HeaderBag.php
225 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/HeaderUtils.php
226 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/ServerBag.php
227 /src/Adapter/SymfonyContainer.php
228 /vendor/mobiledetect/mobiledetectlib/Mobile_Detect.php
229 /config/db_slave_server.inc.php
230 /src/Adapter/ContainerBuilder.php
231 /src/Adapter/Environment.php
232 /src/Core/EnvironmentInterface.php
233 /vendor/symfony/symfony/src/Symfony/Component/Config/ConfigCache.php
234 /vendor/symfony/symfony/src/Symfony/Component/Config/ResourceCheckerConfigCache.php
235 /vendor/symfony/symfony/src/Symfony/Component/Config/ConfigCacheInterface.php
236 /vendor/symfony/symfony/src/Symfony/Component/Cache/DoctrineProvider.php
237 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/CacheProvider.php
238 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/Cache.php
239 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/FlushableCache.php
240 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/ClearableCache.php
241 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/MultiOperationCache.php
242 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/MultiGetCache.php
243 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/MultiDeleteCache.php
244 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/MultiPutCache.php
245 /vendor/symfony/symfony/src/Symfony/Component/Cache/PruneableInterface.php
246 /vendor/symfony/symfony/src/Symfony/Component/Cache/ResettableInterface.php
247 /vendor/symfony/contracts/Service/ResetInterface.php
248 /vendor/symfony/symfony/src/Symfony/Component/Cache/Adapter/ArrayAdapter.php
249 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/ArrayTrait.php
250 /vendor/psr/log/Psr/Log/LoggerAwareTrait.php
251 /vendor/symfony/symfony/src/Symfony/Component/Cache/Adapter/AdapterInterface.php
252 /vendor/symfony/symfony/src/Symfony/Component/Cache/CacheItem.php
253 /vendor/symfony/contracts/Cache/ItemInterface.php
254 /vendor/psr/cache/src/CacheItemInterface.php
255 /vendor/psr/cache/src/CacheItemPoolInterface.php
256 /vendor/symfony/contracts/Cache/CacheInterface.php
257 /vendor/psr/log/Psr/Log/LoggerAwareInterface.php
258 /vendor/doctrine/orm/lib/Doctrine/ORM/Tools/Setup.php
259 /vendor/doctrine/deprecations/lib/Doctrine/Deprecations/Deprecation.php
260 /vendor/doctrine/orm/lib/Doctrine/ORM/Configuration.php
261 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Configuration.php
262 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/Psr6/CacheAdapter.php
263 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/Psr6/DoctrineProvider.php
264 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/AnnotationReader.php
265 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/Reader.php
266 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/AnnotationRegistry.php
267 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Driver/DoctrineAnnotations.php
268 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Annotation.php
269 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Entity.php
270 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Embeddable.php
271 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Embedded.php
272 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/MappedSuperclass.php
273 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/InheritanceType.php
274 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/DiscriminatorColumn.php
275 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/DiscriminatorMap.php
276 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Id.php
277 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/GeneratedValue.php
278 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Version.php
279 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/JoinColumn.php
280 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/JoinColumns.php
281 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Column.php
282 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/OneToOne.php
283 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/OneToMany.php
284 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/ManyToOne.php
285 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/ManyToMany.php
286 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Table.php
287 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/UniqueConstraint.php
288 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Index.php
289 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/JoinTable.php
290 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/SequenceGenerator.php
291 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/CustomIdGenerator.php
292 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/ChangeTrackingPolicy.php
293 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/OrderBy.php
294 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/NamedQueries.php
295 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/NamedQuery.php
296 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/HasLifecycleCallbacks.php
297 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PrePersist.php
298 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PostPersist.php
299 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PreUpdate.php
300 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PostUpdate.php
301 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PreRemove.php
302 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PostRemove.php
303 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PostLoad.php
304 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PreFlush.php
305 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/FieldResult.php
306 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/ColumnResult.php
307 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/EntityResult.php
308 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/NamedNativeQuery.php
309 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/NamedNativeQueries.php
310 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/SqlResultSetMapping.php
311 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/SqlResultSetMappings.php
312 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/AssociationOverride.php
313 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/AssociationOverrides.php
314 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/AttributeOverride.php
315 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/AttributeOverrides.php
316 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/EntityListeners.php
317 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Cache.php
318 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/SimpleAnnotationReader.php
319 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/DocParser.php
320 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/DocLexer.php
321 /vendor/doctrine/lexer/lib/Doctrine/Common/Lexer/AbstractLexer.php
322 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/Annotation/Target.php
323 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Driver/AnnotationDriver.php
324 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Driver/CompatibilityAnnotationDriver.php
325 /vendor/doctrine/persistence/src/Persistence/Mapping/Driver/MappingDriver.php
326 /vendor/doctrine/persistence/src/Persistence/Mapping/Driver/ColocatedMappingDriver.php
327 /var/cache/prod/FrontContainer.php
328 /src/Adapter/Container/LegacyContainer.php
329 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/Container.php
330 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/Argument/RewindableGenerator.php
331 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/Argument/ServiceLocator.php
332 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/ServiceLocator.php
333 /vendor/symfony/contracts/Service/ServiceLocatorTrait.php
334 /vendor/psr/container/src/ContainerExceptionInterface.php
335 /vendor/psr/container/src/NotFoundExceptionInterface.php
336 /vendor/symfony/contracts/Service/ServiceProviderInterface.php
337 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/ResettableContainerInterface.php
338 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/ContainerInterface.php
339 /src/Adapter/Container/LegacyContainerInterface.php
340 /modules/blockwishlist/vendor/autoload.php
341 /modules/blockwishlist/vendor/composer/autoload_real.php
342 /modules/blockwishlist/vendor/composer/autoload_static.php
343 /modules/contactform/vendor/autoload.php
344 /modules/contactform/vendor/composer/autoload_real.php
345 /modules/contactform/vendor/composer/autoload_static.php
346 /modules/dashactivity/vendor/autoload.php
347 /modules/dashactivity/vendor/composer/autoload_real.php
348 /modules/dashactivity/vendor/composer/autoload_static.php
349 /modules/dashtrends/vendor/autoload.php
350 /modules/dashtrends/vendor/composer/autoload_real.php
351 /modules/dashtrends/vendor/composer/autoload_static.php
352 /modules/dashgoals/vendor/autoload.php
353 /modules/dashgoals/vendor/composer/autoload_real.php
354 /modules/dashgoals/vendor/composer/autoload_static.php
355 /modules/dashproducts/vendor/autoload.php
356 /modules/dashproducts/vendor/composer/autoload_real.php
357 /modules/dashproducts/vendor/composer/autoload_static.php
358 /modules/graphnvd3/vendor/autoload.php
359 /modules/graphnvd3/vendor/composer/autoload_real.php
360 /modules/graphnvd3/vendor/composer/autoload_static.php
361 /modules/gridhtml/vendor/autoload.php
362 /modules/gridhtml/vendor/composer/autoload_real.php
363 /modules/gridhtml/vendor/composer/autoload_static.php
364 /modules/gsitemap/vendor/autoload.php
365 /modules/gsitemap/vendor/composer/autoload_real.php
366 /modules/gsitemap/vendor/composer/autoload_static.php
367 /modules/pagesnotfound/vendor/autoload.php
368 /modules/pagesnotfound/vendor/composer/autoload_real.php
369 /modules/pagesnotfound/vendor/composer/autoload_static.php
370 /modules/productcomments/vendor/autoload.php
371 /modules/productcomments/vendor/composer/autoload_real.php
372 /modules/productcomments/vendor/composer/autoload_static.php
373 /modules/ps_categorytree/vendor/autoload.php
374 /modules/ps_categorytree/vendor/composer/autoload_real.php
375 /modules/ps_categorytree/vendor/composer/autoload_static.php
376 /modules/ps_checkpayment/vendor/autoload.php
377 /modules/ps_checkpayment/vendor/composer/autoload_real.php
378 /modules/ps_checkpayment/vendor/composer/autoload_static.php
379 /modules/ps_contactinfo/vendor/autoload.php
380 /modules/ps_contactinfo/vendor/composer/autoload_real.php
381 /modules/ps_contactinfo/vendor/composer/autoload_static.php
382 /modules/ps_crossselling/vendor/autoload.php
383 /modules/ps_crossselling/vendor/composer/autoload_real.php
384 /modules/ps_crossselling/vendor/composer/autoload_static.php
385 /modules/ps_currencyselector/vendor/autoload.php
386 /modules/ps_currencyselector/vendor/composer/autoload_real.php
387 /modules/ps_currencyselector/vendor/composer/autoload_static.php
388 /modules/ps_customeraccountlinks/vendor/autoload.php
389 /modules/ps_customeraccountlinks/vendor/composer/autoload_real.php
390 /modules/ps_customeraccountlinks/vendor/composer/autoload_static.php
391 /modules/ps_customtext/vendor/autoload.php
392 /modules/ps_customtext/vendor/composer/autoload_real.php
393 /modules/ps_customtext/vendor/composer/autoload_static.php
394 /modules/ps_dataprivacy/vendor/autoload.php
395 /modules/ps_dataprivacy/vendor/composer/autoload_real.php
396 /modules/ps_dataprivacy/vendor/composer/autoload_static.php
397 /modules/ps_emailsubscription/vendor/autoload.php
398 /modules/ps_emailsubscription/vendor/composer/autoload_real.php
399 /modules/ps_emailsubscription/vendor/composer/autoload_static.php
400 /modules/ps_faviconnotificationbo/vendor/autoload.php
401 /modules/ps_faviconnotificationbo/vendor/composer/autoload_real.php
402 /modules/ps_faviconnotificationbo/vendor/composer/autoload_static.php
403 /modules/ps_featuredproducts/vendor/autoload.php
404 /modules/ps_featuredproducts/vendor/composer/autoload_real.php
405 /modules/ps_featuredproducts/vendor/composer/autoload_static.php
406 /modules/ps_imageslider/vendor/autoload.php
407 /modules/ps_imageslider/vendor/composer/autoload_real.php
408 /modules/ps_imageslider/vendor/composer/autoload_static.php
409 /modules/ps_languageselector/vendor/autoload.php
410 /modules/ps_languageselector/vendor/composer/autoload_real.php
411 /modules/ps_languageselector/vendor/composer/autoload_static.php
412 /modules/ps_linklist/vendor/autoload.php
413 /modules/ps_linklist/vendor/composer/autoload_real.php
414 /modules/ps_linklist/vendor/composer/autoload_static.php
415 /modules/ps_mainmenu/vendor/autoload.php
416 /modules/ps_mainmenu/vendor/composer/autoload_real.php
417 /modules/ps_mainmenu/vendor/composer/autoload_static.php
418 /modules/ps_searchbar/vendor/autoload.php
419 /modules/ps_searchbar/vendor/composer/autoload_real.php
420 /modules/ps_searchbar/vendor/composer/platform_check.php
421 /modules/ps_searchbar/vendor/composer/autoload_static.php
422 /modules/ps_sharebuttons/vendor/autoload.php
423 /modules/ps_sharebuttons/vendor/composer/autoload_real.php
424 /modules/ps_sharebuttons/vendor/composer/platform_check.php
425 /modules/ps_sharebuttons/vendor/composer/autoload_static.php
426 /modules/ps_shoppingcart/vendor/autoload.php
427 /modules/ps_shoppingcart/vendor/composer/autoload_real.php
428 /modules/ps_shoppingcart/vendor/composer/autoload_static.php
429 /modules/ps_socialfollow/vendor/autoload.php
430 /modules/ps_socialfollow/vendor/composer/autoload_real.php
431 /modules/ps_socialfollow/vendor/composer/autoload_static.php
432 /modules/ps_themecusto/vendor/autoload.php
433 /modules/ps_themecusto/vendor/composer/autoload_real.php
434 /modules/ps_themecusto/vendor/composer/autoload_static.php
435 /modules/ps_wirepayment/vendor/autoload.php
436 /modules/ps_wirepayment/vendor/composer/autoload_real.php
437 /modules/ps_wirepayment/vendor/composer/autoload_static.php
438 /modules/statsbestcustomers/vendor/autoload.php
439 /modules/statsbestcustomers/vendor/composer/autoload_real.php
440 /modules/statsbestcustomers/vendor/composer/autoload_static.php
441 /modules/statsbestsuppliers/vendor/autoload.php
442 /modules/statsbestsuppliers/vendor/composer/autoload_real.php
443 /modules/statsbestsuppliers/vendor/composer/autoload_static.php
444 /modules/statscatalog/vendor/autoload.php
445 /modules/statscatalog/vendor/composer/autoload_real.php
446 /modules/statscatalog/vendor/composer/autoload_static.php
447 /modules/statscheckup/vendor/autoload.php
448 /modules/statscheckup/vendor/composer/autoload_real.php
449 /modules/statscheckup/vendor/composer/autoload_static.php
450 /modules/statsdata/vendor/autoload.php
451 /modules/statsdata/vendor/composer/autoload_real.php
452 /modules/statsdata/vendor/composer/autoload_static.php
453 /modules/statsproduct/vendor/autoload.php
454 /modules/statsproduct/vendor/composer/autoload_real.php
455 /modules/statsproduct/vendor/composer/autoload_static.php
456 /modules/statsstock/vendor/autoload.php
457 /modules/statsstock/vendor/composer/autoload_real.php
458 /modules/statsstock/vendor/composer/autoload_static.php
459 /modules/psgdpr/vendor/autoload.php
460 /modules/psgdpr/vendor/composer/autoload_real.php
461 /modules/psgdpr/vendor/composer/autoload_static.php
462 /modules/blockreassurance/vendor/autoload.php
463 /modules/blockreassurance/vendor/composer/autoload_real.php
464 /modules/blockreassurance/vendor/composer/autoload_static.php
465 /modules/ps_facetedsearch/vendor/autoload.php
466 /modules/ps_facetedsearch/vendor/composer/autoload_real.php
467 /modules/ps_facetedsearch/vendor/composer/autoload_static.php
468 /modules/nkmgls/vendor/autoload.php
469 /modules/nkmgls/vendor/composer/autoload_real.php
470 /modules/nkmgls/vendor/composer/platform_check.php
471 /modules/nkmgls/vendor/composer/autoload_static.php
472 /modules/nkmgls/vendor/nukium/gls-prestashop/lib/NkmHelper.php
473 /modules/paybox/vendor/autoload.php
474 /modules/paybox/vendor/composer/autoload_real.php
475 /modules/paybox/vendor/composer/platform_check.php
476 /modules/paybox/vendor/composer/autoload_static.php
477 /modules/paybox/vendor/clue/stream-filter/src/functions_include.php
478 /modules/paybox/vendor/clue/stream-filter/src/functions.php
479 /modules/paybox/vendor/php-http/message/src/filters.php
480 /modules/iqitsociallogin/vendor/autoload.php
481 /modules/iqitsociallogin/vendor/composer/autoload_real.php
482 /modules/iqitsociallogin/vendor/composer/platform_check.php
483 /modules/iqitsociallogin/vendor/composer/autoload_static.php
484 /modules/ps_eventbus/vendor/autoload.php
485 /modules/ps_eventbus/vendor/composer/autoload_real.php
486 /modules/ps_eventbus/vendor/composer/autoload_static.php
487 /modules/ps_accounts/vendor/autoload.php
488 /modules/ps_accounts/vendor/composer/autoload_real.php
489 /modules/ps_accounts/vendor/composer/platform_check.php
490 /modules/ps_accounts/vendor/composer/autoload_static.php
491 /modules/ps_accounts/vendor/paragonie/random_compat/lib/random.php
492 /modules/ps_accounts/vendor/symfony/polyfill-ctype/bootstrap.php
493 /modules/ps_accounts/vendor/lcobucci/jwt/compat/class-aliases.php
494 /modules/ps_accounts/vendor/lcobucci/jwt/src/Token.php
495 /modules/ps_accounts/vendor/lcobucci/jwt/src/Signature.php
496 /modules/ps_accounts/vendor/lcobucci/jwt/compat/json-exception-polyfill.php
497 /modules/ps_accounts/vendor/lcobucci/jwt/compat/lcobucci-clock-polyfill.php
498 /modules/ps_accounts/vendor/phpseclib/phpseclib/phpseclib/bootstrap.php
499 /modules/ps_accounts/vendor/ramsey/uuid/src/functions.php
500 /modules/ps_accounts/vendor/segmentio/analytics-php/lib/Segment.php
501 /modules/ps_accounts/vendor/segmentio/analytics-php/lib/Segment/Client.php
502 /modules/ps_accounts/vendor/segmentio/analytics-php/lib/Segment/Consumer.php
503 /modules/ps_accounts/vendor/segmentio/analytics-php/lib/Segment/QueueConsumer.php
504 /modules/ps_accounts/vendor/segmentio/analytics-php/lib/Segment/Consumer/File.php
505 /modules/ps_accounts/vendor/segmentio/analytics-php/lib/Segment/Consumer/ForkCurl.php
506 /modules/ps_accounts/vendor/segmentio/analytics-php/lib/Segment/Consumer/LibCurl.php
507 /modules/ps_accounts/vendor/segmentio/analytics-php/lib/Segment/Consumer/Socket.php
508 /modules/ps_accounts/vendor/segmentio/analytics-php/lib/Segment/Version.php
509 /modules/ps_emailalerts/vendor/autoload.php
510 /modules/ps_emailalerts/vendor/composer/autoload_real.php
511 /modules/ps_emailalerts/vendor/composer/autoload_static.php
512 /modules/ps_checkout/vendor/autoload.php
513 /modules/ps_checkout/vendor/composer/autoload_real.php
514 /modules/ps_checkout/vendor/composer/platform_check.php
515 /modules/ps_checkout/vendor/composer/autoload_static.php
516 /modules/ps_checkout/vendor/ramsey/uuid/src/functions.php
517 /modules/autoupgrade/vendor/autoload.php
518 /modules/autoupgrade/vendor/composer/autoload_real.php
519 /modules/autoupgrade/vendor/composer/autoload_static.php
520 /modules/sendinblue/vendor/autoload.php
521 /modules/sendinblue/vendor/composer/autoload_real.php
522 /modules/sendinblue/vendor/composer/platform_check.php
523 /modules/sendinblue/vendor/composer/autoload_static.php
524 /src/Core/Hook/HookModuleFilter.php
525 /src/Core/Hook/HookModuleFilterInterface.php
526 /modules/ps_checkout/ps_checkout.php
527 /classes/PaymentModule.php
528 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_method_createdata.php
529 /vendor/smarty/smarty/libs/sysplugins/smarty_data.php
530 /classes/Translate.php
531 /modules/ps_checkout/translations/fr.php
532 /src/PrestaShopBundle/Translation/TranslatorComponent.php
533 /vendor/symfony/symfony/src/Symfony/Component/Translation/Translator.php
534 /vendor/symfony/symfony/src/Symfony/Component/Translation/TranslatorInterface.php
535 /vendor/symfony/contracts/Translation/LocaleAwareInterface.php
536 /vendor/symfony/contracts/Translation/TranslatorInterface.php
537 /vendor/symfony/symfony/src/Symfony/Component/Translation/TranslatorBagInterface.php
538 /src/PrestaShopBundle/Translation/PrestaShopTranslatorTrait.php
539 /src/PrestaShopBundle/Translation/TranslatorLanguageTrait.php
540 /src/PrestaShopBundle/Translation/TranslatorInterface.php
541 /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/MessageFormatter.php
542 /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/IntlFormatter.php
543 /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/IntlFormatterInterface.php
544 /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/MessageFormatterInterface.php
545 /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/ChoiceMessageFormatterInterface.php
546 /vendor/symfony/symfony/src/Symfony/Component/Translation/IdentityTranslator.php
547 /vendor/symfony/contracts/Translation/TranslatorTrait.php
548 /vendor/symfony/symfony/src/Symfony/Component/Config/ConfigCacheFactory.php
549 /vendor/symfony/symfony/src/Symfony/Component/Config/ConfigCacheFactoryInterface.php
550 /var/cache/prod/translations/catalogue.fr-FR.NXhscRe.php
551 /vendor/symfony/symfony/src/Symfony/Component/Translation/MessageCatalogue.php
552 /vendor/symfony/symfony/src/Symfony/Component/Translation/MessageCatalogueInterface.php
553 /vendor/symfony/symfony/src/Symfony/Component/Translation/MetadataAwareInterface.php
554 /controllers/front/listing/CategoryController.php
555 /classes/controller/ProductListingFrontController.php
556 /classes/controller/ProductPresentingFrontController.php
557 /classes/controller/FrontController.php
558 /src/Adapter/Presenter/Object/ObjectPresenter.php
559 /src/Adapter/Presenter/PresenterInterface.php
560 /src/Adapter/Presenter/Cart/CartPresenter.php
561 /src/Adapter/Image/ImageRetriever.php
562 /classes/tax/TaxConfiguration.php
563 /classes/Smarty/TemplateFinder.php
564 /classes/assets/StylesheetManager.php
565 /classes/assets/AbstractAssetManager.php
566 /src/Adapter/Assets/AssetUrlGeneratorTrait.php
567 /classes/assets/JavascriptManager.php
568 /classes/assets/CccReducer.php
569 /modules/iqitthemeeditor/iqitthemeeditor.php
570 /modules/iqitthemeeditor/src/IqitSmartyModifiers.php
571 /modules/iqitthemeeditor/translations/fr.php
572 /classes/Category.php
573 /classes/webservice/WebserviceRequest.php
574 /src/Core/Localization/Locale/Repository.php
575 /src/Core/Localization/Locale/RepositoryInterface.php
576 /src/Core/Localization/CLDR/LocaleRepository.php
577 /src/Core/Localization/CLDR/LocaleDataSource.php
578 /src/Core/Localization/CLDR/DataLayer/LocaleCache.php
579 /src/Core/Data/Layer/AbstractDataLayer.php
580 /src/Core/Localization/CLDR/LocaleDataLayerInterface.php
581 /vendor/symfony/symfony/src/Symfony/Component/Cache/Adapter/FilesystemAdapter.php
582 /vendor/symfony/symfony/src/Symfony/Component/Cache/Adapter/AbstractAdapter.php
583 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/AbstractAdapterTrait.php
584 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/AbstractTrait.php
585 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/ContractsTrait.php
586 /vendor/symfony/contracts/Cache/CacheTrait.php
587 /vendor/psr/cache/src/InvalidArgumentException.php
588 /vendor/psr/cache/src/CacheException.php
589 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/FilesystemTrait.php
590 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/FilesystemCommonTrait.php
591 /vendor/symfony/symfony/src/Symfony/Component/Cache/Marshaller/DefaultMarshaller.php
592 /vendor/symfony/symfony/src/Symfony/Component/Cache/Marshaller/MarshallerInterface.php
593 /src/Core/Localization/CLDR/DataLayer/LocaleReference.php
594 /src/Core/Localization/CLDR/Reader.php
595 /src/Core/Localization/CLDR/ReaderInterface.php
596 /src/Core/Localization/Currency/Repository.php
597 /src/Core/Localization/Currency/RepositoryInterface.php
598 /src/Core/Localization/Currency/CurrencyDataSource.php
599 /src/Core/Localization/Currency/DataSourceInterface.php
600 /src/Core/Localization/Currency/DataLayer/CurrencyCache.php
601 /src/Core/Localization/Currency/CurrencyDataLayerInterface.php
602 /src/Core/Localization/Currency/DataLayer/CurrencyDatabase.php
603 /src/Adapter/Currency/CurrencyDataProvider.php
604 /src/Core/Currency/CurrencyDataProviderInterface.php
605 /src/Adapter/LegacyContext.php
606 /src/Adapter/Tools.php
607 /src/Core/Localization/Currency/DataLayer/CurrencyReference.php
608 /src/Core/Localization/Currency/DataLayer/CurrencyInstalled.php
609 /vendor/prestashop/decimal/src/Operation/Rounding.php
610 /src/Core/Localization/Locale.php
611 /src/Core/Localization/LocaleInterface.php
612 /src/Core/Localization/Specification/Price.php
613 /src/Core/Localization/Specification/Number.php
614 /src/Core/Localization/Specification/NumberInterface.php
615 /src/Core/Localization/Specification/Factory.php
616 /src/Core/Localization/CLDR/LocaleData.php
617 /src/Core/Localization/CLDR/NumberSymbolsData.php
618 /src/Core/Localization/CLDR/CurrencyData.php
619 /src/Core/Localization/CLDR/Locale.php
620 /src/Core/Localization/CLDR/LocaleInterface.php
621 /src/Core/Localization/Specification/NumberSymbolList.php
622 /classes/Currency.php
623 /src/Core/Localization/Currency/LocalizedCurrencyId.php
624 /src/Core/Localization/Currency/CurrencyData.php
625 /src/Core/Localization/Currency/CurrencyCollection.php
626 /src/Core/Localization/Currency.php
627 /src/Core/Localization/CurrencyInterface.php
628 /src/Core/Localization/Specification/NumberCollection.php
629 /src/Core/Localization/Number/Formatter.php
630 /classes/Cart.php
631 /src/Adapter/AddressFactory.php
632 /classes/CartRule.php
633 /classes/Product.php
634 /src/Core/Domain/Product/ValueObject/RedirectType.php
635 /src/Core/Util/DateTime/DateTime.php
636 /src/Core/Domain/Product/Stock/ValueObject/OutOfStockType.php
637 /src/Core/Domain/Product/Pack/ValueObject/PackStockType.php
638 /src/Core/Domain/Product/ValueObject/ProductType.php
639 /src/Core/Domain/Product/ValueObject/Reference.php
640 /src/Core/Domain/Product/ValueObject/Ean13.php
641 /src/Core/Domain/Product/ValueObject/Isbn.php
642 /src/Core/Domain/Product/ValueObject/Upc.php
643 /src/Core/Domain/Product/ProductSettings.php
644 /src/Core/Image/ImageFormatConfiguration.php
645 /src/Core/Image/ImageFormatConfigurationInterface.php
646 /classes/FeatureFlag.php
647 /src/Core/FeatureFlag/FeatureFlagSettings.php
648 /classes/ImageType.php
649 /src/Core/Domain/Shop/ValueObject/ShopId.php
650 /src/Core/Domain/Shop/ValueObject/ShopIdInterface.php
651 /modules/ps_emailsubscription/ps_emailsubscription.php
652 /src/Core/Module/WidgetInterface.php
653 /src/PrestaShopBundle/Translation/DomainNormalizer.php
654 /classes/Media.php
655 /modules/blockreassurance/blockreassurance.php
656 /modules/nkmgls/nkmgls.php
657 /modules/nkmgls/controllers/admin/AdminGlsOrderController.php
658 /classes/controller/ModuleAdminController.php
659 /classes/controller/AdminController.php
660 /modules/nkmgls/controllers/admin/AdminGlsAjaxController.php
661 /modules/nkmgls/controllers/admin/AdminGlsLabelController.php
662 /modules/nkmgls/controllers/admin/AdminGlsPackingListController.php
663 /classes/module/CarrierModule.php
664 /modules/nkmgls/translations/fr.php
665 /modules/nkmgls/vendor/nukium/gls-prestashop/src/Service/Init/PrestashopGlsInit.php
666 /modules/nkmgls/vendor/nukium/gls-common/src/Service/Init/GlsInit.php
667 /modules/nkmgls/vendor/nukium/gls-common/src/Util/ServiceInstantiationTrait.php
668 /modules/nkmgls/vendor/nukium/gls-common/src/Service/Container.php
669 /modules/nkmgls/vendor/nukium/gls-common/src/Service/ContainerInterface.php
670 /modules/nkmgls/vendor/nukium/gls-common/src/Service/Init/ShipItAdapterResolutionInit.php
671 /modules/nkmgls/vendor/nukium/gls-prestashop/src/Service/Init/PrestashopAdapterInit.php
672 /modules/nkmgls/vendor/nukium/gls-common/src/Service/Init/AdapterInitInterface.php
673 /modules/nkmgls/vendor/nukium/gls-common/src/Service/Repository/Cache/CacheRepositoryFactory.php
674 /modules/nkmgls/vendor/nukium/gls-prestashop/src/Service/Repository/Cache/PrestashopCacheRepository.php
675 /modules/nkmgls/vendor/nukium/gls-prestashop/src/Service/Repository/AbstractRepository.php
676 /modules/nkmgls/vendor/nukium/gls-common/src/Service/Repository/Cache/CacheRepositoryInterface.php
677 /modules/nkmgls/vendor/nukium/gls-prestashop/classes/GlsCacheClass.php
678 /modules/nkmgls/vendor/nukium/gls-common/src/Entity/CacheInterface.php
679 /modules/nkmgls/vendor/nukium/gls-common/src/Service/Handler/DTO/Adapter/Address/AddressHandlerFactory.php
680 /modules/nkmgls/vendor/nukium/gls-prestashop/src/Service/Handler/DTO/Adapter/Address/PrestashopAddressHandler.php
681 /modules/nkmgls/vendor/nukium/gls-common/src/Service/Handler/DTO/Adapter/Address/AddressHandler.php
682 /modules/nkmgls/vendor/nukium/gls-common/src/Service/Handler/DTO/Adapter/Carrier/CarrierHandlerFactory.php
683 /modules/nkmgls/vendor/nukium/gls-prestashop/src/Service/Handler/DTO/Adapter/Carrier/PrestashopCarrierHandler.php
684 /modules/nkmgls/vendor/nukium/gls-common/src/Service/Handler/DTO/Adapter/Carrier/CarrierHandler.php
685 /modules/nkmgls/vendor/nukium/gls-prestashop/src/Service/Helper/ModuleHelper.php
686 /modules/nkmgls/vendor/nukium/gls-prestashop/src/Service/Adapter/Config/PrestashopConfig.php
687 /modules/nkmgls/vendor/nukium/gls-common/src/Service/Adapter/Config/ConfigInterface.php
688 /modules/nkmgls/vendor/nukium/gls-prestashop/src/Service/Repository/Carrier/PrestashopCarrierRepository.php
689 /classes/Carrier.php
690 /modules/nkmgls/vendor/nukium/gls-common/src/Service/Handler/Entity/Cache/CacheHandlerFactory.php
691 /modules/nkmgls/vendor/nukium/gls-prestashop/src/Service/Handler/Entity/Cache/PrestashopCacheHandler.php
692 /modules/nkmgls/vendor/nukium/gls-common/src/Service/Handler/Entity/Cache/CacheHandler.php
693 /modules/nkmgls/vendor/nukium/gls-common/src/Service/Adapter/Config/ConfigFactory.php
694 /modules/nkmgls/vendor/nukium/gls-common/src/Service/Adapter/EntityManager/EntityManagerFactory.php
695 /modules/nkmgls/vendor/nukium/gls-prestashop/src/Service/Adapter/EntityManager/PrestashopEntityManager.php
696 /modules/nkmgls/vendor/nukium/gls-common/src/Service/Adapter/EntityManager/EntityManagerInterface.php
697 /modules/nkmgls/vendor/nukium/gls-common/src/Service/Adapter/Shop/ShopFactory.php
698 /modules/nkmgls/vendor/nukium/gls-prestashop/src/Service/Adapter/Shop/PrestashopShop.php
699 /modules/nkmgls/vendor/nukium/gls-common/src/Service/Adapter/Shop/ShopInterface.php
700 /modules/nkmgls/vendor/nukium/gls-common/src/Service/Adapter/Translator/TranslatorFactory.php
701 /modules/nkmgls/vendor/nukium/gls-prestashop/src/Service/Adapter/Translator/PrestashopTranslator.php
702 /modules/nkmgls/vendor/nukium/gls-common/src/Service/Adapter/Translator/TranslatorInterface.php
703 /modules/nkmgls/vendor/nukium/gls-common/src/Service/Adapter/Utility/UtilityFactory.php
704 /modules/nkmgls/vendor/nukium/gls-prestashop/src/Service/Adapter/Utility/PrestashopUtility.php
705 /modules/nkmgls/vendor/nukium/gls-common/src/Service/Adapter/Utility/Component/DefaultUtility.php
706 /modules/nkmgls/vendor/nukium/gls-prestashop/src/Service/Patch/PatchSystem.php
707 /modules/nkmgls/vendor/nukium/gls-common/src/Service/Adapter/Logger/Component/DefaultLogger.php
708 /modules/nkmgls/vendor/nukium/gls-prestashop/src/Service/Patch/Component/AddOriginalAddressPatch.php
709 /modules/nkmgls/vendor/nukium/gls-prestashop/src/Service/Patch/PatchComponentInterface.php
710 /modules/nkmgls/vendor/nukium/gls-common/src/Service/ShipIt/ShipItAdapterResolution.php
711 /modules/nkmgls/vendor/nukium/gls-common/src/Service/ShipIt/Adapter/NoShipItAdapter.php
712 /modules/nkmgls/vendor/nukium/gls-common/src/Service/ShipIt/ShipItAdapterInterface.php
713 /modules/nkmgls/vendor/nukium/gls-common/src/Service/ShipIt/Adapter/LabelAdapter.php
714 /modules/nkmgls/vendor/nukium/gls-common/src/Service/ShipIt/Adapter/AbstractAdapter.php
715 /modules/nkmgls/vendor/nukium/gls-common/src/Service/ShipIt/Adapter/Component/AuthErrorComponent.php
716 /modules/nkmgls/vendor/nukium/gls-common/src/Service/ShipIt/ShipItComponentInterface.php
717 /modules/nkmgls/vendor/nukium/gls-common/src/Service/ShipIt/Adapter/Component/DefaultErrorComponent.php
718 /modules/nkmgls/vendor/nukium/gls-common/src/Service/Adapter/Logger/LoggerFactory.php
719 /modules/nkmgls/vendor/nukium/gls-common/src/Service/ShipIt/Adapter/Component/LabelInternationalComponent.php
720 /modules/nkmgls/vendor/nukium/gls-common/src/Service/ShipIt/Routine/ShipItErrorRoutine.php
721 /modules/nkmgls/vendor/nukium/gls-common/src/Service/API/ShipmentApi.php
722 /modules/nkmgls/vendor/nukium/gls-common/src/Service/HttpClient/LegacyClient.php
723 /modules/nkmgls/vendor/nukium/gls-common/src/Service/Handler/Legacy/GlsApiHandler.php
724 /modules/nkmgls/vendor/nukium/gls-common/src/Service/HttpClient/GlsCurlClient.php
725 /modules/nkmgls/vendor/nukium/gls-common/src/Service/Helper/GlsHelper.php
726 /modules/nkmgls/vendor/nukium/gls-common/src/Service/ShipIt/Adapter/Component/LabelErrorComponent.php
727 /modules/nkmgls/vendor/nukium/gls-common/src/Service/ShipIt/Adapter/Component/LabelComponent.php
728 /modules/nkmgls/vendor/nukium/gls-common/src/Service/ShipIt/Adapter/RelayAdapter.php
729 /modules/nkmgls/vendor/nukium/gls-common/src/Service/ShipIt/Adapter/Component/RelayComponent.php
730 /modules/nkmgls/vendor/nukium/gls-common/src/Service/ShipIt/Adapter/TrackingAdapter.php
731 /modules/nkmgls/vendor/nukium/gls-common/src/Service/ShipIt/Adapter/Component/TrackingComponent.php
732 /modules/nkmgls/vendor/nukium/gls-common/src/Service/API/TrackingApi.php
733 /modules/nkmgls/vendor/nukium/gls-prestashop/src/Service/Handler/Carrier/GlsExpressHandler.php
734 /modules/nkmgls/vendor/nukium/gls-prestashop/src/Service/Helper/FtpHelper.php
735 /modules/nkmgls/vendor/nukium/gls-prestashop/src/Service/Helper/EnvHelper.php
736 /modules/nkmgls/vendor/nukium/gls-common/src/Service/Routine/AllowedServicesRoutine.php
737 /modules/nkmgls/vendor/nukium/gls-common/src/Service/DataLoader/AllowedServicesLoader.php
738 /modules/nkmgls/vendor/nukium/gls-common/src/Service/Handler/DTO/GLS/AllowedServicesHandler.php
739 /modules/nkmgls/vendor/nukium/gls-common/src/Service/API/AllowedServicesApi.php
740 /modules/nkmgls/vendor/nukium/gls-common/src/Service/Routine/CacheRoutine.php
741 /modules/nkmgls/vendor/nukium/gls-common/src/Service/DataLoader/CacheLoader.php
742 /modules/paybox/paybox.php
743 /modules/paybox/src/Configuration/Settings.php
744 /modules/paybox/vendor/netresearch/jsonmapper/src/JsonMapper.php
745 /modules/paybox/src/Configuration/Account.php
746 /modules/paybox/src/Configuration/DemoAccount.php
747 /modules/paybox/src/Configuration/PaymentConfiguration.php
748 /modules/paybox/src/Configuration/SubscriptionConfiguration.php
749 /modules/paybox/src/Configuration/InstalmentConfiguration.php
750 /modules/paybox/src/Configuration/Instalment.php
751 /modules/paybox/src/Configuration/Contract.php
752 /modules/paybox/src/Utils/Tools.php
753 /vendor/monolog/monolog/src/Monolog/Logger.php
754 /vendor/monolog/monolog/src/Monolog/ResettableInterface.php
755 /vendor/monolog/monolog/src/Monolog/Handler/RotatingFileHandler.php
756 /vendor/monolog/monolog/src/Monolog/Handler/StreamHandler.php
757 /vendor/monolog/monolog/src/Monolog/Handler/AbstractProcessingHandler.php
758 /vendor/monolog/monolog/src/Monolog/Handler/AbstractHandler.php
759 /vendor/monolog/monolog/src/Monolog/Handler/HandlerInterface.php
760 /vendor/monolog/monolog/src/Monolog/Utils.php
761 /modules/paybox/translations/fr.php
762 /modules/ps_emailalerts/ps_emailalerts.php
763 /modules/ps_emailalerts/MailAlert.php
764 /modules/ps_checkout/vendor/prestashop/module-lib-service-container/src/DependencyInjection/ServiceContainer.php
765 /modules/ps_checkout/vendor/prestashop/module-lib-cache-directory-provider/src/Cache/CacheDirectoryProvider.php
766 /modules/ps_checkout/vendor/prestashop/module-lib-service-container/src/DependencyInjection/ContainerProvider.php
767 /var/cache/prod/Ps_checkout8440FrontContainer.php
768 /modules/ps_checkout/src/Validator/FrontControllerValidator.php
769 /modules/ps_checkout/src/Validator/MerchantValidator.php
770 /modules/ps_checkout/src/PayPal/PayPalConfiguration.php
771 /modules/ps_checkout/src/Configuration/PrestaShopConfiguration.php
772 /modules/ps_checkout/src/Configuration/PrestaShopConfigurationOptionsResolver.php
773 /modules/ps_checkout/src/Shop/ShopProvider.php
774 /vendor/symfony/symfony/src/Symfony/Component/OptionsResolver/OptionsResolver.php
775 /vendor/symfony/symfony/src/Symfony/Component/OptionsResolver/Options.php
776 /modules/ps_checkout/src/Repository/PayPalCodeRepository.php
777 /modules/ps_checkout/src/Repository/PsAccountRepository.php
778 /modules/ps_checkout/vendor/prestashop/prestashop-accounts-installer/src/Installer/Facade/PsAccounts.php
779 /modules/ps_checkout/vendor/prestashop/prestashop-accounts-installer/src/Installer/Installer.php
780 /src/Core/Addon/Module/ModuleManagerBuilder.php
781 /src/Core/Util/File/YamlParser.php
782 /vendor/symfony/symfony/src/Symfony/Component/Config/Resource/SelfCheckingResourceChecker.php
783 /vendor/symfony/symfony/src/Symfony/Component/Config/ResourceCheckerInterface.php
784 /vendor/symfony/symfony/src/Symfony/Component/Config/Resource/FileResource.php
785 /vendor/symfony/symfony/src/Symfony/Component/Config/Resource/SelfCheckingResourceInterface.php
786 /vendor/symfony/symfony/src/Symfony/Component/Config/Resource/ResourceInterface.php
787 /var/cache/prod/yaml/4b591b7a28d98961575010499c0558f3.php
788 /src/Adapter/LegacyLogger.php
789 /src/PrestaShopBundle/Service/DataProvider/Admin/CategoriesProvider.php
790 /src/Adapter/Module/ModuleDataProvider.php
791 /src/Adapter/Module/AdminModuleDataProvider.php
792 /src/PrestaShopBundle/Service/DataProvider/Admin/ModuleInterface.php
793 /src/Adapter/Module/Module.php
794 /src/Core/Module/ModuleInterface.php
795 /vendor/symfony/symfony/src/Symfony/Component/Config/FileLocator.php
796 /vendor/symfony/symfony/src/Symfony/Component/Config/FileLocatorInterface.php
797 /vendor/symfony/symfony/src/Symfony/Component/Routing/Loader/YamlFileLoader.php
798 /vendor/symfony/symfony/src/Symfony/Component/Config/Loader/FileLoader.php
799 /vendor/symfony/symfony/src/Symfony/Component/Config/Loader/Loader.php
800 /vendor/symfony/symfony/src/Symfony/Component/Config/Loader/LoaderInterface.php
801 /vendor/symfony/symfony/src/Symfony/Component/Routing/Router.php
802 /vendor/symfony/symfony/src/Symfony/Component/Routing/RouterInterface.php
803 /vendor/symfony/symfony/src/Symfony/Component/Routing/Matcher/UrlMatcherInterface.php
804 /vendor/symfony/symfony/src/Symfony/Component/Routing/RequestContextAwareInterface.php
805 /vendor/symfony/symfony/src/Symfony/Component/Routing/Generator/UrlGeneratorInterface.php
806 /vendor/symfony/symfony/src/Symfony/Component/Routing/Matcher/RequestMatcherInterface.php
807 /vendor/symfony/symfony/src/Symfony/Component/Routing/RequestContext.php
808 /src/Adapter/Module/ModuleDataUpdater.php
809 /src/Core/Module/ModuleManager.php
810 /src/Core/Module/ModuleManagerInterface.php
811 /src/Core/Module/ModuleRepository.php
812 /src/Core/Module/ModuleRepositoryInterface.php
813 /src/Adapter/HookManager.php
814 /src/Core/Module/SourceHandler/SourceHandlerFactory.php
815 /src/PrestaShopBundle/Event/Dispatcher/NullDispatcher.php
816 /vendor/symfony/symfony/src/Symfony/Component/EventDispatcher/EventDispatcherInterface.php
817 /vendor/symfony/contracts/EventDispatcher/EventDispatcherInterface.php
818 /src/Core/Hook/HookDispatcherInterface.php
819 /modules/ps_accounts/ps_accounts.php
820 /modules/ps_accounts/src/Hook/HookableTrait.php
821 /modules/ps_accounts/src/Module/Install.php
822 /modules/ps_accounts/translations/fr.php
823 /modules/ps_accounts/src/ServiceContainer/PsAccountsContainer.php
824 /modules/ps_accounts/vendor/prestashopcorp/lightweight-container/src/ServiceContainer/ServiceContainer.php
825 /modules/ps_accounts/config.php
826 /modules/ps_accounts/src/Log/Logger.php
827 /modules/ps_accounts/vendor/monolog/monolog/src/Monolog/Logger.php
828 /modules/ps_accounts/vendor/psr/log/Psr/Log/LoggerInterface.php
829 /modules/ps_accounts/vendor/monolog/monolog/src/Monolog/ResettableInterface.php
830 /modules/ps_accounts/vendor/monolog/monolog/src/Monolog/Handler/RotatingFileHandler.php
831 /modules/ps_accounts/vendor/monolog/monolog/src/Monolog/Handler/StreamHandler.php
832 /modules/ps_accounts/vendor/monolog/monolog/src/Monolog/Handler/AbstractProcessingHandler.php
833 /modules/ps_accounts/vendor/monolog/monolog/src/Monolog/Handler/AbstractHandler.php
834 /modules/ps_accounts/vendor/monolog/monolog/src/Monolog/Handler/HandlerInterface.php
835 /modules/ps_accounts/vendor/monolog/monolog/src/Monolog/Utils.php
836 /modules/ps_accounts/src/ServiceProvider/ApiClientProvider.php
837 /modules/ps_accounts/vendor/prestashopcorp/lightweight-container/src/ServiceContainer/Contract/IServiceProvider.php
838 /modules/ps_accounts/src/ServiceProvider/CommandProvider.php
839 /modules/ps_accounts/src/ServiceProvider/DefaultProvider.php
840 /modules/ps_accounts/src/ServiceProvider/OAuth2Provider.php
841 /modules/ps_accounts/src/ServiceProvider/RepositoryProvider.php
842 /modules/ps_accounts/src/ServiceProvider/SessionProvider.php
843 /modules/ps_accounts/src/Service/PsAccountsService.php
844 /modules/ps_accounts/src/Account/Session/ShopSession.php
845 /modules/ps_accounts/src/Account/Session/Session.php
846 /modules/ps_accounts/src/Account/Session/SessionInterface.php
847 /modules/ps_accounts/src/Repository/ConfigurationRepository.php
848 /modules/ps_accounts/src/Adapter/Configuration.php
849 /modules/ps_accounts/src/Service/OAuth2/OAuth2Service.php
850 /modules/ps_accounts/src/Http/Client/ClientConfig.php
851 /modules/ps_accounts/src/Http/Client/ConfigObject.php
852 /modules/ps_accounts/src/Type/Enum.php
853 /modules/ps_accounts/src/Service/OAuth2/OAuth2Client.php
854 /modules/ps_accounts/src/Adapter/Link.php
855 /modules/ps_accounts/src/Context/ShopContext.php
856 /modules/ps_accounts/vendor/ramsey/uuid/src/Uuid.php
857 /modules/ps_accounts/vendor/ramsey/uuid/src/UuidInterface.php
858 /modules/ps_accounts/vendor/ramsey/uuid/src/UuidFactory.php
859 /modules/ps_accounts/vendor/ramsey/uuid/src/UuidFactoryInterface.php
860 /modules/ps_accounts/vendor/ramsey/uuid/src/FeatureSet.php
861 /modules/ps_accounts/vendor/ramsey/uuid/src/Converter/Number/DegradedNumberConverter.php
862 /modules/ps_accounts/vendor/ramsey/uuid/src/Converter/NumberConverterInterface.php
863 /modules/ps_accounts/vendor/ramsey/uuid/src/Builder/DefaultUuidBuilder.php
864 /modules/ps_accounts/vendor/ramsey/uuid/src/Builder/UuidBuilderInterface.php
865 /modules/ps_accounts/vendor/ramsey/uuid/src/Codec/StringCodec.php
866 /modules/ps_accounts/vendor/ramsey/uuid/src/Codec/CodecInterface.php
867 /modules/ps_accounts/vendor/ramsey/uuid/src/Provider/Node/FallbackNodeProvider.php
868 /modules/ps_accounts/vendor/ramsey/uuid/src/Provider/NodeProviderInterface.php
869 /modules/ps_accounts/vendor/ramsey/uuid/src/Provider/Node/SystemNodeProvider.php
870 /modules/ps_accounts/vendor/ramsey/uuid/src/Provider/Node/RandomNodeProvider.php
871 /modules/ps_accounts/vendor/ramsey/uuid/src/Generator/RandomGeneratorFactory.php
872 /modules/ps_accounts/vendor/ramsey/uuid/src/Generator/RandomBytesGenerator.php
873 /modules/ps_accounts/vendor/ramsey/uuid/src/Generator/RandomGeneratorInterface.php
874 /modules/ps_accounts/vendor/ramsey/uuid/src/Provider/Time/SystemTimeProvider.php
875 /modules/ps_accounts/vendor/ramsey/uuid/src/Provider/TimeProviderInterface.php
876 /modules/ps_accounts/vendor/ramsey/uuid/src/Generator/TimeGeneratorFactory.php
877 /modules/ps_accounts/vendor/ramsey/uuid/src/Converter/Time/PhpTimeConverter.php
878 /modules/ps_accounts/vendor/ramsey/uuid/src/Converter/TimeConverterInterface.php
879 /modules/ps_accounts/vendor/ramsey/uuid/src/Generator/DefaultTimeGenerator.php
880 /modules/ps_accounts/vendor/ramsey/uuid/src/Generator/TimeGeneratorInterface.php
881 /modules/ps_accounts/vendor/ramsey/uuid/src/BinaryUtils.php
882 /modules/ps_accounts/src/Service/OAuth2/CachedFile.php
883 /modules/ps_accounts/src/Account/LinkShop.php
884 /modules/ps_accounts/src/Cqrs/CommandBus.php
885 /modules/ps_accounts/src/Cqrs/Bus.php
886 /modules/ps_accounts/src/Account/Session/Firebase/ShopSession.php
887 /modules/ps_accounts/src/Account/Session/Firebase/FirebaseSession.php
888 /modules/ps_accounts/src/Account/Session/Firebase/OwnerSession.php
889 /modules/ps_checkout/src/Context/PrestaShopContext.php
890 /modules/ps_checkout/src/ExpressCheckout/ExpressCheckoutConfiguration.php
891 /modules/ps_checkout/src/PayPal/PayPalPayLaterConfiguration.php
892 /modules/ps_checkout/src/Version/Version.php
893 /modules/ps_accounts/src/Adapter/ConfigurationKeys.php
894 /src/Adapter/Presenter/Cart/CartLazyArray.php
895 /src/Adapter/Presenter/AbstractLazyArray.php
896 /src/Adapter/Product/PriceFormatter.php
897 /src/Core/Util/Inflector.php
898 /vendor/doctrine/inflector/lib/Doctrine/Inflector/InflectorFactory.php
899 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Language.php
900 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/English/InflectorFactory.php
901 /vendor/doctrine/inflector/lib/Doctrine/Inflector/GenericLanguageInflectorFactory.php
902 /vendor/doctrine/inflector/lib/Doctrine/Inflector/LanguageInflectorFactory.php
903 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/English/Rules.php
904 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Ruleset.php
905 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Transformations.php
906 /vendor/doctrine/inflector/lib/Doctrine/Inflector/WordInflector.php
907 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/English/Inflectible.php
908 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Transformation.php
909 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Pattern.php
910 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Patterns.php
911 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/English/Uninflected.php
912 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Substitutions.php
913 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Substitution.php
914 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Word.php
915 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Inflector.php
916 /vendor/doctrine/inflector/lib/Doctrine/Inflector/CachedWordInflector.php
917 /vendor/doctrine/inflector/lib/Doctrine/Inflector/RulesetInflector.php
918 /classes/Gender.php
919 /classes/Risk.php
920 /classes/Meta.php
921 /modules/revsliderprestashop/revsliderprestashop.php
922 /modules/revsliderprestashop/rev-loader.php
923 /modules/revsliderprestashop/includes/revslider_db.class.php
924 /modules/revsliderprestashop/includes/data.class.php
925 /modules/revsliderprestashop/includes/functions.class.php
926 /modules/revsliderprestashop/includes/em-integration.class.php
927 /modules/revsliderprestashop/includes/cssparser.class.php
928 /modules/revsliderprestashop/includes/woocommerce.class.php
929 /modules/revsliderprestashop/includes/wpml.class.php
930 /modules/revsliderprestashop/includes/colorpicker.class.php
931 /modules/revsliderprestashop/includes/navigation.class.php
932 /modules/revsliderprestashop/includes/object-library.class.php
933 /modules/revsliderprestashop/admin/includes/loadbalancer.class.php
934 /modules/revsliderprestashop/admin/includes/plugin-update.class.php
935 /modules/revsliderprestashop/includes/extension.class.php
936 /modules/revsliderprestashop/includes/favorite.class.php
937 /modules/revsliderprestashop/includes/aq-resizer.class.php
938 /modules/revsliderprestashop/includes/external-sources.class.php
939 /modules/revsliderprestashop/includes/page-template.class.php
940 /modules/revsliderprestashop/includes/slider.class.php
941 /modules/revsliderprestashop/includes/slide.class.php
942 /modules/revsliderprestashop/includes/output.class.php
943 /modules/revsliderprestashop/public/revslider-front.class.php
944 /modules/revsliderprestashop/includes/backwards.php
945 /modules/revsliderprestashop/admin/includes/class-pclzip.php
946 /modules/revsliderprestashop/admin/includes/license.class.php
947 /modules/revsliderprestashop/admin/includes/addons.class.php
948 /modules/revsliderprestashop/admin/includes/template.class.php
949 /modules/revsliderprestashop/admin/includes/functions-admin.class.php
950 /modules/revsliderprestashop/admin/includes/folder.class.php
951 /modules/revsliderprestashop/admin/includes/import.class.php
952 /modules/revsliderprestashop/admin/includes/export.class.php
953 /modules/revsliderprestashop/admin/includes/export-html.class.php
954 /modules/revsliderprestashop/admin/includes/newsletter.class.php
955 /modules/revsliderprestashop/admin/revslider-admin.class.php
956 /modules/revsliderprestashop/includes/update.class.php
957 /modules/revsliderprestashop/includes/resize-imag.php
958 /modules/revsliderprestashop/translations/fr.php
959 /classes/Address.php
960 /classes/State.php
961 /src/Core/Security/PasswordPolicyConfiguration.php
962 /src/Core/Configuration/DataConfigurationInterface.php
963 /src/Core/Security/Hashing.php
964 /src/Core/Filter/FrontEndObject/MainFilter.php
965 /src/Core/Filter/FilterInterface.php
966 /src/Core/Filter/FrontEndObject/CartFilter.php
967 /src/Core/Filter/HashMapWhitelistFilter.php
968 /src/Core/Filter/CollectionFilter.php
969 /src/Core/Filter/FrontEndObject/ProductFilter.php
970 /src/Core/Filter/FrontEndObject/EmbeddedAttributesFilter.php
971 /src/Core/Filter/FrontEndObject/CustomerFilter.php
972 /src/Core/Filter/FrontEndObject/ShopFilter.php
973 /src/Core/Filter/FrontEndObject/ConfigurationFilter.php
974 /modules/productcomments/productcomments.php
975 /modules/ps_shoppingcart/ps_shoppingcart.php
976 /modules/iqitcontactpage/iqitcontactpage.php
977 /modules/iqitcontactpage/translations/fr.php
978 /modules/iqitsociallogin/iqitsociallogin.php
979 /modules/iqitsociallogin/translations/fr.php
980 /modules/iqitmegamenu/iqitmegamenu.php
981 /modules/iqitmegamenu/models/IqitMenuTab.php
982 /modules/iqitmegamenu/models/IqitMenuHtml.php
983 /modules/iqitmegamenu/models/IqitMenuLinks.php
984 /modules/iqitmegamenu/translations/fr.php
985 /modules/iqitelementor/iqitelementor.php
986 /modules/iqitelementor/src/IqitElementorLanding.php
987 /modules/iqitelementor/src/IqitElementorTemplate.php
988 /modules/iqitelementor/src/IqitElementorProduct.php
989 /modules/iqitelementor/src/IqitElementorCategory.php
990 /modules/iqitelementor/src/IqitElementorContent.php
991 /modules/iqitelementor/src/iqitElementorWpHelper.php
992 /modules/iqitelementor/includes/plugin-elementor.php
993 /modules/iqitelementor/src/widgets/IqitElementorWidget_Brands.php
994 /modules/iqitelementor/src/widgets/IqitElementorWidget_ProductsList.php
995 /modules/iqitelementor/src/widgets/IqitElementorWidget_ProductsListTabs.php
996 /modules/iqitelementor/src/widgets/IqitElementorWidget_Modules.php
997 /modules/iqitelementor/src/widgets/IqitElementorWidget_CustomTpl.php
998 /modules/iqitelementor/src/widgets/IqitElementorWidget_Menu.php
999 /modules/iqitelementor/src/widgets/IqitElementorWidget_RevolutionSlider.php
1000 /modules/iqitelementor/src/widgets/IqitElementorWidget_Newsletter.php
1001 /modules/iqitelementor/src/widgets/IqitElementorWidget_Blog.php
1002 /modules/iqitelementor/src/widgets/IqitElementorWidget_Search.php
1003 /modules/iqitelementor/src/widgets/IqitElementorWidget_Links.php
1004 /modules/iqitelementor/src/widgets/IqitElementorWidget_ContactForm.php
1005 /modules/iqitelementor/translations/fr.php
1006 /modules/iqitfreedeliverycount/iqitfreedeliverycount.php
1007 /modules/iqitfreedeliverycount/translations/fr.php
1008 /modules/sendinblue/sendinblue.php
1009 /modules/sendinblue/translations/fr.php
1010 /modules/sendinblue/services/ConfigService.php
1011 /modules/colissimo_simplicite/colissimo_simplicite.php
1012 /modules/colissimo_simplicite/models/ColissimoDeliveryInfo.php
1013 /modules/colissimo_simplicite/models/ColissimoDeliveryPoint.php
1014 /modules/colissimo_simplicite/translations/fr.php
1015 /modules/lgcookieslaw/lgcookieslaw.php
1016 /modules/lgcookieslaw/translations/fr.php
1017 /src/Core/Product/Search/ProductSearchContext.php
1018 /src/Core/Product/Search/ProductSearchQuery.php
1019 /src/Core/Product/Search/SortOrder.php
1020 /modules/ps_facetedsearch/ps_facetedsearch.php
1021 /modules/ps_facetedsearch/src/HookDispatcher.php
1022 /modules/ps_facetedsearch/src/Hook/Attribute.php
1023 /modules/ps_facetedsearch/src/Hook/AbstractHook.php
1024 /modules/ps_facetedsearch/src/Hook/AttributeGroup.php
1025 /modules/ps_facetedsearch/src/Hook/Category.php
1026 /modules/ps_facetedsearch/src/Hook/Configuration.php
1027 /modules/ps_facetedsearch/src/Hook/Design.php
1028 /modules/ps_facetedsearch/src/Hook/Feature.php
1029 /modules/ps_facetedsearch/src/Form/Feature/FormModifier.php
1030 /modules/ps_facetedsearch/src/Form/Feature/FormDataProvider.php
1031 /modules/ps_facetedsearch/src/Hook/FeatureValue.php
1032 /modules/ps_facetedsearch/src/Form/FeatureValue/FormModifier.php
1033 /modules/ps_facetedsearch/src/Form/FeatureValue/FormDataProvider.php
1034 /modules/ps_facetedsearch/src/Hook/Product.php
1035 /modules/ps_facetedsearch/src/Hook/ProductSearch.php
1036 /modules/ps_facetedsearch/src/Hook/SpecificPrice.php
1037 /modules/ps_facetedsearch/src/Filters/Provider.php
1038 /modules/ps_facetedsearch/src/URLSerializer.php
1039 /modules/ps_facetedsearch/src/Filters/DataAccessor.php
1040 /modules/ps_facetedsearch/src/Product/SearchProvider.php
1041 /src/Core/Product/Search/FacetsRendererInterface.php
1042 /src/Core/Product/Search/ProductSearchProviderInterface.php
1043 /modules/ps_facetedsearch/src/Filters/Converter.php
1044 /modules/ps_facetedsearch/src/Product/SearchFactory.php
1045 /src/Core/Product/Search/ProductSearchResult.php
1046 /classes/Combination.php
1047 /modules/ps_facetedsearch/src/Definition/Availability.php
1048 /modules/ps_facetedsearch/src/Product/Search.php
1049 /modules/ps_facetedsearch/src/Adapter/MySQL.php
1050 /modules/ps_facetedsearch/src/Adapter/AbstractAdapter.php
1051 /modules/ps_facetedsearch/src/Adapter/InterfaceAdapter.php
1052 /vendor/doctrine/collections/lib/Doctrine/Common/Collections/ArrayCollection.php
1053 /vendor/doctrine/collections/lib/Doctrine/Common/Collections/Collection.php
1054 /vendor/doctrine/collections/lib/Doctrine/Common/Collections/ReadableCollection.php
1055 /vendor/doctrine/collections/lib/Doctrine/Common/Collections/Selectable.php
1056 /modules/ps_facetedsearch/src/Filters/Products.php
1057 /classes/stock/StockAvailable.php
1058 /modules/ps_facetedsearch/src/Filters/Block.php
1059 /src/Core/Product/Search/Facet.php
1060 /src/Core/Product/Search/Filter.php
1061 /vendor/prestashop/decimal/src/DecimalNumber.php
1062 /vendor/prestashop/decimal/src/Builder.php
1063 /src/Core/Product/Search/FacetCollection.php
1064 /classes/ProductAssembler.php
1065 /classes/tax/Tax.php
1066 /classes/Manufacturer.php
1067 /classes/SpecificPrice.php
1068 /classes/tax/TaxManagerFactory.php
1069 /classes/tax/TaxRulesTaxManager.php
1070 /classes/tax/TaxManagerInterface.php
1071 /classes/tax/TaxCalculator.php
1072 /classes/GroupReduction.php
1073 /src/Core/Localization/CLDR/ComputingPrecision.php
1074 /src/Core/Localization/CLDR/ComputingPrecisionInterface.php
1075 /classes/Pack.php
1076 /classes/order/Order.php
1077 /classes/Feature.php
1078 /classes/ProductPresenterFactory.php
1079 /src/Adapter/Presenter/Product/ProductListingPresenter.php
1080 /src/Adapter/Presenter/Product/ProductPresenter.php
1081 /src/Adapter/Product/ProductColorsRetriever.php
1082 /src/Core/Product/ProductPresentationSettings.php
1083 /src/Adapter/Presenter/Product/ProductListingLazyArray.php
1084 /src/Adapter/Presenter/Product/ProductLazyArray.php
1085 /classes/Image.php
1086 /vendor/prestashop/decimal/src/Operation/Division.php
1087 /vendor/prestashop/decimal/src/Operation/Multiplication.php
1088 /vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php
1089 /var/cache/prod/smarty/compile/warehouse/d4/1d/65/d41d65d76b9471b5d365fe06cf1737c89a53af9f_2.module.ps_facetedsearchviewstemplatesfrontcatalogfacets.tpl.php
1090 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_block.php
1091 /vendor/smarty/smarty/libs/plugins/modifier.count.php
1092 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php
1093 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_foreach.php
1094 /var/cache/prod/smarty/compile/warehouse/2e/80/73/2e807335546cfa2360c36327ac89dd2fcb054379_2.module.ps_facetedsearchviewstemplatesfrontcatalogactivefilters.tpl.php
1095 /src/Core/Product/Search/Pagination.php
1096 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/bb/85/6b/bb856bc456eeb8d3881b4b16559692931100cee3_2.file.category.tpl.php
1097 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_capture.php
1098 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/92/5b/54/925b5420d64b948b3229da21ab6dd2ff798a7a1a_2.file.product-list.tpl.php
1099 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/24/3e/71/243e71636e97556888c0393b2f9b2707ca88ed68_2.file.layout-left-column.tpl.php
1100 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/71/d7/35/71d735abfb624f417275d842d825bca284f61193_2.file.layout-both-columns.tpl.php
1101 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/7d/45/b7/7d45b7ec7efac918307809de29557d44680a63e4_2.file.helpers.tpl.php
1102 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_tplfunction.php
1103 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/86/07/8b/86078b28459fa7cd90601729f42410aa6198246a_2.file.head.tpl.php
1104 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/75/a1/41/75a14189d0796b2f1afd51b5286ce629009a30ed_2.file.head-jsonld.tpl.php
1105 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/4f/0b/1f/4f0b1fdd2b9e22e8147a81c8cb2124c0a64a0d9f_2.file.product-list-jsonld.tpl.php
1106 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/53/60/5f/53605fdf8a8949b6a22d2d9cb063fe42d53e06b8_2.file.pagination-seo.tpl.php
1107 /vendor/smarty/smarty/libs/plugins/modifier.replace.php
1108 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/39/a8/b1/39a8b12a758387bfe9a459af55b35aa2633c339c_2.file.stylesheets.tpl.php
1109 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/cd/b1/00/cdb100cf3c2798f0d78781ef17d51d53ad8d6aa3_2.file.javascript.tpl.php
1110 /classes/ProductDownload.php
1111 /src/Core/Cart/Calculator.php
1112 /src/Core/Cart/CartRowCollection.php
1113 /src/Core/Cart/Fees.php
1114 /src/Core/Cart/AmountImmutable.php
1115 /src/Core/Cart/CartRuleCollection.php
1116 /src/Core/Cart/CartRuleCalculator.php
1117 /src/Adapter/Product/PriceCalculator.php
1118 /src/Core/Cart/CartRow.php
1119 /vendor/symfony/symfony/src/Symfony/Component/Translation/PluralizationRules.php
1120 /src/Core/Util/String/StringModifier.php
1121 /src/Core/Util/String/StringModifierInterface.php
1122 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/15/5f/49/155f4970adacdf2bb136d57371ece6919a20a9f4_2.file.product-activation.tpl.php
1123 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/49/3f/fd/493ffd63fb8e54f110fda59bc59cba5f0243b073_2.file.header.tpl.php
1124 /modules/iqithtmlandbanners/iqithtmlandbanners.php
1125 /modules/iqithtmlandbanners/src/IqitHtmlAndBannerRepository.php
1126 /modules/iqithtmlandbanners/src/IqitHtmlAndBannerPresenter.php
1127 /modules/iqithtmlandbanners/src/IqitHtmlAndBanner.php
1128 /modules/iqithtmlandbanners/translations/fr.php
1129 /vendor/smarty/smarty/libs/sysplugins/smarty_template_cached.php
1130 /vendor/smarty/smarty/libs/sysplugins/smarty_cacheresource.php
1131 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_cacheresource_file.php
1132 /var/cache/prod/smarty/cache/iqithtmlandbanners/1/1/1/1/8/displayNav1/warehouse/c7/74/df/c774dfa1ec092af1bad964e2e84d44e094a12e16.iqithtmlandbannersviewstemplateshookiqithtmlandbanners.tpl.php
1133 /modules/ps_languageselector/ps_languageselector.php
1134 /modules/ps_currencyselector/ps_currencyselector.php
1135 /var/cache/prod/smarty/compile/warehouse/b9/77/56/b97756c07f8c7dd53da6530f78f67ddd242f77c9_2.module.ps_currencyselectorps_currencyselector.tpl.php
1136 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/16/a1/8f/16a18f495002f0441eaa5151434d5866441bac65_2.file.header-2.tpl.php
1137 /modules/iqitsearch/iqitsearch.php
1138 /modules/iqitsearch/translations/fr.php
1139 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_method_gettemplatevars.php
1140 /var/cache/prod/smarty/compile/warehouse/78/3c/e0/783ce0bc99544193d9645b02e003b32e879d6a43_2.module.iqitsearchviewstemplateshookiqitsearch.tpl.php
1141 /var/cache/prod/smarty/compile/warehouse/46/29/db/4629dbb3c4efa13c090c633dc2e46e5f2b42bed3_2.module.iqitsearchviewstemplateshooksearchbar.tpl.php
1142 /modules/ps_customersignin/ps_customersignin.php
1143 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/72/be/19/72be192e406191c1cad554abe284e159adeb4234_2.module.ps_customersigninps_customersigninbtn.tpl.php
1144 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/b4/a4/76/b4a476e0a8201677b298f7c0f8ca1ac698e1bac3_2.module.ps_shoppingcartps_shoppingcartbtn.tpl.php
1145 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/35/65/5e/35655e6409b6198f29dd6e732ef9598dec599880_2.module.ps_shoppingcartps_shoppingcart.tpl.php
1146 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/f6/e9/f2/f6e9f2b1680a466582d2199d038efe2cfa3a83f7_2.module.ps_shoppingcartps_shoppingcartcontent.tpl.php
1147 /var/cache/prod/smarty/cache/iqitmegamenu/index/1/1/1/1/8/warehouse/12/c6/31/12c63107907c6d214b90e77509786468cad41332.iqitmegamenuviewstemplateshookhorizontal.tpl.php
1148 /classes/CMS.php
1149 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_updatecache.php
1150 /var/cache/prod/smarty/compile/warehouse/79/74/04/797404135c3d6163c184d5946c377ac2bc91c4d2_2.module.iqitmegamenuviewstemplateshookhorizontal.tpl.cache.php
1151 /vendor/smarty/smarty/libs/plugins/shared.mb_str_replace.php
1152 /var/cache/prod/smarty/compile/warehouse/47/0d/5c/470d5c96fd175e37e89afd5cc78d331c9756e29d_2.module.iqitmegamenuviewstemplateshook_partialssubmenu_content.tpl.cache.php
1153 /var/cache/prod/smarty/compile/warehouse/98/cb/9e/98cb9e3fbf4c879e219db3109049550b02a2da1b_2.module.iqitmegamenuviewstemplateshookmobile.tpl.cache.php
1154 /var/cache/prod/smarty/compile/warehouse/56/f0/d4/56f0d4faf7cc1ec9240e891fedda6e0b4794dc62_2.module.iqitmegamenuviewstemplateshook_partialssubmenu_content_mobile.tpl.cache.php
1155 /var/cache/prod/smarty/compile/warehouse/9b/b6/a9/9bb6a9970aa01b8fd3c752c16e574cb1b14bf323_2.module.ps_languageselectorps_languageselectormobilemenu.tpl.cache.php
1156 /var/cache/prod/smarty/compile/warehouse/dd/65/22/dd6522dbacb2ead7139cef7a64e59ac80e0726fc_2.module.ps_currencyselectorps_currencyselectormobilemenu.tpl.cache.php
1157 /var/cache/prod/smarty/compile/warehouse/d3/f6/c8/d3f6c8247111f1ef9bebabfff451b9cb9207ba0b_2.module.ps_customersigninps_customersigninmobilemenu.tpl.cache.php
1158 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_codeframe.php
1159 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_writefile.php
1160 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/27/7f/d3/277fd37fbd4e3d5997a6729163ed4291fb7b747e_2.file.mobile-header-1.tpl.php
1161 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/7a/30/38/7a3038780284d52e9fcd7a66e51e5b86a166106b_2.module.iqitsearchviewstemplateshooksearchbarmobile.tpl.php
1162 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/be/ee/e6/beeee6f3d87613010f8af1cabc4c4562f8cf600a_2.module.ps_customersigninps_customersigninmobile.tpl.php
1163 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/d4/e1/57/d4e1571b6b210795247564db06deb17061778b51_2.module.ps_shoppingcartps_shoppingcartmqty.tpl.php
1164 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/9a/64/f3/9a64f33010c8c3420bbc410257bdb57f0a9bc3be_2.file.breadcrumb.tpl.php
1165 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/d4/35/7f/d4357f43e19050f2d2f2028e6f165cd3b7cc2cd7_2.file.notifications.tpl.php
1166 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/a7/28/48/a72848955674ed794c6c6a5e504b11a1cb173ed8_2.file.category-header.tpl.php
1167 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/92/94/ca/9294ca5ac8cef4c021336349ebba4cf8ccc608a1_2.file.products-top.tpl.php
1168 /vendor/smarty/smarty/libs/plugins/modifier.regex_replace.php
1169 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/83/e9/08/83e90827ba40fafa2a771c4073ac57f31928625e_2.file.sort-orders.tpl.php
1170 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/18/fe/cb/18fecbdf20428cf6869837dea2e0d5ca5dd8d3ec_2.file.products.tpl.php
1171 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/3f/3e/f7/3f3ef74c741ca95575dc32ec76705f946e3422a0_2.file.product.tpl.php
1172 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/0d/c1/99/0dc199c5d12599ceeb88b6a2b1d98a7a56f14314_2.file.product-miniature-1.tpl.php
1173 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/b6/dd/21/b6dd2164727c4f6493fca8e8e7fc27495f5e513d_2.file.product-miniature-thumb.tpl.php
1174 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/56/c3/f2/56c3f2a516718b563166d070fcdb1702f53c5b74_2.file.product-miniature-btn.tpl.php
1175 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/c3/b4/5d/c3b45dd17613497fe3573058ca4c0e68116beb49_2.file.pagination.tpl.php
1176 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/d7/38/da/d738dab394eb6986b6d095fda5b79bd9db20b43b_2.file.products-bottom.tpl.php
1177 /modules/ps_categorytree/ps_categorytree.php
1178 /var/cache/prod/smarty/compile/warehouse/89/21/00/8921007f54626fc7fe42cbff53f1d70828d3393d_2.module.ps_categorytreeviewstemplateshookps_categorytree.tpl.php
1179 /var/cache/prod/smarty/compile/warehouse/81/a1/04/81a1040ed0eeab6f58198f9907167c7fced628c5_2.module.ps_facetedsearchps_facetedsearch.tpl.php
1180 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/a1/9f/e0/a19fe04169c26490610977ee4790590b01e18353_2.file.footer.tpl.php
1181 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/49/8a/94/498a94e3fb2e357d8f6d4e4c267d7b70c033a1c3_2.file.footer-1.tpl.php
1182 /modules/iqitlinksmanager/iqitlinksmanager.php
1183 /modules/iqitlinksmanager/src/IqitLinkBlockRepository.php
1184 /modules/iqitlinksmanager/src/IqitLinkBlock.php
1185 /modules/iqitlinksmanager/src/IqitLinkBlockPresenter.php
1186 /modules/iqitlinksmanager/translations/fr.php
1187 /var/cache/prod/smarty/cache/iqitlinksmanager/1/1/1/1/8/displayFooter/warehouse/a3/94/0b/a3940bd1d7ebdb077f5394215b97cf9d975f5741.iqitlinksmanagerviewstemplateshookiqitlinksmanager.tpl.php
1188 /var/cache/prod/smarty/cache/iqitcontactpage/1/1/1/1/8/warehouse/c4/e5/8b/c4e58ba5baab27adb5450fcac6725664cd1cef81.iqitcontactpageviewstemplateshookiqitcontactpageblock.tpl.php
1189 /var/cache/prod/smarty/compile/warehouse/ee/75/26/ee752603de038a9aef5378771f6bf531aa9e40f3_2.module.iqitcontactpageviewstemplateshookiqitcontactpageblock.tpl.cache.php
1190 /var/cache/prod/smarty/compile/warehouse/44/b4/ef/44b4ef888deb2f933dcd9da2c1066fcd712ea5c6_2.module.iqitcontactpageviewstemplateshook_partialscontent.tpl.cache.php
1191 /var/cache/prod/smarty/compile/warehouse/2d/c2/29/2dc229bcd2fcd72db57e2012572582b00bdf5abe_2.file.cookieslaw.tpl.php
1192 /vendor/smarty/smarty/libs/plugins/modifier.escape.php
1193 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/63/d3/ad/63d3adee5f6b5e391329228d089f792c3bb82b69_2.file.social-links.tpl.php
1194 /var/cache/prod/smarty/compile/warehouse/30/7d/c6/307dc6bd4724d29d1572cc301dd7148e962604ef_2.module.ps_emailsubscriptionviewstemplateshookps_emailsubscription.tpl.php
1195 /modules/psgdpr/psgdpr.php
1196 /modules/psgdpr/translations/fr.php
1197 /modules/psgdpr/classes/GDPRConsent.php
1198 /var/cache/prod/smarty/compile/warehouse/5e/ee/24/5eee242e5cbca9bb89b8ffa439cebef7beaaf2e4_2.module.psgdprviewstemplateshookdisplayGDPRConsent.tpl.php
1199 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/16/d6/b8/16d6b8721374815caf8784f27e2d077ed824ca86_2.file.footer-copyrights-1.tpl.php
1200 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/22/f3/55/22f35596a1c264e5427f9b58f5206b3b8a797425_2.file.password-policy-template.tpl.php
1201 /modules/statsdata/statsdata.php
1202 /classes/Connection.php
1203 /classes/ConnectionsSource.php